4BXWA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
322
structure length
286
Chain Sequence
b'CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR XA
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
total genus 69
structure length 286
sequence length 322
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxwA02
2J2UB 2GCHG 2QC2A 1JL9A 1QRXA 2A7JA 4O03A 3U1JB 4ZH8B 5FBIA 1O2MA 1VGCC 2XWBI 2QGRA 2FLRH 1BCUH 1DXPA 1GHBF 2Y5HL 1IQEL 3ASIA 1H9HE 1K22H 1O38A 4Z0LA 1TA2A 2ZDAH 6ESTA 4COXA 1F0TA 3QLPH 4I8HA 2ZGXH 3TNSA 3ZYIB 1GCDA 4AB8A 4K60A 1UTOA 3ZVFA 3T62A 1V6DA 3D62A 4MPWA 4LOYH 1SHYA 1TFXA 3STJA 2KB9A 2Y7XA 3KRKA 4Y6DA 3N8WA 1MQ5A 3UNRA 1IGZA 1C1WH 2H1UA 1C5QA 2SGPE 2BD5A 2GCTB 1W8BH 4Y79A 2W3IB 3M7TA 7KMEH 1W3CA 1HAEA 1F0UA 2FX4A 1P9UA 2B7DL 1T8NA 3ZYGA 1UZPA 4RRYA 3SU6A 4BDWA 2FOAA 1QA0A 3PWBA 2BQ7B 1TPOA 1O35A 4BAMB 5CHAC 1LMJA 1HAGE 1P3CA 3TGJE 1OWEA 1BMLA 2ZFFH 3PO1B 4DVAU 5GPIB 2FXRA 2AGGX 1T4VH 4DOQA 4YLUA 4GAWA 2MHPA 4MPUA 3F6UL 3EDXB 2RG3A 4I8JA 1OP0A 3NKKA 2WFTA 1T7CA 2VIWA 2BDBA 4ABFA 1K1NA 3ATWA 2J4IB 3KK6A 1UTMA 2A1DB 1C1PA 1GHAF 1QBVH 3NZIA 3MO9A 5CKMA 2G00A 3VXEH 1G30B 3VB6A 1BOQA 2VGCC 4ZHMU 1GBJA 2GD4B 1ZYOA 1UHBB 1EPJA 3RXAA 4Q7ZA 1GVLA 1KIGH 1HAOH 2H5DA 3CS7A 3ELAL 4OGXA 1ATDA 1P57B 1KDQA 1TPAE 3U9AH 1V2NT 2BDAA 1TE0A 1DE7H 1C1MA 3Q3YA 1K1JA 3RXSA 2WYGA 4MPVA 3GYMA 1SGFA 2QXGA 2F91A 2WV5A 1JBUL 4AGJA 4A7IB 4PH9A 4BAOB 2AMQA 1EZQB 4O3UA 5JW1A 1MCVA 4XSKU 2ZQ2A 3KL6A 1CGJE 1FIWA 1O2RA 4AB9A 4GHTA 3RXTA 4LZ4B 1PPFE 3ATLA 2BZ6L 4GVUA 3RXFA 3TBDA 2OQUA 1P12E 1GBEA 1OP8A 3JZ2B 3V65B 1P0SL 3MNXA 2AYWA 1DM4B 1NFWB 1EQGA 1T31A 4D0FA 1AVGH 2BM2A 3LC3A 4WH8A 3TH3L 1XXFA 3VB5A 4NGAH 1APOA 3A8CA 2DE9A 2WG4B 1GMCG 1UTJA 1J9CH 1YPHC 3TH4H 2H9EL 1NQLB 2AEIH 5LGOA 5C2ZA 3JZ1B 2D1JA 3NXPA 1Q2WA 1ZRKA 2IPHA 2Y81A 5FAHA 2BD2A 2HOBA 3HO3A 2Y5FA 1C5NH 2PSXA 5ETXA 1O0DH 1ETRH 2ZDNA 1TX7A 2VVUL 1EATA 2VIDA 4JYUL 1O32A 3ITIA 3BT2A 4AG1A 5CISA 1HJ9A 5GWZA 3MH4A 2XBXA 1XUKA 2VWNL 1MOXC 2OC8A 2M74A 4NIXA 4GCHG 1GI7B 4K69A 5L2ZL 1AFQB 4UONA 1NT0A 2YNBA 3K9XB 4CBOA 3TZIA 2ZDKA 1W14U 3SJ9A 3VXFH 2EC9H 2AYLA 4KGAA 1P04A 3PMHB 2HNTC 1H8DH 1OWKA 4Y8XA 1OP2A 2O8WA 1JRSA 1WU1B 2WPIE 4K1EA 5F03A 3SORA 4X8TH 3BEFB 1EPGA 3RM0H 2TGPZ 1GMHF 1C1QA 1L2EA 1CT0E 2ZCLP 1KSNB 2VJ1A 1TQ0B 5LPRA 2ZPQA 2ZU5A 2GKVE 3ZVCA 3GCXE 2ZFRH 6CHAB 1GJCB 1BJUA 3FP8E 3M36L 1LVOA 3TK6A 1TPPA 1FY1A 3BTDE 5GXPA 2DUCA 2VVVL 4JYVL 1YUKB 1HAIH 4IC5A 1XUJA 1ZPZA 1FI8A 2OCVB 1H9LB 4CRFA 2D8WA 1P01A 3KNXA 3T26A 3AW1A 1K21H 2P3FL 1GBAA 1TLEA 1O3CA 1AB9B 1P2IA 3BG4B 3FANA 5TCAA 1MQ6L 2F9OA 4Q7YA 3PM3A 3U8OH 1OYTH 1NPMA 4B74A 2F9VA 1AZZA 1PPCE 1CA8B 3E1XB 3DT0H 1MTNC 2XBYA 2SNWA 3M3SA 1G3EA 1C2LA 2FYQA 1YF4A 4CR9A 1EKBB 2QYIA 1EOJA 2FWWA 1SSXA 2OC1A 1P2KA 1G37A 1L5GB 3D65E 2BQ6B 5GJ4B 4ISHL 3SGQE 2VIVA 4MG3A 1LPKA 1TNGA 1QB9A 1DY9A 4ZMAH 4MMZB 1E0FD 3FAOA 1V2VT 1A1RA 1QL7A 2ZZUH 3EGFA 3I29A 1G2LA 1P03A 1QBNA 1BRAA 3P8GA 4YZUA 2Z3DA 4UE7H 2A2QH 4Y7AA 5C3NA 1O36A 2VB0A 1EJNA 5DP3A 2VH6A 1E38B 3BTGE 1SGPE 2BDHA 4FUJA 2W26A 1TX6A 2Y80A 1BTWA 3UTUH 1DQBA 1V2RT 2OLGA 3ATIA 1ZSKA 2ANMH 3CA7A 1SLUB 2BOHA 5IKTA 1B9WA 3KQDL 1UTPA 1SVPA 5T6GA 2Y7XB 4WMDA 4Y6DB 3N8WB 3M37L 2NU0E 2R3UA 2XC0L 1L3YA 1A3BH 1C5WB 1CQQA 1O5BB 5L2YL 1ARBA 4K1SA 3SJ8A 1ZHPA 5F6MA 1SBWA 1AUTL 1BMAA 2GT7A 5FPSA 4AFUA 4X8SH 4CRDA 1EJAA 1KXAA 5EPYA 1EOLA 2ZCKP 4FUGA 2G81E 4AZ2B 2BYAX 7GCHG 1KXCA 2W2NE 3LJJA 4J2YB 1LDTT 3ELAH 1WTHD 4U2WA 2Z9GA 1DUEA 1LO6A 1GCTB 2HPQH 4ISIL 1YCPH 4E06H 2OC7A 3Q3XA 4ZHAA 2J95A 2W3KA 1IHSH 1O30A 3A8BA 4IMQA 2XRCA 2ZGHA 4I7YH 4DCDA 3KQEL 2Z3EA 1XDTR 5DG6A 1W10U 1MUEB 1O2XA 2R2WU 3D49H 1UZKA 3LN1A 1G3DA 1ELFA 1CA0B 4OS5A 1PFXC 1ELGA 3M7UA 4X6MA 2K1QA 4YOIA 1HXFH 2GVFA 1EQHA 2BZ6H 1KTTB 1UZJA 3RXOA 4O3TA 3QO6A 1LPGA 1KYNA 1IQLA 2FI3E 1LVBA 1KDQB 4ZAEA 3DUXH 2UUYA 3SNEA 1KLJL 1EP6A 3PTNA 3ZVDA 1BZXE 3FVFB 2J94A 4B73A 3LN0A 5C1UA 4B75A 2FP7B 3TH3H 4H6SB 2H2ZA 2WYGB 1JMOH 4I33A 3TH2H 1ESTA 1GI5A 2OP9A 5F8ZA 3QN7A 5FX6A 2JH5D 5EW1H 4UD9H 3PLBA 3GY7A 1AHTH 5A0BA 3P8NA 2JH0D 4IS5A 3ZZ7A 1OOKB 3KL6B 1O34A 4VGCB 4TWYA 1A5HA 3MU8A 2MGRA 4ZKNU 4DT7B 2H9HA 3GCHB 1FNIA 4Z0KA 4ESTE 1W13U 1ZZZA 2FLRL 1XVOA 5AFZH 1E36B 3ESTA 4A1XA 1CX2A 2BX3A 5E2OA 1NO9H 1X7AL 4HTCH 3PTBA 4ZHLU 5JBTA 4WXVA 4X1SU 3V13A 3LC3B 1GJDB 2G5NA 1PJPA 4CSYA 1SQOA 2Y7ZA 1GJ8B 1AUJA 3ZZBA 4R0IA 1L4DA 3HS6A 3LH3A 2D1JB 1UVOA 3LC5A 2Y81B 1VGCB 3NK8A 5AVDA 3TGIE 3U7UG 1OX1A 3L33A 6GCHG 2ZKSA 1DLKB 1O5CB 5EGMA 3TJNA 1RIWB 1KTSB 5LPEA 2OINA 1ZTLA 1Z6EA 1XX9A 1W8BL 3BIUH 3Q00A 2KAIA 1HAFA 1IVOC 1TOZA 2ANWA 1EMOA 1P3EA 1C5MD 1GHBG 3URDA 1O2GH 2FLGA 2P8OC 1FSBA 3FP6E 5T6FA 4JCNA 2XC4L 4WMFA 1LKAA 3TU7H 4U32A 1ZPBA 3RLYH 4A1TA 2ILNA 4ABHA 3GCTF 4RSPA 1NU7B 4IW4E 4NFFA 1SR5C 3IG6B 2ZPRA 1OWHA 1O3KA 4WJG2 1AMHA 2A4QA 2CHAB 1W12U 2SNVA 3MTYA 4F49A 2A2XH 5J4SA 4ABBA 1D3QB 1GI9B 2WPKE 1FY3A 3TITA 1HLTH 1GBTA 1IOEA 5CHAB 1ANEA 3TK6B 1YPGH 1HT5A 2MGPA 3AAUA 1HNEE 3KQCA 2G5VA 3LU9B 3SU2A 1NRSH 4BDXA 2Y38A 1ATAA 1CHOF 3SUGA 3HGPA 1VITF 3ZYJB 1DT2A 1B0EA 1V2OT 4ZROA 1EUFA 1BMMH 5EW2H 1O39A 1FN6A 3ENSA 1UO6A 1Z6CA 3F9HA 2VU8E 4UEHH 1F0SA 5GCHF 3ZVAA 2BB4A 1MD8A 2CF9H 3A83A 3TJOA 1GJ9B 1ORFA 1ANDA 1DY8A 1JRTA 1O3LA 3HS5A 1ELBA 5DP6A 6COXA 3RP2A 5K0HB 1WAYB 4QT8C 2GZ8A 3IWMA 3HO5A 1V2MT 2XC5L 1IQGA 1D3PB 2V3OH 1MKWH 1D3TB 1D4PB 4CR5A 3BF6H 1YCPK 1LPKB 1N7DA 1FY5A 1SOZA 3IJEB 4XBMA 1A7SA 1Y5AT 4MDSA 4WH6A 1P9SA 1EQ9A 4I8LA 1G2LB 4FM5A 1TGNA 5A8YA 1HREA 1IJQA 4YZUB 3MO6A 1J9CL 5L2YH 1AGJA 1MKXK 5EODA 2Q1JB 4Y7AB 1CGHA 4K2YA 1BHXF 1ABJH 1V2PT 3U98H 2AMPA 2VH6B 1OS8A 3UREA 4X6NA 1TBZH 2W26B 1J14A 3GY4A 1HUTH 3K6YA 4Q7XA 1O3AA 2Y80B 1HAVA 1SGNE 3H5CB 3A80A 1XUFA 3SHCH 3NJPC 2Z7FE 4JK5A 1K1MA 1QA7A 4RN6A 5JPMH 4ISIH 2HWLB 2BOHB 4WVPE 5COXA 4D90A 3MU4A 2K2TA 4XLWA 4CRCA 3RU4D 1ZR0A 2FOGA 1BRBE 4H42U 2P28B 1CHGA 1YPKH 3GCOA 1GJ4H 4UFFH 1PPGE 4I8KA 3FP7E 2ZO3H 1C1OA 1EBVA 1EZSC 2PR3A 3FCSB 5AFYH 4ABJA 1BTUA 4U30A 4WMEA 4X2XA 4BANB 2ZQ1A 4OS1A 1ZAQA 2OTVA 3V3MA 5C67A 1D6WA 4X8TL 1C2FA 5IDKA 1EAIC 2GDDA 3RXKA 1Y3VA 3H7OA 8GCHF 1GL1A 3SBKA 1MBMA 3NTGA 1MAYA 1HAYB 4ZHAB 2J95B 5EPNA 1FJSL 2W3KB 2BD3A 2O8MA 4BOHA 3RXVA 2ZU1A 3HATH 4UFEH 2BX4A 2ZFQH 2GP9B 3EQ0H 3MU5A 2FM2A 2EI8A 4X1RU 2STAE 1AE8H 2V3HH 2WUCA 3LH1A 4INHA 4PROA 3A7YA 4MMYB 4AORA 4B1TA 4BTUA 3UQVA 3KQBA 1PPHE 4MNXA 5FCKA 3HKIB 1ZHMA 2UUJB 2XNIA 3RM2H 1XVMA 3PYHA 1BRCE 5LH8A 1ZPCA 1GGDB 1G3CA 4I31A 1LPGB 1LVMA 1O3BA 1DIYA 1BTHH 3SV8A 3T5FH 1GBKA 2PHBA 3MOCA 1HDTH 4GHQA 1SGIB 4Y0ZE 1A0LA 3TGKE 2H5CA 1EZUC 4NIVA 3E90B 2VIPA 4RRZA 1O3EA 2CMYA 1UTQA 2PTNA 3RXDA 1C4U2 2VWLA 3S69A 1CU1A 1DWDH 4YT7H 5TJXA 1CVUA 1K2I1 1TMTH 1KY9A 1W7GH 2GTBA 2ZTZA 1P11E 3TK9A 5I25A 2TRMA 1JIRA 5FCRA 1BT7A 3O8RA 1DPOA 2QN5T 1LHEH 1ZSJA 1C5YB 3SI4H 1UK4A 2YGPA 1RJXB 2RDLA 2UWOA 3GDUA 1Q3XA 2UUFB 2BDGA 3KCGL 2B8OH 4Z0KB 1MTNB 4IMZA 1A0HB 3E0NB 1IQFA 1RD3B 1ZHRA 2HVXA 4ZXXH 4CHAB 3MO3A 1ELCA 2VWOA 2F9BL 3RC6A 1C1UH 1KLTA 4M11A 1TGBA 2ODPA 3RC5A 4D7GA 2XYAA 2W5EA 1CBWC 2P16A 2ZDLA 2AS9A 3Q3KB 3LGYA 1DLEA 4MVNA 2O9QA 3GDSA 2Y7ZB 5CKNA 2Y82A 1IGXA 1JXPA 1GHXH 1MD7A 5C1XA 2ZTXA 2EI7A 3LC5B 3M3TA 4AFZA 1FDPA 1YUFA 3SV2H 2Y5HA 9LPRA 2FTLE 1IQEA 3UPEA 2AH4X 3F9GA 3BT1A 4NA9L 5EGMB 1KXEA 1TRMA 4MQAA 1LKBA 3M5MA 4AFQA 7LPRA 1PQ8A 1OYQA 3LPRA 1ACBE 4TWWA 4X8SL 3TJVA 1FF7A 1UTLM 2KAIB 1FAXL 4ABEA 1TPGA 1EJMA 1MKWK 1S82A 3UR9A 1O3IA 4OS7A 3TK5A 3CP7A 1MTUA 1O33A 2GX4A 1THSH 1QQ4A 3LDXH 1XM1A 3HO4A 3FBYA 1PRHA 2ZHDA 4OS2A 1ZMJA 3T29A 1S81A 1ZTKA 5PTPA 3ZZ3A 3ZZDA 2FS8A 1YO8A 2BDYA 4Y8ZA 4C16A 1FV9A 1GHWH 3UWJH 1SG8B 1W11U 1T8OA 1YCPM 2FOBA 2XBVL 1P2OA 2BTCE 2NU4E 3DFJA 1VCPA 1O31A 3BTEE 3LGIA 2ZA5A 4X0WU 1KXDA 2VJ3A 4NSVA 2ZI2H 1L4ZA 4MTBA 2VWMA 1DX5M 1F0RA 1EPTC 4OTJA 1RTFB 4Y10E 1O3OA 2B0FA 4NCYA 1SQTA 3SU0A 4FUFA 1K36A 2J34A 2P93A 1NRPH 4JZIA 1WV7H 3WY8A 3S9CA 2F9PA 1DWCH 3ENSB 3O8BA 1MU6B 1F0SB 2P3UA 1APQA 3T2NA 4D9QA 3A88A 3Q7DA 1ZRBA 3VFEA 5HGGA 1T32A 4BTIA 1ELVA 1BB0B 3EYDA 1IAUA 2HGTH 5DP9A 3RXQA 3SNBA 1SC8U 4AOQA 1ZJDA 2FOFA 4B2CA 4Y7BA 3POYA 5A8ZA 1TMUH 1G36A 5F1AA 2OXSA 3SV9A 1BUIA 1WOFA 2AGEX 4ASHA 3OLTA 3EGKH 2P3TB 5JBAS 4LORA 2PW8H 4X6OA 1Z8JB 2ZGCA 4TPIZ 1C1NA 1O2KA 1HPGA 1THPB 1V2QT 3RXIA 4E7NA 9ESTA 4D8NA 3UIRA 1TGCA 1J17T 3A86A 3U1IB 2R0KA 3V0XA 1DX5I 1K37A 4DIHH 1FAKH 1GDNA 3U73A 3RMNH 4AYYB 5EXMA 1LTOA 4HZHA 1C2DA 1NRQH 1HAVB 2R0LA 1EPHA 3ZVGA 2PSYA 1DWBH 2ZF0H 2GCHF 4Y71A 3BTME 1GPZA 2VVCA 1QFKL 1W7XH 3SI3H 5CKQA 5JDUB 4FXGH 3LGWA 3F9FA 2RNLA 2IOTA 3SU1A 1P2JA 1YPMH 3ZYDA 2OC0A 1BA8B 1VR1H 2ZPSA 1AUTC 1WUNH 1TOMH 4TY7A 2PR3B 2WFXB 1O2PA 2I9BA 2ZNKH 1TX8A 3SOSA 5DKMA 2ZU3A 1GJ6A 3GYLB 1ELTA 2CN0H 3MH7A 1PGEA 3VGCC 3ZZAA 1O2OA 1AKSA 1Y3WA 2BD8A 2P8OB 2ZHEH 1IQJL 2ZWLH 1QQUA 2V35A 1O5EH 5A2MH 1TBRH 8LPRA 5AF9H 1ESBA 3A7WA 3RXLA 4ZUHA 3QGNB 1TGTA 1G3BA 4HFPB 2FYRA 2EI8B 3OX7U 1LVYA 1DDJA 1V2KT 2BDCA 2FESH 1XKAL 4ABGA 4RRXA 5IKVA 4RS0A 1CT2E 1TIOA 3OTJE 2HRVA 2PWXA 3A81A 1A2CH 1FQ3A 2QF0A 1SGYE 1BF9A 1C1VH 3OSYA 3KCGH 2VIOA 2DDUA 3GCTG 1NFUA 1RRKA 4THNH 1NFYA 4ZXYH 3A82A 3M36A 2UWLA 2ZGJA 2F9BH 2PHBB 3M7QA 2GZ9A 2PTCE 1TABE 1F7ZA 2VVVA 3PLKA 2PUXB 5A09A 2G55A 2ZEBA 3SJOA 1EB2A 1Y3XA 3SQHE 1DFPA 3A87A 1UCYE 1FE2A 3MQEA 2V6NA 1SB1H 1ETSH 1E34B 4UFGH 1MQ6A 5A0AE 4DIIH 2ODYB 4IC6A 2BY9X 1SI5H 5JVZA 1V3XA 2JETC 1HV7A 4XBBA 3BPSE 3RXEA 2UWOB 4NA9H 1GBCA 2GV6A 1O2UA 1OWDA 1KXBA 3DEMA 1GG6C 4X6PA 4CRGA 1X7AC 3W95A 2P3FN 3S7HB 3SJIA 4Y79B 1AWFH 2A45B 4TGFA 2VNTA 5F8XA 1EAXA 3F68H 2WPHE 1PYTD 1EAUA 2Y6TA 1ABIH 1O2WA 1O5FH 2LPRA 1O2HA 2F9UA 3S9AA 2C8XB 4LMFA 1AVXA 2Y82B 5FBEA 3SGAE 2GZ7A 2JH6D 1QRWA 3ZZ5A 4D0EA 4AFSA 2EI7B 3NUMA 1G32B 3UNSA 3B23B 3QMOA 2WYJA 1FIZA 3MHWU 4X8UH 1TRNA 1KLIL 3HK6B 1TBQH 1BBRE 3SOQA 5E0HA 1S85A 5IKQA 4FUDA 2NWNA 2O8LA 1EX3A 2BOKA 3S0NA 3T27A 3TJUA 2XBWA 2QXJA 5FXLA 4FVDA 3E8LA 1YYY1 4Z6AH 2F3CE 4INLA 1MKXH 1ZMNA 2ZFSA 3BTKE 5BRRE 1GMCF 3W94A 3TK5B 1HAZB 3EA7A 3HS7A 1GI1A 4H6TA 2JKHL 3SOBB 3A7ZA 4BXSA 1G2MA 4G1MB 1SFIA 3UQOA 2GT8A 2ZU4A 3DFLA 3OYPA 3V7TA 4A1VA 2W2QE 4JZDH 2P94L 1P2MA 3SU4A 1N8OC 1SLWB 1WHEA 1H9IE 4FU7A 1T8MA 4A92A 3IITA 1S5SA 4AG2A 1HAPH 1C5OH 4ZH8A 2WPIS 2PGBB 3BIVH 4GCHF 4K3JA 2ALPA 4YOGA 4HGCA 5E8DA 1GMDG 4I32A 3ZZ8A 2G4TA 1GBMA 3ATKA 1FPHH 4FUCA 1F0RB 1DANH 1GI3A 5HM2A 1VCQA 1LHFH 3LONA 1IQNL 3BTHE 4ISLA 3KQEA 1TMBH 2ALVA 4XDEA 3RLWH 1EXFA 1TGSZ 2J34B 1IQML 3VEQB 1AFQC 4DURA 1NPEB 2BLVA 4E7RG 3H7TA 8GCHG 1LHDH 2GMTC 2P3UB 1A61H 2BY5X 4YT7L 5DGJA 1OPHB 1OWJA 3HPTA 2Z6BD 4BTIB 3M5OA 2TIOA 1VITH 1YGCL 5EOKA 4WWYA 3TGFA 1GVZA 3MU0A 1EB1H 2QIQA 1LCYA 3GY8A 2Y5GL 3LTGD 4Y7BB 1I0UA 4ZXXL 1HBTH 3A8DA 4BTTA 1SGQE 3O8CA 1GI0A 3P70B 2BQ7A 2ZHQH 1GBFA 6CHAC 1QFKH 1IOEL 1C9PA 1O3JA 3QZQA 3U8TH 1G1SA 2P95L 3O8DA 4KKDA 1GDQA 3KEEA 1N6YA 3DD2H 1ELAA 2O8TA 3P8OA 1NU9A 4BNRA 1H4WA 1JWTA 3M5LA 5A0CA 5DO4H 1TA6A 1AB9C 1SQAA 4JZEL 4AGKA 4KELA 2ANKH 3Q77A 3KHVA 1DDXA 1HRFA 1V2TT 3P95A 1A5IA 4X8VL 5DP4A 2GD4A 1UVPA 2FOHA 2HLCA 2SGAA 1UHBA 1CBWB 3M5NA 4OS6A 1QJ1B 3A7XA 4CUDA 2FPZA 4Y71B 1FN8A 2A7HA 1SZBA 1F92A 2BD7A 2ZHWH 5CMXH 4CREA 1W0ZU 2CGAA 4B76A 2D2DA 1V2ST 1MMJN 1DXWA 2C8YB 1IQGL 3OLUA 4O02B 1IQKL 3A7VA 1OB1C 3NT1A 1GHYH 1N1IA 4TPYA 2OD3B 3E0PB 1QB6A 2ZGBH 5EQRA 3RU4T 4O97A 3LKWA 1GI8B 1C5SA 4K8YA 4M7GA 4YM9A 1Q4GA 1P2QA 1TRYA 1QIXB 5DP7A 1E35B 1TWXB 3CENA 1ARCA 1ZGIA 2GGVB 2J9NA 1YC0A 2VGCB 2WPHS 5BPEA 3T28A 1IP0A 3AAVA 1ZTJA 3RMOH 1AKSB 3K2UA 1C5MF 2AERH 2V0BA 3M35A 2QF3A 1QHRB 1XUIA 1Q31A 5HYOA 1T4UH 1GHAG 1NFXA 1EZXC 1ZJKA 2PKAA 3SNCA 3ZZ9A 4NZQA 1IQIA 1RXPA 1IHTH 3FFGA 2P26A 4INKA 1O3MA 1ANBA 1THRH 3OU0A 3BV9B 2TGFA 1Z1JA 2VINA 1Z8IB 1AVWA 7GCHF 3N8YA 3TLOA 2G52A 4I8GA 1HRTH 2C93B 1LQEA 2Z94A 5FDQA 3MNSA 1K9OE 1GBIA 3SHAH 1GI6A 1GJBB 3GCNA 1NFUB 2UWLB 1BDAA 1FY4A 1HCGA 2Q6FA 4ZKOU 3QK1A 4A6LA 1C2JA 5F19A 1IQHA 1V2WT 4DW2U 1SGTA 1XUHA 1DVAH 1UCYH 2ZHFH 2PV9B 3TVJB 4BAHB 1SOTA 2UUKB 2Z3CA 3PGHA 2OYEP 1SGRE 1TONA 3SN8A 1AQ7A 4JK6A 1V3XB 1KLIH 4XE4A 5G4BA 1C2GA 1NZQH 3NWUA 3V64C 3K65B 4DG4A 1UJ1A 2TGTA 1DOJA 1XXDA 2C3SA 3QTOH 2GDEH 5DK1A 2C8WB 4BXWA 2PFEA 2ZP0H 3RXBA 3MH6A 5LPFA 1ID5H 3KQBL 2FI4E 1ZMLA 1O2LA 3QUMP 1B0FA 2B9LA 1FAKL 5HMAA 3VB4A 1N1LA 2FZZA 1PYTC 1C4V2 1ZGVA 1LMWB 1BTPA 1FY8E 5L6NH 2OYUP 3PMJA 1VZQH 3RUOA 5JBBE 3F1SB 2WYJB 3QH0A 5GDSH 1W7XL 2EEKA 2RA0A 1WTGH 4NA7A 1BBRH 2ZECA 2HNTF 2WPME 1K1LA 2FEQH 3SUDA 4CRBA 4NG9H 3VB3A 5E8EH 3MNBA 1B7XB 3R0FA 4GPGA 4ISOA 1XFEA 1Y8TA 3S9BA 2ZU2A 2FX6A 7ESTE 3UUZA 2AMDA 4AQTA 3BG8A 3GCHC 2CV3A 1G1RA 1INCA 5JYIA 1MQ5L 6LPRA 2A32A 1G2MB 2ZTYA 4XOJA 3P17H 2Q6DA 4ZAEB 2VWOL 5FX5A 4JYTA 1NESE 5FHTA 3N8ZA 2J94B 1GL0E 4X2VA 3SUEA 3GY3A 5A8XA 6GCHF 4NA8A 1H1BA 1YM0A 1GMHG 2F9NA 1TPSA 4JZFH 4UFDH 5C1YA 3IITB 2FI5E 4LXBH 3D23A 2J38A 2AIPA 2BDIA 3VGCB 4YT6H 1TYNA 3TIUA 3P6ZB 2BOXA 1C9TA 2ZFPH 1YGCH 2C90B 4R8TB 1U6QA 3SO3A 1YBWA 1P8VC 2WPKS 1ELEE 1P02A 4XBCA 1FJSA 1RIWC 2VH0A 2BOUA 4ZXYL 3N7OA 4F4OC 4CH2B 2WPJE 1ZLRA 1K1IA 1MTSA 1GBHA 1P05A 1JV2B 2BZAA 2G00L 4E05H 4IBLH 2WV4A 4FUBA 4KP0A 4KTCA 1D9IA 5IYTA 3GDVA 1HFDA 3QX5H 1A5GH 1SL3A 1PQ7A 2YOLA 1LQDA 4FVBA 4Y0YE 1BTZA 3M61U 3CS7L 1HYLA 2RA3A 3HPTB 1SGCA 1HX2A 1SGEE 1CO7E 4JZEH 3E91A 2CHAC 4ABDA 1VJAU 2TGDA 4X8VH 4X1NU 3RMMH 1CCFA 1AE5A 1WHFA 3N8XA 1UZQA 3C9AC 1WCZA 2BQWA 2THFB 3B9FH 2W2OE 3T25A 4BTTB 4XBDA 3N8VA 1YLCA 1Z71A 1C5LH 2P59A 3SGBE 2XCNA 2I9AA 1HJAC 3AW0A 1CVWH 2JETB 3U69H 1CEJA 4Y11E 1YP9A 3MU1A 1QGFA 1C5XB 5EQQA 2A4GA 2P93L 1GG6B 4X8UL 1O2SA 1OKXA 3PB1E 2W7SA 3SNDA 1HJ8A 3BEIB 4ABAA 2H9TH 1MU8B 1J15A 2EI6A 4ZKRU 3HKJB 1DICA 1Y3YA 3PMBB 1Y59T 2BMGA 2BXUH 2Y5FL 1EAIA 4Z6AL 3SOVA 1Z7KA 5DP5A 4CBNA 1UCYK 2ANYA 1O2TA 4OS4A 1YPLH 2AIQA 1XUGA 4Y76A 2PLXA 2PKSC 1FLEE 1PPEE 3MDLA 2C8ZB 2IJOB 2O8UA 4CH8B 2XBXL 1C5VA 1RGQA 2UWPA 2FO9A 1E37B 2EA3A 1U67A 4JZDL 2TPIZ 1Y5UT 4BAKB 3DA9B 3ODFA 1FAXA 4E1GA 5EU8A 4MLFB 1C1RA 1BRUP 2W86A 2BO2A 2BLQA 1EAWA 4DY7B 2G8TA 1QB1A 1O3HA 1GDUA 2SGEE 1C1SA 4NIYA 3STIA 3S7KB 3RMLH 3RXRA 2ODQA 1NFXB 5JBBS 2PKAB 5F8TA 1O2IA 1C2EA 3GISX 4M10A 1N8OB 2XBVA 1F5LA 2WPMS 4YTAA 1XKAC 1MH0A 4B2AA 1BBRK 2A5AA 1AIXH 3ZZ6A 1LHGH 2VIQA 2QY0B 2WPLE 1O37A 3N8YB 3SW2A 3NTBA 1G9IE 4MPXA 3QDZB 1P06A 2Z9JA 1K1OA 4IGDA 5JB8E 1HCGB 1F5KU 5EXLA 4CUFA 1SGFG 2C4FH 2WG3C 5HM9A 1GWAA 4ABIA 4CUEA 3FZZA 1G1TA 2QCYA 3BN9A 1O2QA 1AO5A 3ZZ4A 1RTLA 1C1TA 1D3DB 1QY6A 1EGFA 5CE1A 5KIRA 1MTWA 4J1YA 3ATMA 2GMTB 3BSQA 4Q2KA 3OY6U 1SPJA 2XBYL 5AHGH 1JOUB 2BVXH 4YESB 1WYKA 4D76A 3RR3A 2TGAA 2PUQH 4DJZB 2VVUA 3A85A 1O5DH 3RXPA 3MMGA 3NPSA 3UWIA 4BAQB 2DE8A 4LK4A 3SQEE 2B5TB 1YPHE 1L0ZA 1MBQA 2VWNA 1F7EA 5L30H 5H4IB 2GV7A 2BY6X 2WPJS 4SGBE 5T3HA 1GGDC 3K6ZA 1AFEH 1VCWA 3GCWE 1BQYA 1GHVH 4SGAE 1PPZA 8KME2 1VJ9U 2SGFE 4NZLA 3PWCA 3SU3A 2K2SB 4IN2A 1MTVA 1ZOMA 5ESBA 3UOPA 2ULLA 4WY3A 2CJIA 4YLQH 1QURH 4ISNA 1O2YA 1Z6JH 1K28D 2ZG0H 1G1QA 4Q80A 2Q6GA 1TQ7B 1UVUH 3KIDU 3E16B 3KN2A 3GY6A 2OBOA 1NTPA 4NWLA 4BTUB 1EPIA 2BVRH 2RCEA 2NPRA 2A4RA 5SGAE 1GI4A 5TCCA 2CF8H 4X1PU 1S84A 1MAXA 4CRAA 3LGUA 2HNTE 2Z9IA 5K0HA 1ELDE 2I6QA 4CHAC 3RDZA 4NSYA 3UFAA 3UNQA 2GCTC 4NFEA 3P8FA 2G51A 1EPTA 1C2IA 4MNWA 1C2HA 3A8AA 5E0GA 1Z1IA 2J92A 1GHZA 4X2YA 4FU9A 1YLDA 2PGQB 2BVSH 3PV4A 1SGDE 3PLPA 4RKOB 1U8CB 5J4QA 3SUFA 3OY5U 2J38B 3PO1C 1QNJA 1QL8A 2XWAA 1FPCH 5EQSA 3F9EA 3LIWA 3RU4E 2Q1JA 1IQJA 5I46L 3NCLA 1F5RA 5DPAA 1LPZA 1HIAA 2W7UA 1A3EH 2B7DH 2VH0B 2A5KA 4FU8A 1CHOG 1D6RA 1VITG 2BOKL 4JZ1A 5C5OA 3DHKH 5ESTE 3SNAA 5C5NA 2XBWL 1RS0A 4H4FA 1NY22 5GCHG 1HGTH 2RHPA 1C2KA 2ESTE 4MMXB 1UTKA 4AX9H 2XXLA 1GJ5H 1LQDB 5GIBA 3BTQE 3L3TA 3F6UH 1IQLL 1DVAL 1YPJH 3SV6A 1MZAA 4MNVA 5B6OA 5KN5C 1TLDA 3R3GB 2R9PA 2OQ5A 2KV4A 2CXVA 2XW9A 1MCTA 1O3NA 1P10A 1OWIA 1HAHH 1DS2E 1GBDA 1UK3A 4UDWH 2BQWB 1T8LA 3MH5A 3PROA 1HJ7A 5DJ7A 4AYVB 1TNLA 4KTSA 3EAJA 1J16A 4ZKSU 1S0QA 1AN1E 3GY5A 1QRZA 2ZFTA 1DWEH 2SGQE 2WPLS 3KQDA 2HPPH 1UK2A 3SJKA 2FIRH 2STBE 3M37A 2ASUB 1HT8A 2XC0A 1JBUH 1IOXA 2BD4A 2FLBL 2FOEA 2QAAA 2AFQB 2AGIX 4XL1A 3A7TA 3CS0A 5JB8S 3L6PA 1RFNA 3ZZCA 1NN6A 4KTUA 2J2UA 5FPYA 2EI6B 2G4UA 3LAQA 1J8AA 4NG9L 1UVTH 4GLYA 3SV7A 2BMGB 2LNCA 3LTFB 1BIOA 1AI8H 1C5UA 1P0SH 2ZDMA 5EG4A 3A89A 4HI3A 4RKJB 1NRRH 2ZIQH 1TB6H 4Y76B 3AVZA 2ZDVH 4NIWA 5HXFA 2BY7X 1BJVA 2TBSA 1BMNH 1NROH 1UVSH 3M3VA 2H9EH 2UWPB 1Z6EL 1GBLA 1HZ8A 1MZDA 3LGVA 2QXHA 1UTNA 2IN2A 2OUAA 3BTFE 1FFMA 3HK3B 2XCFA 2HALA 4JZFL 3UOUA 3GISB 1Z8GA 1GI2A 5ABWA 4JYUH 1AY6H 1P2NA 2JKHA 1W2KH 5JB9E 4YT6L 8ESTE 3P92A 2OBQA 4D9RA 1ADXA 2FTMA 4A5TS 1GJ7B 1COUA 2W3IA 2WUBA 1TNIA 5E0JA 1NZIA 4MNYA 2ADXA 2P94A 5L2ZH 2BXTH 3Q3KA 5JBCE 2M5TA 3BEUA 1A0JA 1FONA 3RXJA 3QZRA 4O9VA 3QCWA 2A4OA 2YGOA 4GUXA 1FMGA 3HGNA 1Z8RA 1B5GH 4B2BA 4LZ1H 3SW2B 1L1GA 1CSOE 2R3YA 2QA9E 3RXCA 1HB0B 2YNAA 1AZ8A 3KQCL 4X1QU 3E6PH 1GVKB 1WQSA 1HAXB 2NU3E 2J4IA 1IQNA 2A31A 4NWKA 3G01A 4D7FA 2FOMB 3BG4C 2BHGA 3BTWE 1NC6A 2A7CA 1IQMA 1YKTA 1UMAH 3ZV8A 1JIMA 1QCPA 1PFXL 3CENL 1CCVA 3GICB 3QGJA 2NU1E 4FUIA 3UR6A 1C5RA 1TNKA 3ZV9A 4FUHA 1TOCB 4JYVH 3SU5A 4B71A 1SFQB 1URKA 2D26C 3BTTE 4YO9A 3MYWA 1L1JA 3ZVEA 1K1PA 3QTVH 4K5ZA 3RXGA 4X2WA 1P09A 1C2MA 2F83A 2P3FH 1BTYA 3ZYEA 3Q76A 1KLOA 1CVWL 1TALA 1IQIL 3FFGL 3TNTA 4WF8A 2Z9LA 1XKBC 1QJ6B 1O2NA 2FODA 1ETTH 1S0RA 2Y5GA 1C5ZB 1QR3E 3PMAB 1L1NA 4A7IA 3KF2A 1EZQA 1CE5A 1Y3UA 3MI4A 1GBBA 3C1KA 2ZC9H 1O2VA 2QXIA 1CQEA 3KGPA 1TAWA 1GJAB 2XTTB 3EE0B 1YUGA 4OTYA 3LOXA 2FS9A 1HXEH 2P95A 1O3FA 1KIGL 1DITH 2XC4A 4ISHH 3FZDA 1HJAB 4DGJA 4U01A 2VWMK 1C5TA 1EMNA 3P5BL 3U8RH 2CJIB 2QV1A 1ATBA 1P9JA 1EP5A 1NFWA 2R2MB 4RUTA 1XMNB 4JMYA 1IQHL 1OSSA 1V2UT 1O5GH 1NS3A 1NM6A 4FUEA 1WQVH 3RXMA 3RXUA 1H8IH 3URCA 1M1XB 2ZCHP 4O1ZA 1QJ7B 1SMFE 5K7RA 1GK5A 1NT1A 4TYDA 3EA9A 2BLOA 1S6HA 1A3PA 1SLVB 2BLWA 3RC4A 5I46H 2KL7A 1PTHA 1CT4E 2NU2E 5DP8A 1BITA 1O5AB 1NRNH 3MFJA 1A46H 3QWCH 1NFYB 1DUAA 1LHCH 2FOCA 1V2JT 3LT3A 5E2PA 1IQKA 1WSSH 3VPKA 3GOVB 1AD8H 3E3TA 1EPTB 1V2LT 3RXHA 2PKSB 3TPIZ 2W2ME 4GSOA 2W2PE 4AN7A 3GY2A 5C20A 5IKRA 2P3TA 1O2ZA 5JVYA 2FZZL 1AWHB 4K1TA 3K9XA 2FDAA 3AASA 4NGAL 1GCTC 2Z9KA 2FD6A 1PPBH 3MNCA 1AU8A 4OGYA 3LIWB 3MWIU 1FZZA 1ZSLA 3C27B 2RA0L 1EASA 1BHXB 1DSUA 1HIAB 1LPZB 1PQ5A 1Y5BT 1QTFA 1WU1A 2XC5A 1PQAA 3LJOA 3SZNA 1YPEH 3ZVBA 1CA0C 2I6SA 4TY6A 3EA8A 1ESAA 1A4WH 3B8JA 1KSNA 1ATEA 1O2JA 1S83A 1W0YH 2WINI 1O3PB 3R05A 1F2SE 1FXYA 1O3GA 1S6FA 3I77A 1CGIE 1TNJA 1QBOA 1KXFA 5T6DA 1GMDF 2VVCK 2FLBH 3VB7A 4Y8YA 5EXNA 1RTKA 5JB9S 2VWLL 3A84A 2A0QB 3I78A 4XFQA 2H6MA 2PUQL 1ANCA 1O5DL 1C4Y2 3LGTA 1QL9A 1C5PA 1N6XA 4VGCC 1SLXB 5JBCS 4WXIA 1PXXA 3UY9A 1WBGB 4RRWA 5L30L 1KLJH 3CFWA 2BY8X 4IN1A 1TNHA 4K8BA 2BD9A 1F7MA 3V12A 5FPTA 1IQFL 1SHHB 3ODDA 2FMJA 2BQ6A 1DSTA 1M9UA 1BTXA 1OXGA 1O3DA 2SFAA 5JBAE 1XKBA 4YOJA 1FUJA 2P16L 2SGDE 1RFNB 2A5IA
chains in the Genus database with same CATH superfamily
2J2UB 2GCHG 2QC2A 1JL9A 1QRXA 2A7JA 4O03A 3U1JB 4ZH8B 2WV9A 5FBIA 1O2MA 1VGCC 2XWBI 2QGRA 2FLRH 1BCUH 1DXPA 1GHBF 2Y5HL 1IQEL 3ASIA 1H9HE 1K22H 1O38A 4Z0LA 1TA2A 1NBMD 2ZDAH 6ESTA 4COXA 1F0TA 2HVYB 3QLPH 4I8HA 2ZGXH 3TNSA 3ZYIB 1GCDA 4AB8A 4K60A 1UTOA 3ZVFA 3T62A 1V6DA 3D62A 4MPWA 4LOYH 4RT1A 1SHYA 1TFXA 3STJA 2KB9A 2QF5A 2Y7XA 3KRKA 3FO8D 4Y6DA 3N8WA 1MQ5A 3UNRA 1IGZA 1C1WH 2H1UA 1C5QA 2SGPE 2BD5A 2GCTB 1W8BH 4Y79A 2W3IB 3M7TA 3OE7D 7KMEH 1W3CA 1HAEA 1F0UA 2FX4A 1P9UA 2B7DL 1T8NA 3ZYGA 1FX0B 1UZPA 4RRYA 3SU6A 4BDWA 2FOAA 1QA0A 3PWBA 2BQ7B 1TPOA 1O35A 4BAMB 5CHAC 1LMJA 1HAGE 1P3CA 3TGJE 1OWEA 1BMLA 2ZFFH 3PO1B 4DVAU 5GPIB 2FXRA 2AGGX 1T4VH 4DOQA 4YLUA 4GAWA 2MHPA 4MPUA 3F6UL 3EDXB 2RG3A 4I8JA 1OP0A 3NKKA 2WFTA 1T7CA 2VIWA 2BDBA 4ABFA 1K1NA 2J98B 2J4IB 3ATWA 3KK6A 1UTMA 2A1DB 1C1PA 1GHAF 1QBVH 3NZIA 3MO9A 5CKMA 2G00A 3VXEH 1G30B 2V7QD 3VB6A 1BOQA 2VGCC 4ZHMU 1GBJA 2GD4B 1ZYOA 1UHBB 1EPJA 3RXAA 4Q7ZA 4P00A 1GVLA 1KIGH 1HAOH 2H5DA 2IPQX 3CS7A 3ELAL 4OGXA 1ATDA 1P57B 1KDQA 1TPAE 3U9AH 5EJLA 1V2NT 1H8ED 2BDAA 1TE0A 1DE7H 1C1MA 3Q3YA 1K1JA 3RXSA 2WYGA 4MPVA 3GYMA 1SGFA 2QXGA 2F91A 2WV5A 1JBUL 4AGJA 4A7IB 4PH9A 4BAOB 2AMQA 1EZQB 5EJZA 4O3UA 5JW1A 1MCVA 4XSKU 2ZQ2A 3KL6A 1CGJE 1FIWA 1O2RA 4AB9A 4GHTA 3RXTA 4LZ4B 1PPFE 3ATLA 2BZ6L 4GVUA 3RXFA 3TBDA 2OQUA 1P12E 1GBEA 1OP8A 3JZ2B 3V65B 1P0SL 3MNXA 2AYWA 1DM4B 1NFWB 1EQGA 1T31A 4D0FA 1AVGH 2BM2A 3F0PA 3LC3A 4WH8A 3TH3L 1XXFA 1E79D 3VB5A 4NGAH 1APOA 3A8CA 2DE9A 2WG4B 1GMCG 3F3BA 2QF4A 1UTJA 1J9CH 1YPHC 3TH4H 2H9EL 1NQLB 2AEIH 5LGOA 5C2ZA 3JZ1B 2D1JA 2JIZD 1Q2WA 1ZRKA 2IPHA 3NXPA 2Y81A 5FAHA 2BD2A 2HOBA 3HO3A 2Y5FA 1C5NH 2PSXA 5ETXA 1O0DH 1ETRH 2ZDNA 1TX7A 3VG8A 2VVUL 1EATA 2VIDA 4JYUL 1O32A 3ITIA 3BT2A 4AG1A 5CISA 1HJ9A 5GWZA 3MH4A 2XBXA 1XUKA 2VWNL 1MOXC 2OC8A 2M74A 4NIXA 4GCHG 1GI7B 4K69A 5L2ZL 1AFQB 4UONA 1NT0A 2YNBA 3K9XB 4CBOA 3TZIA 2ZDKA 1W14U 3SJ9A 2KR7A 3VXFH 2EC9H 2AYLA 4KGAA 1P04A 3PMHB 2HNTC 1H8DH 1OWKA 4Y8XA 1OP2A 2O8WA 1JRSA 1WU1B 2WPIE 4K1EA 5F03A 3SORA 4X8TH 3BEFB 1EPGA 3RM0H 2TGPZ 1GMHF 1C1QA 1L2EA 3WWFA 1CT0E 2ZCLP 1KSNB 2VJ1A 1TQ0B 5LPRA 2ZPQA 2ZU5A 4OM9A 2GKVE 3ZVCA 3GCXE 2XNDD 2ZFRH 6CHAB 1GJCB 1BJUA 3FP8E 3M36L 1LVOA 3TK6A 1TPPA 1FY1A 3BTDE 2BT8A 5GXPA 1YY3A 2DUCA 2VVVL 4JYVL 1YUKB 1HAIH 4FOUC 4IC5A 1XUJA 1ZPZA 1FI8A 2OCVB 1H9LB 4CRFA 2D8WA 1P01A 3KNXA 3T26A 3AW1A 1K21H 1LK9A 2P3FL 1GBAA 1TLEA 1O3CA 1AB9B 1P2IA 5KECA 3BG4B 3FANA 5TCAA 1MQ6L 1VKYA 2F9OA 4Q7YA 3PM3A 3U8OH 1OYTH 1NPMA 4B74A 2M2AA 2F9VA 1AZZA 1PPCE 1CA8B 3E1XB 3DT0H 1MTNC 2XBYA 2SNWA 3M3SA 1G3EA 1C2LA 2FYQA 1YF4A 4CR9A 1EKBB 2QYIA 1EOJA 2FWWA 1SSXA 2OC1A 1P2KA 1G37A 1L5GB 3D65E 5HKKD 2BQ6B 5GJ4B 4ISHL 3SGQE 2VIVA 4MG3A 1LPKA 1TNGA 4DT4A 1QB9A 1DY9A 4ZMAH 4MMZB 1E0FD 3FAOA 1V2VT 1A1RA 1OHHD 1QL7A 2ZZUH 3FN8A 3EGFA 3I29A 1G2LA 1P03A 1QBNA 3N7DA 1BRAA 3P8GA 4YZUA 2Z3DA 4UE7H 2A2QH 4Y7AA 5C3NA 1O36A 2VB0A 1EJNA 5DP3A 2VH6A 1E38B 3BTGE 2F43B 1SGPE 2BDHA 4FUJA 2W26A 1TX6A 4RI0A 2Y80A 1BTWA 3UTUH 1DQBA 1V2RT 2OLGA 3ATIA 1ZSKA 2ANMH 3CA7A 1SLUB 2BOHA 5IKTA 5HIZA 1B9WA 3KQDL 1UTPA 1SVPA 5T6GA 2Y7XB 4WMDA 4Y6DB 3N8WB 3M37L 2NU0E 2R3UA 2XC0L 1L3YA 1A3BH 1C5WB 1CQQA 1O5BB 5L2YL 1ARBA 4K1SA 3SJ8A 1ZHPA 5F6MA 1SBWA 1AUTL 1BMAA 2GT7A 5FPSA 4AFUA 4X8SH 5CDFE 4CRDA 3FKSD 1EJAA 1KXAA 5EPYA 1EOLA 4B6FA 2ZCKP 4FUGA 2G81E 4AZ2B 2BYAX 7GCHG 1KXCA 2W2NE 3LJJA 4J2YB 1LDTT 3ELAH 1WTHD 4U2WA 2Z9GA 2VRSA 1DUEA 1LO6A 1GCTB 2HPQH 4ISIL 5DN6D 1YCPH 4E06H 2OC7A 3Q3XA 4ZHAA 2J95A 2W3KA 1IHSH 1O30A 3N99A 3A8BA 3ZIAD 4IMQA 2XRCA 2AHME 2ZGHA 4I7YH 4DCDA 3KQEL 2Z3EA 1XDTR 5DG6A 1W10U 1MUEB 2YGQA 1O2XA 2R2WU 3D49H 1UZKA 3LN1A 1G3DA 1ELFA 1CA0B 4OS5A 4TSFD 1PFXC 1ELGA 2KM0A 3F0OA 3M7UA 4X6MA 2K1QA 4YOIA 1HXFH 2GJGA 1EQHA 2BZ6H 1KTTB 2GVFA 1UZJA 3RXOA 4O3TA 3QO6A 1LPGA 1KYNA 1IQLA 2FI3E 3OEED 1LVBA 1KDQB 4ZAEA 3DUXH 2UUYA 3SNEA 1KLJL 1EP6A 3PTNA 3ZVDA 1BZXE 3FVFB 2J94A 4B73A 3LN0A 5C1UA 4B75A 2FP7B 3TH3H 4H6SB 2H2ZA 2WYGB 1JMOH 4I33A 3TH2H 1ESTA 1GI5A 2OP9A 5F8ZA 3QN7A 5FX6A 2JH5D 5EW1H 4UD9H 3PLBA 3GY7A 1AHTH 5A0BA 3P8NA 2JH0D 4IS5A 3ZZ7A 2L74A 1OOKB 3KL6B 1O34A 4VGCB 4TWYA 1A5HA 3MU8A 2MGRA 4ZKNU 4DT7B 2H9HA 3GCHB 1FNIA 4Z0KA 4ESTE 1W13U 1ZZZA 2FLRL 1XVOA 5AFZH 1E36B 3ESTA 4A1XA 1CX2A 2BX3A 5E2OA 1NO9H 1X7AL 4HTCH 3PTBA 4ZHLU 5JBTA 4WXVA 4X1SU 3V13A 3LC3B 1GJDB 2G5NA 1PJPA 4CSYA 1SQOA 2Y7ZA 1GJ8B 1AUJA 3ZZBA 4R0IA 1L4DA 3KQ5A 3HS6A 3LH3A 2D1JB 1UVOA 3LC5A 2Y81B 1VGCB 3NK8A 5AVDA 2V3MA 3TGIE 3U7UG 1OX1A 3L33A 6GCHG 2ZKSA 1DLKB 4HG6A 1O5CB 5EGMA 3TJNA 1RIWB 1KTSB 5LPEA 3PV5A 5T1VA 1SKYE 2OINA 1ZTLA 1Z6EA 1XX9A 1W8BL 3BIUH 3Q00A 2KAIA 1HAFA 1IVOC 1TOZA 2ANWA 1EMOA 1P3EA 1C5MD 1GHBG 3URDA 1O2GH 2FLGA 2P8OC 1FSBA 3FP6E 5T6FA 4JCNA 2XC4L 4WMFA 1LKAA 3TU7H 5IK2D 4U32A 1ZPBA 3RLYH 4A1TA 2ILNA 5HIYA 4ABHA 3GCTF 4RSPA 1NU7B 4IW4E 4NFFA 1SR5C 3IG6B 2ZPRA 1OWHA 1O3KA 4WJG2 1AMHA 2A4QA 2CHAB 1W12U 2SNVA 3MTYA 4F49A 2A2XH 5J4SA 4ABBA 4M9FA 1D3QB 1GI9B 2WPKE 1FY3A 3TITA 1HLTH 1GBTA 1IOEA 5CHAB 1ANEA 3TK6B 1YPGH 1HT5A 2MGPA 3AAUA 1HNEE 3KQCA 2G5VA 3LU9B 3SU2A 1NRSH 4BDXA 2Y38A 1ATAA 1CHOF 3SUGA 3HGPA 1VITF 3ZYJB 1DT2A 1B0EA 1V2OT 4ZROA 1EUFA 1BMMH 4F48B 1O39A 1FN6A 5EW2H 3ENSA 1UO6A 1Z6CA 3F9HA 5GNDA 2VU8E 4UEHH 1F0SA 5GCHF 3ZVAA 1W0JD 2BB4A 1MD8A 2CF9H 3A83A 3TJOA 1GJ9B 1ORFA 1ANDA 1DY8A 1JRTA 1O3LA 3HS5A 1ELBA 5DP6A 6COXA 3RP2A 5K0HB 1WAYB 4QT8C 2GZ8A 3IWMA 3HO5A 1V2MT 2XC5L 1IQGA 1D3PB 2V3OH 1MKWH 1D3TB 1D4PB 4CR5A 3BF6H 1YCPK 1LPKB 1N7DA 1FY5A 1SOZA 1QZ8A 3IJEB 4XBMA 1A7SA 1Y5AT 4MDSA 4WH6A 1P9SA 1EQ9A 4I8LA 1G2LB 4FM5A 1TGNA 5A8YA 1HREA 1IJQA 4YZUB 3MO6A 1J9CL 5L2YH 1AGJA 5F53A 1MKXK 5EODA 2Q1JB 4Y7AB 1CGHA 4K2YA 1BHXF 1ABJH 1V2PT 3U98H 2WPDD 2AMPA 2VH6B 2YMSD 1OS8A 3UREA 4X6NA 1TBZH 2W26B 1J14A 3GY4A 1HUTH 3K6YA 4Q7XA 1O3AA 2Y80B 1HAVA 3F2GA 1SGNE 3H5CB 3A80A 1XUFA 3SHCH 3NJPC 2Z7FE 4JK5A 1K1MA 1QA7A 4RN6A 3F2FA 5JPMH 4ISIH 2HWLB 2BOHB 4WVPE 5COXA 4D90A 3MU4A 2K2TA 4XLWA 4CRCA 3RU4D 1ZR0A 2FOGA 1BRBE 4H42U 2P28B 1CHGA 1YPKH 3GCOA 1GJ4H 4UFFH 1PPGE 4I8KA 3FP7E 2ZO3H 1C1OA 1EBVA 1EZSC 2PR3A 4P02A 3FCSB 5AFYH 4ABJA 1BTUA 4U30A 4WMEA 4X2XA 4BANB 2ZQ1A 4OS1A 1ZAQA 2OTVA 3V3MA 5C67A 1D6WA 4X8TL 1C2FA 5IDKA 1EAIC 2GDDA 3RXKA 1Y3VA 3H7OA 8GCHF 1GL1A 3SBKA 1MBMA 2PP6A 3NTGA 1MAYA 1HAYB 4ZHAB 2J95B 5EPNA 1FJSL 2W3KB 2BD3A 2O8MA 4BOHA 3RXVA 2ZU1A 3HATH 4UFEH 2BX4A 2ZFQH 2GP9B 3EQ0H 3MU5A 2FM2A 2EI8A 4X1RU 2STAE 1AE8H 2V3HH 2WUCA 3LH1A 4GU3A 4INHA 3A7YA 4MMYB 4PROA 4AORA 4BTUA 3UQVA 3KQBA 1PPHE 4MNXA 5FCKA 3HKIB 1ZHMA 2UUJB 2XNIA 3RM2H 1XVMA 3PYHA 1BRCE 5LH8A 1ZPCA 1GGDB 1G3CA 4I31A 2L6OA 1LPGB 1BMFD 1LVMA 1O3BA 1DIYA 1BTHH 3SV8A 3T5FH 1GBKA 2PHBA 3MOCA 1HDTH 4GHQA 1SGIB 4Y0ZE 1A0LA 3TGKE 2H5CA 1EZUC 4NIVA 3E90B 2VIPA 4RRZA 1O3EA 2CMYA 1UTQA 2PTNA 3RXDA 1C4U2 2VWLA 3S69A 1CU1A 1DWDH 4YT7H 5TJXA 1CVUA 1K2I1 1TMTH 1KY9A 1W7GH 2GTBA 2ZTZA 1P11E 3TK9A 5I25A 2TRMA 1JIRA 5FCRA 1BT7A 3O8RA 1DPOA 2QN5T 1LHEH 1ZSJA 1C5YB 3SI4H 1UK4A 2YGPA 1RJXB 2RDLA 2UWOA 3GDUA 1Q3XA 2UUFB 2BDGA 3KCGL 2B8OH 4Z0KB 1MTNB 4IMZA 1A0HB 3E0NB 1IQFA 1RD3B 1ZHRA 2HVXA 4ZXXH 4CHAB 3MO3A 1ELCA 2VWOA 2F9BL 3RC6A 1C1UH 1KLTA 4M11A 1TGBA 2ODPA 3RC5A 4D7GA 2XYAA 2W5EA 1CBWC 2P16A 2ZDLA 2AS9A 3Q3KB 3LGYA 1DLEA 4MVNA 2O9QA 3GDSA 2Y7ZB 5CHBA 2H9EC 5CKNA 2Y82A 1IGXA 3NRLA 1JXPA 5DSFA 1GHXH 1MD7A 5C1XA 2ZTXA 2EI7A 3LC5B 3M3TA 4AFZA 1FDPA 1YUFA 3SV2H 2Y5HA 9LPRA 2FTLE 1IQEA 3UPEA 2AH4X 3F9GA 3BT1A 4NA9L 5EGMB 1KXEA 1TRMA 4MQAA 1LKBA 3M5MA 4AFQA 7LPRA 1PQ8A 1OYQA 3LPRA 1ACBE 4TWWA 4X8SL 3TJVA 1FF7A 1UTLM 2KAIB 1FAXL 4ABEA 1TPGA 1EJMA 1MKWK 1S82A 3UR9A 1O3IA 4OS7A 3TK5A 3CP7A 1MTUA 1O33A 2GX4A 1THSH 1QQ4A 3LDXH 1XM1A 3HO4A 3FBYA 1PRHA 2ZHDA 4OS2A 1ZMJA 3T29A 1S81A 1ZTKA 5PTPA 3ZZ3A 3ZZDA 2FS8A 1YO8A 2BDYA 4Y8ZA 4C16A 1FV9A 1GHWH 3UWJH 1SG8B 1W11U 1T8OA 1YCPM 2FOBA 2XBVL 1P2OA 2BTCE 2NU4E 3DFJA 1VCPA 1O31A 3BTEE 3LGIA 2ZA5A 4X0WU 1KXDA 2VJ3A 4NSVA 2ZI2H 1L4ZA 4MTBA 2VWMA 1DX5M 1F0RA 1EPTC 4OTJA 1RTFB 4Y10E 1O3OA 2B0FA 4NCYA 1SQTA 2JJ2D 3SU0A 4FUFA 1K36A 2J34A 2VBCA 2P93A 1NRPH 4JZIA 1WV7H 3WY8A 3S9CA 2LELA 2F9PA 1DWCH 3ENSB 3O8BA 1MU6B 1F0SB 2P3UA 1APQA 3T2NA 4D9QA 3A88A 3Q7DA 1ZRBA 3VFEA 5HGGA 1T32A 4BTIA 1ELVA 1BB0B 3EYDA 1IAUA 2HGTH 5DP9A 3RXQA 3SNBA 1SC8U 3UAIC 4AOQA 1ZJDA 2FOFA 4B2CA 4Y7BA 3POYA 5A8ZA 1TMUH 1G36A 5F1AA 2OXSA 3SV9A 1BUIA 1WOFA 2AGEX 3DSOA 4ASHA 3OLTA 3EGKH 2P3TB 5JBAS 1V1HA 4LORA 2J5UA 2PW8H 4X6OA 1Z8JB 2ZGCA 4TPIZ 1C1NA 1O2KA 2WSSD 1HPGA 1THPB 1V2QT 3RXIA 4E7NA 9ESTA 4D8NA 3UIRA 1TGCA 1J17T 3A86A 3U1IB 2R0KA 3V0XA 1DX5I 1K37A 4DIHH 1FAKH 1GDNA 3U73A 3RMNH 4AYYB 5EXMA 1LTOA 4HZHA 1C2DA 1NRQH 3S6XA 1HAVB 1EPHA 2R0LA 2YMSC 2PSYA 1DWBH 3ZVGA 2ZF0H 2GCHF 4Y71A 3BTME 1GPZA 2VVCA 1QFKL 1W7XH 3SI3H 5CKQA 5JDUB 4FXGH 3LGWA 3F9FA 2RNLA 2IOTA 3SU1A 1P2JA 1YPMH 3ZYDA 2OC0A 1BA8B 1VR1H 2ZPSA 1AUTC 1WUNH 1TOMH 4TY7A 2PR3B 2WFXB 1O2PA 2OK5A 2I9BA 2ZNKH 1TX8A 3SOSA 5DKMA 2ZU3A 1GJ6A 3GYLB 1ELTA 2CN0H 3MH7A 1PGEA 3VGCC 3ZZAA 1O2OA 1AKSA 1Y3WA 2BD8A 2P8OB 2ZHEH 1IQJL 2ZWLH 1QQUA 2V35A 1O5EH 5A2MH 1TBRH 8LPRA 5AF9H 1ESBA 3A7WA 3RXLA 4ZUHA 3QGNB 1TGTA 1G3BA 3OAAD 4HFPB 2FYRA 2EI8B 3OX7U 1LVYA 1DDJA 1V2KT 2BDCA 2FESH 1XKAL 4ABGA 4RRXA 5IKVA 4RS0A 1CT2E 1TIOA 3OTJE 2HRVA 2PWXA 3A81A 1A2CH 1FQ3A 2QF0A 1SGYE 1BF9A 1C1VH 3OSYA 3KCGH 2VIOA 2DDUA 3GCTG 1NFUA 1RRKA 4THNH 1NFYA 4ZXYH 3A82A 3M36A 2UWLA 2ZGJA 2F9BH 2PHBB 3M7QA 2GZ9A 2PTCE 1TABE 1F7ZA 2VVVA 3PLKA 2PUXB 5A09A 2G55A 2ZEBA 3SJOA 1EB2A 1Y3XA 3SQHE 1DFPA 3A87A 1UCYE 1FE2A 3MQEA 2V6NA 1SB1H 1ETSH 1E34B 4UFGH 1MQ6A 5A0AE 4DIIH 2ODYB 4IC6A 2BY9X 1SI5H 5JVZA 1V3XA 2JETC 1HV7A 4XBBA 3BPSE 3RXEA 1WXRA 2UWOB 1EFRD 4NA9H 1GBCA 2GV6A 1O2UA 1OWDA 1KXBA 3DEMA 1GG6C 4X6PA 4ASUD 4CRGA 1X7AC 3W95A 2P3FN 3S7HB 3SJIA 4Y79B 1AWFH 2A45B 4TGFA 2VNTA 5F8XA 1EAXA 3F68H 2WPHE 2KCPA 1PYTD 1EAUA 2Y6TA 1ABIH 1O2WA 1O5FH 2LPRA 1O2HA 2F9UA 3S9AA 2C8XB 4LMFA 1AVXA 2Y82B 5FBEA 3SGAE 2GZ7A 2JH6D 1QRWA 3ZZ5A 4D0EA 4AFSA 2EI7B 3NUMA 1G32B 3UNSA 3B23B 3QMOA 2EY4C 2WYJA 1FIZA 3MHWU 4X8UH 1TRNA 1KLIL 3HK6B 2KCYA 1TBQH 1BBRE 3SOQA 5E0HA 1E1RD 4GU4A 5IKQA 1S85A 4FUDA 2KX4A 2NWNA 2O8LA 1EX3A 2BOKA 3S0NA 3T27A 3TJUA 2XBWA 2QXJA 5FXLA 4FVDA 2K8IA 3E8LA 1YYY1 4Z6AH 2F3CE 4INLA 1MKXH 1ZMNA 2ZFSA 3BTKE 5BRRE 1GMCF 3W94A 3TK5B 1HAZB 3EA7A 3HS7A 1GI1A 4H6TA 2JKHL 3SOBB 4RT0A 3A7ZA 4BXSA 1G2MA 4G1MB 1SFIA 3UQOA 1K0HA 1NBME 2GT8A 2ZU4A 3DFLA 3OYPA 3V7TA 2KCOA 4A1VA 2W2QE 4JZDH 2P94L 1P2MA 3SU4A 1N8OC 1SLWB 1WHEA 1H9IE 4FU7A 1T8MA 4A92A 3IITA 1S5SA 4AG2A 1HAPH 1C5OH 4ZH8A 2WPIS 2PGBB 3BIVH 4GCHF 4K3JA 2ALPA 4YOGA 4HGCA 5E8DA 1GMDG 4I32A 3ZZ8A 2G4TA 1GBMA 3ATKA 1FPHH 4FUCA 1F0RB 1DANH 1GI3A 5HM2A 1VCQA 1LHFH 3LONA 1IQNL 3BTHE 4ISLA 3KQEA 1TMBH 2ALVA 4XDEA 3RLWH 1EXFA 1TGSZ 2J34B 3OFND 1IQML 3VEQB 1AFQC 4DURA 1NPEB 2BLVA 4E7RG 3H7TA 8GCHG 1LHDH 2GMTC 2P3UB 5B6LA 1A61H 2BY5X 4YT7L 5DGJA 1OPHB 1OWJA 3HPTA 2Z6BD 4BTIB 4ACBA 3M5OA 2TIOA 1VITH 1YGCL 5EOKA 4WWYA 3TGFA 1GVZA 1KMHB 3MU0A 1EB1H 2QIQA 1LCYA 3GY8A 2Y5GL 3LTGD 4Y7BB 1I0UA 4ZXXL 1HBTH 3A8DA 4BTTA 2CK3D 1SGQE 3O8CA 1GI0A 3P70B 2BQ7A 2ZHQH 1GBFA 6CHAC 1QFKH 1IOEL 1C9PA 1O3JA 1WDIA 3QZQA 3GS9A 1G1SA 3U8TH 2P95L 3O8DA 4KKDA 1GDQA 3KEEA 1N6YA 3DD2H 1ELAA 2O8TA 3P8OA 1NU9A 3UB0A 1H4WA 1JWTA 3M5LA 4BNRA 5A0CA 5DO4H 1TA6A 1AB9C 1SQAA 4JZEL 4AGKA 4KELA 2ANKH 3Q77A 3KHVA 1DDXA 1HRFA 1V2TT 3P95A 1A5IA 2F4LA 4X8VL 5DP4A 2GD4A 2HORA 1UVPA 2FOHA 2HLCA 1UHBA 1CBWB 2SGAA 3M5NA 4OS6A 1QJ1B 3A7XA 4CUDA 2FPZA 4Y71B 1FN8A 2A7HA 1SZBA 1F92A 2BD7A 2ZHWH 5CMXH 4CREA 1W0ZU 2CGAA 4B76A 2D2DA 1KKEA 1V2ST 1MMJN 1DXWA 2C8YB 1IQGL 3OLUA 4O02B 1IQKL 3A7VA 1OB1C 3NT1A 1GHYH 1N1IA 4TPYA 2OD3B 3E0PB 1QB6A 2ZGBH 5EQRA 3RU4T 4O97A 3LKWA 1GI8B 1C5SA 4K8YA 4M7GA 4YM9A 1Q4GA 1P2QA 1TRYA 1QIXB 5DP7A 1E35B 1TWXB 3CENA 1ARCA 1ZGIA 2GGVB 2J9NA 1YC0A 2VGCB 2WPHS 5BPEA 3T28A 1IP0A 3AAVA 1ZTJA 3RMOH 1AKSB 3K2UA 1C5MF 2AERH 2V0BA 3EE7A 3M35A 2QF3A 1QHRB 1XUIA 1Q31A 5HYOA 1T4UH 1GHAG 1NFXA 1EZXC 1ZJKA 2PKAA 3SNCA 3ZZ9A 4NZQA 1IQIA 1RXPA 1IHTH 3FFGA 2P26A 4INKA 1O3MA 1ANBA 1THRH 3OU0A 3BV9B 2TGFA 1Z1JA 2VINA 1Z8IB 1AVWA 7GCHF 3N8YA 3TLOA 2G52A 2W6ID 1HRTH 4I8GA 2C93B 1LQEA 2Z94A 5FDQA 3MNSA 2EQNA 1K9OE 1GBIA 3SHAH 1GI6A 1GJBB 3GCNA 1NFUB 2UWLB 1BDAA 1FY4A 1HCGA 2Q6FA 5C0UA 4ZKOU 3QK1A 4A6LA 1C2JA 5F19A 1IQHA 1V2WT 4DW2U 1SGTA 1XUHA 1DVAH 1UCYH 2ZHFH 2PV9B 3TVJB 4BAHB 1SOTA 2UUKB 2Z3CA 3PGHA 2OYEP 1SGRE 1TONA 3SN8A 1AQ7A 4JK6A 1V3XB 5KGOA 1KLIH 4XE4A 5G4BA 1C2GA 1NZQH 3NWUA 3V64C 3K65B 4DG4A 1UJ1A 2TGTA 1DOJA 1XXDA 2C3SA 3QTOH 2GDEH 5DK1A 2C8WB 4BXWA 2PFEA 2ZP0H 3RXBA 3MH6A 5LPFA 1ID5H 3KQBL 2FI4E 1ZMLA 1O2LA 3QUMP 1B0FA 2B9LA 1FAKL 5HMAA 3VB4A 1N1LA 1W0KD 2FZZA 1PYTC 1C4V2 1ZGVA 1LMWB 1BTPA 1FY8E 5L6NH 2OYUP 3PMJA 1VZQH 3RUOA 3N7EA 5JBBE 3F1SB 2WYJB 3QH0A 5GDSH 1W7XL 2EEKA 2RA0A 1WTGH 4NA7A 1BBRH 2ZECA 2HNTF 2WPME 1K1LA 2FEQH 3SUDA 4CRBA 4NG9H 2KCAA 3VB3A 5E8EH 4Z1MD 3MNBA 1B7XB 3R0FA 4GPGA 4ISOA 2WZQA 1S6LA 2YMSB 4I86A 1XFEA 1Y8TA 3S9BA 2ZU2A 2FX6A 7ESTE 3UUZA 2AMDA 4AQTA 3BG8A 3GCHC 2CV3A 1G1RA 2JJ1D 1INCA 5JYIA 1MQ5L 6LPRA 2A32A 1G2MB 2ZTYA 4XOJA 3P17H 2Q6DA 4ZAEB 2VWOL 3OEHD 4JYTA 5FX5A 1NESE 5FHTA 3N8ZA 2J94B 1GL0E 4X2VA 3SUEA 3GY3A 5A8XA 6GCHF 4NA8A 1H1BA 1YM0A 1GMHG 2F9NA 1TPSA 4JZFH 4UFDH 5C1YA 3IITB 2FI5E 4LXBH 3D23A 2J38A 2AIPA 2BDIA 3VGCB 4YT6H 1TYNA 3TIUA 3P6ZB 2BOXA 1C9TA 2ZFPH 1YGCH 2C90B 4R8TB 1U6QA 3SO3A 1YBWA 1P8VC 2WPKS 1ELEE 1P02A 4XBCA 1FJSA 1RIWC 2VH0A 2BOUA 4ZXYL 3N7OA 1YWUA 4CH2B 3KYFA 2WPJE 3WWBA 4F4OC 1ZLRA 1K1IA 1MTSA 1GBHA 1P05A 1JV2B 2BZAA 2G00L 4E05H 4IBLH 2WV4A 4FUBA 4KP0A 4KTCA 1D9IA 5IYTA 3GDVA 1HFDA 3QX5H 1A5GH 1SL3A 1PQ7A 2YOLA 1LQDA 4FVBA 4Y0YE 1BTZA 4ZCNA 3M61U 3CS7L 1HYLA 2RA3A 3HPTB 1SGCA 1HX2A 1SGEE 1CO7E 1SQRA 4JZEH 4FETA 3E91A 1YLNA 2CHAC 3FOAA 4ABDA 1VJAU 2TGDA 4X8VH 4X1NU 3RMMH 1CCFA 1AE5A 1WHFA 3N8XA 1UZQA 3CNRA 3C9AC 1WCZA 2BQWA 2THFB 3B9FH 2W2OE 3T25A 4BTTB 4XBDA 3N8VA 1YLCA 4YXWD 1Z71A 1C5LH 3MQKC 2P59A 3SGBE 2XCNA 2I9AA 1HJAC 3AW0A 1CVWH 2JETB 3U69H 1CEJA 4Y11E 1YP9A 3MU1A 1QGFA 1C5XB 5EQQA 5EJ1A 2A4GA 2P93L 1GG6B 4X8UL 1O2SA 1OKXA 3PB1E 2W7SA 3SNDA 1HJ8A 3BEIB 4ABAA 2H9TH 1MU8B 1J15A 2EI6A 4ZKRU 3HKJB 1DICA 1Y3YA 3PMBB 1Y59T 2J97A 2BMGA 2BXUH 5C0TA 2Y5FL 1EAIA 4Z6AL 3SOVA 1Z7KA 5DP5A 4CBNA 1UCYK 2ANYA 1O2TA 4OS4A 1YPLH 2AIQA 3KYGA 1XUGA 4Y76A 2PLXA 2PKSC 4A94C 1FLEE 1PPEE 3MDLA 2C8ZB 2IJOB 2O8UA 4AC9A 4CH8B 2XBXL 1C5VA 1RGQA 2UWPA 2FO9A 1E37B 2EA3A 1U67A 4JZDL 2TPIZ 1Y5UT 4BAKB 3DA9B 3ODFA 1FAXA 4E1GA 2RDEA 5EU8A 4MLFB 1C1RA 1BRUP 2W86A 2BO2A 2BLQA 1EAWA 4DY7B 1E1QD 2G8TA 1QB1A 1O3HA 1GDUA 2SGEE 1C1SA 4NIYA 3STIA 3S7KB 5KEDA 3RMLH 3RXRA 2ODQA 1NFXB 5FL7D 5JBBS 2PKAB 5F8TA 1O2IA 1C2EA 3GISX 4M10A 1N8OB 2XBVA 1F5LA 2WPMS 4YTAA 1XKAC 1MH0A 4B2AA 1BBRK 2A5AA 1AIXH 3ZZ6A 1LHGH 2VIQA 2QY0B 2WPLE 1O37A 3N8YB 3SW2A 3NTBA 1G9IE 4MPXA 3QDZB 1P06A 2Z9JA 1K1OA 4IGDA 5JB8E 1HCGB 1F5KU 5EXLA 4CUFA 1SGFG 2C4FH 2WG3C 5HM9A 1GWAA 4ABIA 4CUEA 3FZZA 1G1TA 2QCYA 3BN9A 1O2QA 1AO5A 3ZZ4A 1RTLA 4TT3D 1C1TA 1D3DB 1QY6A 1EGFA 5CE1A 5KIRA 1MTWA 4J1YA 3ATMA 2GMTB 3BSQA 4Q2KA 3OY6U 1SPJA 2XBYL 5AHGH 1JOUB 2BVXH 4YESB 1WYKA 4D76A 2LP6A 3RR3A 2TGAA 2PUQH 4DJZB 2VVUA 3A85A 1O5DH 3RXPA 3MMGA 3NPSA 3UWIA 4BAQB 2K0QA 2DE8A 4LK4A 3SQEE 2B5TB 1YPHE 1L0ZA 1MBQA 2VWNA 1F7EA 5L30H 5H4IB 2GV7A 2BY6X 2WPJS 4SGBE 5T3HA 1GGDC 3K6ZA 1AFEH 1VCWA 3GCWE 1BQYA 1GHVH 4SGAE 1PPZA 8KME2 1VJ9U 2SGFE 4NZLA 3PWCA 3SU3A 2K2SB 4IN2A 1MTVA 1ZOMA 5ESBA 3UOPA 2ULLA 4WY3A 2CJIA 4YLQH 1QURH 4ISNA 5C94A 1O2YA 1Z6JH 1K28D 2WHXA 2ZG0H 4F55A 1G1QA 4Q80A 2Q6GA 1MABB 1TQ7B 1UVUH 4Q63A 3KIDU 3E16B 3KN2A 3GY6A 2OBOA 1NTPA 4NWLA 4BTUB 1EPIA 2BVRH 2RCEA 2NPRA 2A4RA 3DSGA 2HOXA 5SGAE 1GI4A 5TCCA 2CF8H 4X1PU 1S84A 1MAXA 4CRAA 3LGUA 2HNTE 2Z9IA 5K0HA 1ELDE 2I6QA 4CHAC 3RDZA 4NSYA 3UFAA 3UNQA 2GCTC 4NFEA 3P8FA 3PRDA 2G51A 1EPTA 1C2IA 4MNWA 1C2HA 3A8AA 5E0GA 1Z1IA 2J92A 1GHZA 4X2YA 4FU9A 1YLDA 2PGQB 2W6JD 2BVSH 3PV4A 4Q4LA 1SGDE 3PLPA 4RKOB 2BT7A 1U8CB 5EIYA 5J4QA 3SUFA 3OY5U 2J38B 3PO1C 1QNJA 1QL8A 2XWAA 1FPCH 5EQSA 3F9EA 3LIWA 3RU4E 4XD7D 2Q1JA 1IQJA 5I46L 3NCLA 1F5RA 5DPAA 1LPZA 1HIAA 2W7UA 1A3EH 2B7DH 2VH0B 2A5KA 4FU8A 1CHOG 1D6RA 1VITG 2BOKL 4JZ1A 5C5OA 3DHKH 5ESTE 3SNAA 5C5NA 2XBWL 1RS0A 4H4FA 1NY22 5GCHG 1HGTH 2RHPA 1C2KA 2ESTE 4MMXB 1UTKA 4AX9H 4B1TA 2XXLA 1GJ5H 1LQDB 5GIBA 3BTQE 3L3TA 3F6UH 1IQLL 1DVAL 1YPJH 3SV6A 1MZAA 4MNVA 5B6OA 5KN5C 1TLDA 3R3GB 2R9PA 2OQ5A 2KV4A 2CXVA 2XW9A 1MCTA 1O3NA 3DCLA 1P10A 1OWIA 1HAHH 3SZEA 1DS2E 1GBDA 1UK3A 4UDWH 2BQWB 1T8LA 3MH5A 3PROA 1HJ7A 5DJ7A 4AYVB 1COWD 1TNLA 4KTSA 3EAJA 1J16A 4ZKSU 1S0QA 1AN1E 3GY5A 1QRZA 2ZFTA 1DWEH 2SGQE 2WPLS 3KQDA 5C17A 2HPPH 1UK2A 3SJKA 2FIRH 2STBE 3M37A 2ASUB 1HT8A 2XC0A 1JBUH 1IOXA 2BD4A 2FLBL 2FOEA 2QAAA 2AFQB 2AGIX 4XL1A 3AK5A 3A7TA 3CS0A 5JB8S 3L6PA 1RFNA 3ZZCA 1NN6A 4KTUA 2J2UA 5FPYA 2EI6B 2G4UA 3LAQA 1J8AA 4NG9L 4B6EA 1UVTH 4GLYA 3SV7A 2HLDD 2BMGB 2LNCA 3LTFB 1BIOA 1AI8H 1C5UA 1P0SH 2ZDMA 5EG4A 3W1EA 3A89A 4HI3A 4RKJB 2IJD1 1NRRH 2KNIA 2ZIQH 1TB6H 4Y76B 3AVZA 2ZDVH 4NIWA 5HXFA 2BY7X 1BJVA 2TBSA 2JDID 1BMNH 1NROH 1UVSH 3M3VA 2H9EH 2UWPB 1Z6EL 1GBLA 1HZ8A 1MZDA 3LGVA 2QXHA 1UTNA 2IN2A 2OUAA 3BTFE 1FFMA 3HK3B 2XCFA 2HALA 4JZFL 3UOUA 3GISB 1Z8GA 1GI2A 5ABWA 4JYUH 1AY6H 1P2NA 2JKHA 1W2KH 5JB9E 4YT6L 8ESTE 3P92A 2OBQA 4D9RA 3U28C 1ADXA 2FTMA 4A5TS 1GJ7B 1COUA 2W3IA 4XRNA 2WUBA 1LMMA 1TNIA 5E0JA 1NZIA 4MNYA 2ADXA 2P94A 5L2ZH 2BXTH 3Q3KA 2KFWA 5JBCE 2M5TA 3BEUA 2WZPP 1A0JA 1FONA 3RXJA 3QZRA 4O9VA 3QCWA 2A4OA 2YGOA 4GUXA 1FMGA 4ACAA 3HGNA 1Z8RA 1B5GH 4B2BA 4LZ1H 3SW2B 1L1GA 1CSOE 2R3YA 2QA9E 3RXCA 1HB0B 2YNAA 1AZ8A 3KQCL 4X1QU 3E6PH 1GVKB 1WQSA 1HAXB 2NU3E 2J98A 2J4IA 1IQNA 2A31A 4NWKA 3G01A 4D7FA 2FOMB 3BG4C 2BHGA 3BTWE 1NC6A 2A7CA 1IQMA 1YKTA 1UMAH 3ZV8A 1JIMA 1QCPA 1PFXL 3CENL 1CCVA 3GICB 3QGJA 2NU1E 4FUIA 3UR6A 1C5RA 1TNKA 3ZV9A 4FUHA 2BSFA 1TOCB 4JYVH 1H8HD 3SU5A 4B71A 1SFQB 1URKA 2D26C 3BTTE 4YO9A 3MYWA 1L1JA 3ZVEA 2RFKC 1K1PA 3QTVH 4K5ZA 3RXGA 3SYJA 4X2WA 1P09A 1C2MA 2F83A 2P3FH 1BTYA 3ZYEA 3Q76A 1KLOA 1CVWL 1TALA 1IQIL 3FFGL 3TNTA 4WF8A 2Z9LA 1XKBC 1QJ6B 1O2NA 2FODA 1ETTH 1S0RA 2Y5GA 1C5ZB 1QR3E 3PMAB 1L1NA 4A7IA 3KF2A 1EZQA 3F2HA 1CE5A 1Y3UA 3MI4A 1GBBA 3C1KA 2ZC9H 1O2VA 2QXIA 1CQEA 3KGPA 1TAWA 1GJAB 2XTTB 3EE0B 1YUGA 4OTYA 3LOXA 2FS9A 1HXEH 2P95A 1O3FA 1KIGL 1DITH 2XC4A 4ISHH 3FZDA 1HJAB 4DGJA 4U01A 2VWMK 1C5TA 3WW7A 1EMNA 3P5BL 3U8RH 2CJIB 2QV1A 1ATBA 1P9JA 1EP5A 1NFWA 2R2MB 4RUTA 1XMNB 4JMYA 1IQHL 1OSSA 1V2UT 1O5GH 1NS3A 1NM6A 4FUEA 1WQVH 3RXMA 3RXUA 1H8IH 3URCA 1M1XB 2ZCHP 4O1ZA 1QJ7B 1SMFE 3PRBA 1GK5A 1NT1A 4TYDA 3EA9A 5K7RA 1V1IA 2BLOA 1S6HA 1A3PA 1SLVB 2BLWA 3RC4A 5I46H 2KL7A 1PTHA 1CT4E 2KZ4A 2NU2E 5DP8A 1BITA 1O5AB 1NRNH 3MFJA 1A46H 3QWCH 1NFYB 2JJLA 1DUAA 1LHCH 2FOCA 1V2JT 3LT3A 5E2PA 1IQKA 1WSSH 3VPKA 3GOVB 1AD8H 3E3TA 1EPTB 1V2LT 3RXHA 2PKSB 3TPIZ 2W2ME 4GSOA 2W2PE 4AN7A 3GY2A 5C20A 5IKRA 2P3TA 1O2ZA 5JVYA 2FZZL 1AWHB 2XOKD 3K9XA 2FDAA 4K1TA 3AASA 4NGAL 1GCTC 2Z9KA 2FD6A 1PPBH 3MNCA 1AU8A 4OGYA 3LIWB 3MWIU 1FZZA 1ZSLA 3C27B 2RA0L 1EASA 2QE7D 1BHXB 1DSUA 1HIAB 1LPZB 1PQ5A 1QIUA 1Y5BT 1QTFA 1WU1A 2XC5A 1PQAA 3LJOA 3SZNA 1YPEH 3ZVBA 1CA0C 2I6SA 4TY6A 3EA8A 1ESAA 1A4WH 3B8JA 1KSNA 1ATEA 1O2JA 1S83A 1W0YH 2WINI 1O3PB 3R05A 1F2SE 1FXYA 1O3GA 1S6FA 3I77A 1CGIE 1TNJA 3DSPA 1QBOA 1KXFA 5T6DA 1GMDF 2VVCK 3H09A 2FLBH 3VB7A 4Y8YA 5EXNA 1RTKA 5JB9S 2VWLL 3A84A 2A0QB 3I78A 4XFQA 2H6MA 2PUQL 1ANCA 1O5DL 1UW7A 1C4Y2 3LGTA 1QL9A 1C5PA 1N6XA 4VGCC 1SLXB 5JBCS 4WXIA 1PXXA 3UY9A 1WBGB 4RRWA 5L30L 1KLJH 3CFWA 2BY8X 4IN1A 3PV2A 1TNHA 4K8BA 2BD9A 1F7MA 3V12A 5FPTA 1IQFL 1SHHB 3ODDA 2FMJA 2BQ6A 1DSTA 1M9UA 1BTXA 1OXGA 1O3DA 3OTPA 2SFAA 5JBAE 1XKBA 4YOJA 1FUJA 2P16L 2SGDE 1RFNB 2A5IA
chains in the Genus database with same CATH topology
2J2UB 2GCHG 2QC2A 1JL9A 1QRXA 2A7JA 4O03A 3U1JB 4ZH8B 5FBIA 1O2MA 1VGCC 2XWBI 2QGRA 2FLRH 1BCUH 1DXPA 1GHBF 2Y5HL 1IQEL 3ASIA 1H9HE 1K22H 1O38A 4Z0LA 1TA2A 2ZDAH 6ESTA 4COXA 1F0TA 3QLPH 4I8HA 2ZGXH 3TNSA 3ZYIB 1GCDA 4AB8A 4K60A 1UTOA 3ZVFA 3T62A 1V6DA 3D62A 4MPWA 4LOYH 1SHYA 1TFXA 3STJA 2KB9A 2Y7XA 3KRKA 4Y6DA 3N8WA 1MQ5A 3UNRA 1IGZA 1C1WH 2H1UA 1C5QA 2SGPE 2BD5A 2GCTB 1W8BH 4Y79A 2W3IB 3M7TA 7KMEH 1W3CA 1HAEA 1F0UA 2FX4A 1P9UA 2B7DL 1T8NA 3ZYGA 1UZPA 4RRYA 3SU6A 4BDWA 2FOAA 1QA0A 3PWBA 2BQ7B 1TPOA 1O35A 4BAMB 5CHAC 1LMJA 1HAGE 1P3CA 3TGJE 1OWEA 1BMLA 2ZFFH 3PO1B 4DVAU 5GPIB 2FXRA 2AGGX 1T4VH 4DOQA 4YLUA 4GAWA 2MHPA 4MPUA 3F6UL 3EDXB 2RG3A 4I8JA 1OP0A 3NKKA 2WFTA 1T7CA 2VIWA 2BDBA 4ABFA 1K1NA 3ATWA 2J4IB 3KK6A 1UTMA 2A1DB 1C1PA 1GHAF 1QBVH 3NZIA 3MO9A 5CKMA 2G00A 3VXEH 1G30B 3VB6A 1BOQA 2VGCC 4ZHMU 1GBJA 2GD4B 1ZYOA 1UHBB 1EPJA 3RXAA 4Q7ZA 1GVLA 1KIGH 1HAOH 2H5DA 3CS7A 3ELAL 4OGXA 1ATDA 1P57B 1KDQA 1TPAE 3U9AH 1V2NT 2BDAA 1TE0A 1DE7H 1C1MA 3Q3YA 1K1JA 3RXSA 2WYGA 4MPVA 3GYMA 1SGFA 2QXGA 2F91A 2WV5A 1JBUL 4AGJA 4A7IB 4PH9A 4BAOB 2AMQA 1EZQB 4O3UA 5JW1A 1MCVA 4XSKU 2ZQ2A 3KL6A 1CGJE 1FIWA 1O2RA 4AB9A 4GHTA 3RXTA 4LZ4B 1PPFE 3ATLA 2BZ6L 4GVUA 3RXFA 3TBDA 2OQUA 1P12E 1GBEA 1OP8A 3JZ2B 3V65B 1P0SL 3MNXA 2AYWA 1DM4B 1NFWB 1EQGA 1T31A 4D0FA 1AVGH 2BM2A 3LC3A 4WH8A 3TH3L 1XXFA 3VB5A 4NGAH 1APOA 3A8CA 2DE9A 2WG4B 1GMCG 1UTJA 1J9CH 1YPHC 3TH4H 2H9EL 1NQLB 2AEIH 5LGOA 5C2ZA 3JZ1B 2D1JA 3NXPA 1Q2WA 1ZRKA 2IPHA 2Y81A 5FAHA 2BD2A 2HOBA 3HO3A 2Y5FA 1C5NH 2PSXA 5ETXA 1O0DH 1ETRH 2ZDNA 1TX7A 2VVUL 1EATA 2VIDA 4JYUL 1O32A 3ITIA 3BT2A 4AG1A 5CISA 1HJ9A 5GWZA 3MH4A 2XBXA 1XUKA 2VWNL 1MOXC 2OC8A 2M74A 4NIXA 4GCHG 1GI7B 4K69A 5L2ZL 1AFQB 4UONA