4BXWA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
322
structure length
286
Chain Sequence
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR XA
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
total genus 69
structure length 286
sequence length 322
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxwA02
6ESTA 1NN6A 2Y5FL 2BHGA 1ETTH 1GI5A 4FUCA 1WV7H 5DP5A 5LPEA 5H4IB 4X0WU 3AVZA 1V3XB 3QK1A 1FIZA 1O5DH 2WPHE 1CCFA 3D62A 1IQML 2AIQA 1PJPA 1CQQA 1HPGA 1H9IE 2WG3C 1SQTA 3KQEL 2OC0A 1NT0A 5EG4A 1C2FA 1KLIH 1N8OC 1C2EA 1YCPH 1C5UA 1O3GA 1K22H 3A8CA 1JBUL 4NA9H 4O9VA 1HAOH 1XUHA 4GSOA 3KCGH 1NU7B 4UDWH 2VVVA 2P3FN 4RKOB 1LQDB 2OP9A 4RRYA 1MUEB 5L2YL 5E2OA 1AUJA 3UR6A 1UTMA 3K6ZA 3LKWA 2XRCA 3NXPA 1A46H 1HV7A 2VJ1A 1A4WH 5EPNA 1QB6A 2OD3B 3RXVA 3N8XA 1XUJA 2MGRA 1EPHA 2ZQ1A 2JH6D 3BTME 3UIRA 1HAVA 3KL6B 2UWPB 2P26A 4YT7L 2VIQA 1ESAA 4IN1A 2ZGCA 4GLYA 3SJKA 4KTUA 1VITG 1EZUC 1Y5BT 5ABWA 4BXSA 4XBBA 4BTUA 2MHPA 1FIWA 2P3TB 3QH0A 4COXA 3PTNA 1EQ9A 2WYJB 2STBE 1AWHB 1LPZB 1ARCA 1P04A 2OLGA 5AVDA 5C67A 1AUTL 2EA3A 2W26B 1AHTH 4ZH8A 4NG9H 4JK5A 1EZXC 4X1PU 3POYA 2A32A 4IC6A 5EU8A 1YBWA 2PSXA 5GCHG 2FLBH 4FUIA 3Q3YA 3RXOA 5IKVA 3MHWU 2Z9LA 4IC5A 3BEFB 3DFJA 3Q3KA 4ZXYH 2P16A 1H8IH 1QRXA 1MBQA 1YPEH 2FX6A 4JZEH 4RSPA 3NTBA 4DT7B 1FXYA 1NTPA 2OYUP 1CA0C 3LTFB 1SGIB 3OY6U 1IHSH 1HFDA 4I33A 1N1LA 2XCNA 3GDSA 3RXEA 1F7MA 2CF9H 1VZQH 2FLRH 1YYY1 3UNQA 2PFEA 3MU5A 1W7XL 4BNRA 3U8RH 2XXLA 4CH2B 3LGUA 5FCRA 4NCYA 3HATH 3NJPC 5JBAE 2FZZA 1SVPA 3DFLA 1CBWB 2C8ZB 2G5VA 4X1NU 1D6WA 2O8LA 4UFFH 1DANH 1GGDC 1AWFH 3ODDA 1UTJA 2Z3EA 1TYNA 3SV2H 2QV1A 3BG4B 3RXGA 3SJ8A 4IS5A 6LPRA 5K0HB 3NWUA 2SGQE 1D3TB 1F92A 4NFFA 1P03A 1RIWC 2BX3A 3BEUA 4CREA 2BB4A 1PTHA 3K9XA 1X7AL 4CH8B 5LGOA 2J95A 4UFEH 3K9XB 4TY6A 4UFGH 1BRUP 1O2RA 4O02B 1FI8A 2FOMB 1AMHA 1HAYB 1O3JA 2P3FH 1O3LA 3EE0B 1IQHL 1O2XA 1IHTH 2B9LA 1EATA 2BDCA 2XC4L 3DHKH 3A7VA 1TRNA 1GJCB 1G2MA 3HO3A 1PPZA 4GCHF 1P2JA 4WVPE 4U2WA 4H6SB 3NUMA 2ZG0H 1W8BH 3M35A 1MQ5A 1EJMA 1QL8A 2XC5L 3BTFE 3RXBA 3U1IB 2BY7X 3K65B 2V0BA 2IPHA 3UFAA 1ZGIA 2RNLA 3A81A 1QBVH 3SUFA 5GXPA 2P8OC 1SLXB 3SGQE 1Z8IB 3LAQA 1K2I1 1HAHH 2F91A 1KTSB 3Q3XA 5DP6A 4WMDA 3HO4A 3TBDA 1TLDA 3T28A 1DICA 1GDUA 1H1BA 3B23B 3BTGE 3R05A 1P05A 2WYGB 4LMFA 1YUFA 2AGEX 4TPYA 1EAIA 3GOVB 5BRRE 2Y5GL 1O35A 1GVZA 1CSOE 3K2UA 2WPJS 1PXXA 4B71A 4Y0YE 2GT7A 4CRBA 3SUDA 3VEQB 1WSSH 2FDAA 1TQ7B 4IGDA 2GGVB 5FX6A 3VPKA 1FY5A 3BTDE 1O36A 4AYYB 3OYPA 1MQ6L 1GCTB 4UD9H 3SOSA 1D9IA 3SU1A 2JETC 3UTUH 1MKWK 1OP8A 1DUEA 2XBYA 2LNCA 3QZRA 1T8MA 3DUXH 2BD8A 4CRCA 2H2ZA 3KK6A 1GBBA 3KEEA 2W7SA 2BD7A 2A4QA 3ZYEA 4X2XA 1RJXB 2H9HA 2P28B 1IQNL 2XCFA 5C3NA 1O5BB 1C9TA 1EASA 2AFQB 4O03A 2F9BL 1U67A 3UNSA 3ZYJB 4IMQA 4NIYA 5KIRA 1YUGA 3MDLA 3SJOA 3RXFA 2BM2A 1N8OB 3BTHE 3GCTG 3GY6A 1IQEL 1Z8GA 5TJXA 5EGMA 1EKBB 2HNTE 2BQ6A 3LC3B 5EGMB 2CV3A 1A0LA 3B9FH 4KTSA 1VJ9U 2ZQ2A 5EQRA 2RG3A 3TJUA 4WH6A 5EXLA 4CSYA 2A4GA 1ZAQA 4AG1A 1RTFB 3PO1C 4NFEA 3RXTA 1QA7A 3U1JB 2ZGHA 1YM0A 2R3YA 2TPIZ 2QN5T 3I29A 4WXVA 1GMDF 1ETRH 1WOFA 3C27B 1TMBH 1GI7B 1EX3A 3RXKA 1GJBB 3HGNA 2ZFRH 1ELDE 2BLOA 1SI5H 1MOXC 1ZRBA 1UZJA 3M36L 4WH8A 1MD7A 2QGRA 1HZ8A 2Z9GA 4JYUL 1YF4A 1AIXH 1M9UA 1DXWA 5C1UA 4LK4A 1RFNB 1BB0B 4MMYB 1EB1H 1TPGA 2PV9B 1HJAC 3UY9A 2VWOL 3AASA 2ZU3A 4B1TA 3LONA 3FP7E 3TJVA 2BDYA 1ADXA 1K36A 1O2KA 1GBTA 1G2LA 1ANEA 1O5DL 1FY4A 1V2NT 3NTGA 1YO8A 2VIDA 1O2TA 4WMFA 2FM2A 3I77A 3UR9A 1NFYB 3MOCA 2K2SB 3ZVCA 2ODQA 1Z6EA 2BZ6H 3NK8A 4FUEA 1Y3XA 1CA0B 1KLIL 1DM4B 4A1VA 1MMJN 2AMQA 3URCA 4NA9L 1FAXA 3KCGL 3JZ2B 3LIWA 4FXGH 3PMJA 4ISHH 4XDEA 1V2KT 4YLUA 5A8YA 3RU4T 4DOQA 3HKIB 2AERH 2JKHA 1UVSH 1ZTKA 1IQGL 4FUGA 1ELFA 3BTEE 2AGGX 1EP6A 4AYVB 4GCHG 4JZIA 3ENSB 4CUDA 1ZHPA 2PSYA 3LOXA 4Y7BB 2Y7XB 2Z94A 5CHAB 5CKQA 3T29A 4GVUA 2FOCA 3SHCH 2RA0L 4B73A 2BX4A 5C20A 2BLQA 1GBAA 2RHPA 1O3HA 1LO6A 2FOAA 3BEIB 1RIWB 3DA9B 1SB1H 1YCPM 4D9QA 4OGYA 1QJ6B 3MYWA 3UOPA 1F2SE 1TA6A 3GCOA 3RM2H 3KQBL 1VCWA 3GICB 1P10A 3GISB 2FOEA 1GHXH 1FQ3A 2VH6B 4NG9L 3PB1E 1EMNA 2FLBL 3VB6A 3ZZ8A 2QCYA 3S9BA 1JBUH 4TWWA 1FNIA 2ZDAH 2GTBA 4ZXYL 1CHOF 2NU0E 2VGCC 1YKTA 5JBBE 4JZEL 3E3TA 4AOQA 1GVLA 4ABIA 4GHTA 1ABIH 1GHBG 1S0QA 1YLCA 2OQ5A 3EA8A 4CUEA 1UMAH 1C2DA 4NWLA 5F8ZA 2VIOA 5I46H 3KQDL 1HJ7A 4MMXB 2FTLE 2P8OB 1SFIA 1OWKA 2XBVA 2FLRL 3RDZA 1MKXK 2JH0D 1CT4E 4D9RA 1O2MA 1MD8A 1GBJA 1SC8U 1THSH 1HAPH 1T4VH 4YT7H 3SOVA 1G30B 1TFXA 2D1JA 2VVCK 1BBRH 4KGAA 2BVRH 4JK6A 2SGDE 2MGPA 3MQEA 4C16A 4AZ2B 3GDUA 2KAIB 3EGKH 4CBNA 1O2HA 9ESTA 9LPRA 3HK6B 3DEMA 2P95A 1C1OA 1SGRE 4FM5A 1NFUA 2KB9A 5GIBA 2ZECA 1NFUB 1UTLM 2NU1E 5JDUB 1AFEH 1PQAA 3ODFA 3SUEA 2Q1JA 1GVKB 2RDLA 1SQAA 2JETB 2Y5FA 1V2QT 2ZU4A 3PWBA 3QGJA 2FOGA 2GCTB 1BDAA 3HPTB 1Z1JA 1IQMA 2ANKH 1O38A 8ESTE 1O30A 1O2WA 3KQCL 1W8BL 1W7XH 1ARBA 4IN2A 1SQOA 3MH5A 4JZ1A 3QGNB 1JOUB 5HYOA 1CQEA 3R3GB 1NFWA 5E0JA 3SNBA 3SV8A 4KTCA 1V2VT 3M5LA 1TB6H 1YPKH 1LMJA 1HX2A 4AN7A 1O2QA 4O3UA 2VB0A 2Y80B 3N8YA 1KXCA 5AHGH 1V2LT 1ZMLA 4WY3A 2WPHS 1O32A 4RRWA 2ZFTA 3M3TA 4LZ4B 1O2YA 2VINA 1QQ4A 4DG4A 2BOHB 4Y8YA 1P9SA 2ZPSA 5C2ZA 1LTOA 1G9IE 5B6OA 1PQ7A 2BYAX 1EBVA 1E38B 3A8DA 3CP7A 4ISNA 4OS2A 1KLOA 2A2QH 4E05H 2R0LA 1XX9A 2ZF0H 3LGWA 2HOBA 1GI4A 4MPXA 3RU4D 2UWOB 2K1QA 4ISIH 1LVMA 2XWAA 4BAHB 1V2UT 4X1QU 4RRXA 1V6DA 1ATEA 2WG4B 4Z0LA 3MU4A 4DW2U 3MNSA 4D0FA 1L4DA 1OWJA 8KME2 2G5NA 1VITF 3BPSE 3L3TA 2FEQH 3RC5A 1WYKA 1LHEH 1PQ5A 4H4FA 2ZFSA 1QB1A 2ZP0H 2NWNA 4XSKU 1YPMH 1YPHC 1TALA 2BDAA 3OLTA 2VH0A 4X8UH 2J4IA 2YGOA 2P59A 4TPIZ 2UWLB 3BF6H 5GDSH 5GCHF 3BG4C 3SJ9A 5F03A 3PM3A 1IOXA 2BVSH 2QIQA 3WY8A 1Y3YA 1PPFE 1OP0A 5EW1H 1UHBA 4INHA 1N6XA 1HYLA 3EA7A 4FU7A 2D2DA 1W14U 3IWMA 3LT3A 4Y8XA 1AB9B 1ZHRA 2BDIA 2ALVA 1EJNA 1QQUA 1KSNA 4HFPB 7GCHG 5JB8E 2R3UA 4FVBA 3S7KB 4GPGA 1AU8A 1KY9A 1IGXA 1A1RA 7ESTE 1QIXB 3MU0A 1K1PA 1ZHMA 1L2EA 1YGCH 3LGTA 5IKTA 1P2QA 1ELTA 1G3CA 3GYMA 1G3BA 1IQHA 1ZTLA 5JBAS 1P11E 3U8OH 2XC4A 5A8ZA 1P12E 1Y5AT 1JL9A 1VGCB 3JZ1B 5FPYA 4CBOA 1LKBA 3KGPA 4Y6DA 1O3EA 3T2NA 3OX7U 5DP3A 4ZHAA 1K28D 2XC5A 2VWNL 3TK5B 1AE5A 2CMYA 4ZHAB 2VGCB 2VVCA 1S6FA 1APQA 3LJOA 4LZ1H 1J15A 4KELA 3GY7A 2H9TH 4LORA 2V3HH 1EAIC 1OX1A 2M5TA 1INCA 4UFDH 4YLQH 3U8TH 1C5PA 2O9QA 3F6UH 2VWLL 4RN6A 3RXSA 2RCEA 3PLKA 2GDEH 1TNJA 2UUYA 2DE8A 1FLEE 3MWIU 4ISHL 1MTSA 2UUFB 4NIXA 1KXDA 1CE5A 3GCXE 4JCNA 2WPME 2HALA 1Q3XA 4I8HA 2KV4A 4MNXA 1L1JA 3PYHA 4PROA 4Y7AB 3KN2A 2G4TA 1O31A 5JBTA 1F5KU 2I6QA 3GY3A 4AFZA 2ZHEH 1FMGA 1O2PA 5E8EH 1GI8B 4ABFA 3ZZ7A 2AIPA 2ZWLH 1LDTT 3TPIZ 3P8NA 3M3SA 1ATAA 2ZEBA 4IW4E 1C1RA 1MQ6A 2A4RA 3H7OA 2H6MA 3E0PB 2ZGBH 4JYVH 1BA8B 5L30H 4XBCA 1SR5C 4I8KA 2W3IA 3ESTA 1BHXB 1DDJA 1O3MA 3T62A 2W3IB 2W86A 1D3PB 2K2TA 2GVFA 4ABHA 2XW9A 3ZVFA 3H5CB 2OCVB 3S0NA 3V12A 2QYIA 4X6MA 1PFXC 2W3KA 1BTWA 1BTYA 1C1WH 1MU8B 2CHAB 3EQ0H 4D8NA 4Y76A 1IQNA 1BTHH 1IQLL 4Y76B 4YT6H 1CGIE 1HAZB 1XVOA 2GX4A 4X8TH 1NC6A 2FMJA 4Q7YA 3ZVEA 1P2MA 2G00L 1NFXA 3M5MA 1XXFA 5I46L 1IQEA 1RTLA 2EI7A 3P6ZB 1OWDA 4RKJB 1H9LB 1IJQA 1MH0A 4K8BA 1O2GH 4K2YA 4IBLH 4K69A 1H4WA 2AS9A 1HAVB 3SOQA 3LPRA 1WTGH 4Q80A 4BAKB 4DY7B 1OWIA 2RA3A 2ALPA 1FSBA 1GI6A 5EOKA 4MNYA 1HXFH 2XC0L 3ZYIB 2FTMA 2V6NA 4UONA 2OC8A 1G3EA 4BTUB 1OYQA 3GCTF 1SL3A 3GCWE 1F5LA 3LH3A 4R8TB 1DT2A 4RUTA 2FESH 4BAQB 4ZH8B 3M36A 4CRFA 3SNCA 2P3UA 4OS7A 1TNKA 3A86A 4K5ZA 1DIYA 1MAXA 3A84A 4NZLA 3ZZCA 2P3UB 2GD4A 2GMTB 1NPMA 5L2ZH 3LGYA 3PV4A 2FI3E 3O8DA 3A7TA 5HXFA 4I32A 3Q3KB 2WFXB 2KL7A 1O2OA 3STIA 3LN0A 4XFQA 1ZLRA 2VWOA 1A5IA 3GY8A 1UVUH 1GI1A 4FUHA 2QAAA 4ASHA 1CCVA 1O2ZA 3ATWA 3FAOA 1A0HB 1AKSA 3B8JA 4ZKRU 2WINI 3U73A 4NIVA 1IVOC 1K37A 1GJ6A 3RMNH 4K8YA 3BV9B 3QX5H 1S0RA 3RC6A 1GBDA 2BQWA 1GJDB 2ANYA 3E91A 4GUXA 5CHAC 3SUGA 3D65E 2A0QB 2PW8H 1BHXF 5C1XA 2XTTB 2WFTA 1NRQH 1IQGA 2VWMA 3HO5A 1P3EA 3UQOA 4NSVA 1TRYA 2HNTC 1NRNH 1C4U2 1KDQA 2G81E 2ULLA 4Y11E 5C1YA 3ZV9A 2J95B 2GT8A 4SGAE 1TONA 5DKMA 1W0YH 4VGCC 3BG8A 3ZZAA 1QB9A 2C3SA 2RA0A 5EODA 2HLCA 5E0GA 4O3TA 3UOUA 3F1SB 3HS5A 4OTJA 1UZKA 3V3MA 3ZVGA 4AG2A 1BMMH 3BTWE 1K9OE 5FX5A 4AFSA 3M3VA 1JWTA 2Z9JA 1G2MB 1EUFA 3KQBA 4ISIL 1ZMJA 1GBKA 2Y7ZA 2ZC9H 1UZQA 1O2VA 2Y81A 1O2IA 3QN7A 1DE7H 5A0BA 3URDA 2Y81B 2EEKA 1GJ7B 2C8WB 1C1MA 3RXMA 1TOZA 3S7HB 2A4OA 1KXBA 2I6SA 2PR3A 1DSTA 3TNTA 1P02A 2A5AA 2WPIE 2F9OA 1ZR0A 5FXLA 4X8UL 3RXLA 1FFMA 3A85A 2FO9A 3KQDA 4U30A 2ZHDA 3GY5A 3F9EA 1F0TA 2I9AA 4FVDA 1KIGL 1PRHA 1RRKA 1UTNA 4CRAA 2SGPE 3TH2H 1C5VA 1GHAG 1ETSH 2XBWL 1OPHB 1VJAU 1IQKL 1AZ8A 3UWIA 2C8XB 2BDGA 3F9HA 1ORFA 1AO5A 1GHBF 2PUQH 2IOTA 4BAMB 4AGJA 5J4QA 1SGPE 3TK9A 4NZQA 5JBBS 2CXVA 4E7NA 3N8WA 1PQ8A 2BDBA 1TGCA 2BDHA 2TGTA 2GCTC 3RXIA 1SFQB 3TITA 1YGCL 3A80A 1GBEA 1JXPA 3LDXH 1FPCH 1TE0A 3F9GA 1WTHD 2Z9KA 1OKXA 1C1NA 1Z6JH 3TGFA 3ATLA 4Y8ZA 1DLKB 1SGEE 4NWKA 4D76A 1IGZA 2ZFPH 1SGTA 4KP0A 4YZUA 3ZYGA 1BIOA 4E1GA 3EYDA 1DVAH 3LGIA 3P95A 1AVXA 1SGCA 3KQCA 4U32A 2A5IA 2TIOA 3QWCH 1L0ZA 3D49H 4Y0ZE 2BQ6B 4OS5A 4M11A 1NESE 1NS3A 1O37A 1P2KA 3S69A 2B0FA 3UQVA 5GPIB 1G1TA 5T6GA 3LTGD 3RMMH 3F6UL 2W2OE 3TH3H 2BOKL 2W2PE 1A3BH 1DFPA 2FYQA 1LVOA 5CKNA 1HGTH 1ANDA 1O39A 1O3CA 4NGAH 1NY22 3I78A 1RD3B 1YPGH 2FXRA 1MTUA 1BTZA 4X6PA 3ATMA 3M5OA 3UNRA 1THPB 4AGKA 1FPHH 3EGFA 1AUTC 4ISOA 4I7YH 2OC7A 3DD2H 3TVJB 3PTBA 2R0KA 4D90A 2BOXA 2HPPH 5DK1A 1QNJA 3LJJA 2BTCE 3SW2A 1HRFA 2WPLS 2TBSA 4JYVL 5F1AA 5L30L 1HB0B 1G2LB 1W11U 5SGAE 3ELAH 4ABJA 2J9NA 2J2UA 5A8XA 2EI6A 2R9PA 3QUMP 2J2UB 1C2LA 1DXPA 5E2PA 4X2YA 3KF2A 3O8BA 1T32A 1BRAA 3U69H 1WCZA 3BTKE 3TK6A 2ZU2A 3LIWB 5EW2H 4YT6L 2ZZUH 1AB9C 3UPEA 1KXEA 4X8TL 1IQIL 1NQLB 3VGCB 3TGIE 2B8OH 4BTTA 4CRDA 4OS4A 1VITH 2G8TA 1O2NA 2ZU1A 1MKWH 1IOEL 2QF3A 1K1JA 2PLXA 2A45B 1SGFA 1O2JA 1X7AC 3ZZ9A 1FY1A 3A88A 3HK3B 1IQFL 2AYLA 1CEJA 2Y82A 4CRGA 2XBXL 1QJ7B 3E16B 3P17H 4VGCB 3SHAH 2Z6BD 1XKAL 1VGCC 5ESTE 4THNH 1P9UA 2C90B 8LPRA 1AE8H 2GP9B 3ASIA 1JIMA 3FZZA 3V0XA 1TOCB 2VU8E 4TGFA 2QXGA 4Q7ZA 5L2ZL 4D7FA 2P93L 1APOA 1QY6A 4INLA 7GCHF 3P8OA 1C2MA 2STAE 3IITA 1QFKH 1Z8RA 2PKAA 3L33A 2OINA 1MZDA 2PKAB 4Y79A 3MI4A 1P2OA 1O3NA 1QGFA 1QBOA 4ZHMU 2ZA5A 1UVOA 1LPKA 5JBCE 3EA9A 5JB8S 1O3BA 1YLDA 1BBRE 1LPKB 4ZKNU 1O33A 1SGQE 1C5MD 2VWNA 3FZDA 5T3HA 1C5ZB 1DPOA 3RR3A 1J16A 2ZCKP 3N8ZA 3D23A 2BMGA 2EI8A 5DO4H 1GPZA 2D1JB 1SGDE 2HPQH 4B74A 1THRH 2VWLA 1HT5A 4O97A 3MH7A 1EPJA 5J4SA 1ZPCA 4BOHA 2A7CA 3U98H 1TABE 2H9EH 1HLTH 3FP8E 3STJA 3PLBA 1HIAA 3F68H 2LPRA 2BXTH 1HIAB 2PHBA 4DIHH 1W2KH 1RS0A 5EQQA 1FE2A 3BN9A 2GZ7A 1WQVH 2OYEP 1S84A 1UCYK 4MTBA 1O5CB 3TGJE 1HJ9A 2ZDLA 2HWLB 2YNAA 1Z71A 2XWBI 3M7TA 1FY3A 2QF0A 2OC1A 2Q1JB 1B0EA 1UK2A 1LKAA 3RP2A 1ATBA 1FUJA 3OSYA 1MCVA 5E0HA 1EQHA 3LH1A 4QT8C 1LVYA 1P8VC 4OGXA 3SZNA 4ZAEA 1RGQA 2F9NA 1TX6A 3FFGL 2CHAC 4AB8A 1Y59T 5HM2A 2PGQB 3MTYA 4ZUHA 4H42U 2WPMS 3A7XA 1BOQA 2J94A 3KQEA 2J94B 1P01A 1U8CB 1NO9H 1T8NA 1J8AA 1F0RA 1C1VH 2HNTF 1AQ7A 1H8DH 1NFWB 1SOTA 1EB2A 2WPLE 1BRCE 1K1MA 4I8LA 4J1YA 1Y3UA 2PUXB 3A8AA 1PFXL 3KNXA 2W2QE 4UEHH 4MPUA 1UK3A 2G00A 1DY8A 1CVWL 4BXWA 3N8YB 3U7UG 1PGEA 1C2GA 2BVXH 3M37L 4A1XA 2NPRA 3RXQA 1CGHA 2ZU5A 4Q7XA 4B2AA 3C9AC 4JZDH 3SN8A 1A5GH 5FHTA 2FLGA 3NZIA 2C8YB 5DGJA 2PUQL 2XC0A 2P94L 1TWXB 2GMTC 1IAUA 1Z8JB 1EAUA 4FU8A 1ELBA 2NU3E 1TPPA 4K3JA 2Z3CA 1O5EH 2QXIA 1EAXA 3RXRA 5CISA 2Q6GA 3BTQE 1ABJH 4SGBE 3ITIA 1YPLH 2HGTH 1EOJA 3H7TA 1HT8A 1O5AB 5CKMA 3V7TA 1JRSA 4TYDA 2FI5E 2FS9A 1G36A 3PMAB 5FDQA 2FS8A 3T5FH 2ZTYA 2VNTA 5IKQA 4YM9A 3R0FA 2TGPZ 2F83A 3O8CA 1HCGA 1PYTC 3UUZA 2VH0B 1EPTA 2ZDMA 4X8SH 4E06H 4Y71A 2BY6X 1DVAL 2J4IB 4Z0KA 4DIIH 1KIGH 2FOHA 2A5KA 1WU1A 4M7GA 1WU1B 2V3OH 1YPJH 2D26C 1UHBB 2ZCHP 4BAOB 1DSUA 2B7DH 2BZAA 3ZZBA 1W13U 4R0IA 1D4PB 1MZAA 3P70B 3TH3L 2Y5HL 3MU1A 2ADXA 5JVZA 2ZHWH 1OYTH 1KSNB 5F8XA 1G1RA 1YCPK 1EOLA 3RMLH 2EC9H 3RXJA 3SORA 3ZVAA 3E0NB 3QZQA 1J9CL 4CR5A 3GY2A 4BTIA 4NGAL 2F9UA 4LOYH 1F5RA 3OU0A 1HXEH 4X2VA 1JIRA 2VWMK 1QRZA 3MNCA 1C5RA 3TLOA 1F0UA 1I0UA 1TNHA 3MO6A 3SU2A 1O34A 1PPBH 1GWAA 4YESB 3V65B 5FAHA 4ESTE 2H5CA 1GJAB 4FU9A 4D0EA 4Y6DB 1ZJKA 3ELAL 3SU0A 3GCNA 2ZNKH 1TNLA 2ZHFH 1GBFA 6GCHG 5HMAA 1TNIA 1C5OH 5IDKA 4INKA 3SBKA 3LC5A 1XVMA 1NRSH 2GDDA 1XUGA 1T4UH 3SU6A 3W94A 2BLVA 1L4ZA 3P8FA 4OS1A 2FODA 2CGAA 2AYWA 2C4FH 5FBEA 2Y5GA 2VVUL 1LHGH 2OQUA 2SGFE 5T6DA 1DWCH 1GJ5H 2XBWA 3T27A 3NCLA 3MU8A 1IQKA 1GG6B 1XUIA 4XOJA 1ELAA 1SGFG 3BIVH 3M5NA 1WHEA 1D3DB 3A87A 1SPJA 4TY7A 4PH9A 1B0FA 5DP8A 1EPIA 1V2WT 2GV6A 2F3CE 1N6YA 2WV5A 3A7YA 1ID5H 1GHAF 2WPIS 3MNXA 3KIDU 1QRWA 1NRPH 5A0AE 1C2JA 1P06A 1AVGH 1FY8E 4FUBA 2F9PA 2PKSB 5JVYA 3SJIA 1E35B 1C1PA 1GL0E 2AMPA 1DWBH 4ABGA 3A89A 1TAWA 5FBIA 1AD8H 1BQYA 1TQ0B 1V3XA 1YPHE 2DE9A 3E90B 3TGKE 1GDNA 2W3KB 1UTPA 1QFKL 4AB9A 1TBRH 1QL9A 2Z7FE 1P2IA 1BT7A 3BT2A 5AFYH 1F7ZA 1UVPA 3MH4A 1GMCG 3P5BL 1UTQA 1Y3WA 3GCHC 2CF8H 3RLYH 1NFXB 5T6FA 2BY8X 1TRMA 2SFAA 2WPKE 1ELGA 1TA2A 2EI7B 1UVTH 1V2MT 1DLEA 5E8DA 1LQDA 4ZROA 5CE1A 3SU5A 4Y10E 4WXIA 1WUNH 2ANWA 2ZGJA 1EZSC 1KLTA 1YP9A 2BOKA 1TBQH 1EJAA 1TX8A 3FCSB 2H9EL 6CHAC 2Q6DA 1A7SA 1E0FD 3KL6A 3RUOA 1Z7KA 4AFQA 4O1ZA 2WUCA 3RXUA 2UWPA 1GBLA 2PWXA 3SOBB 2GCHF 2YGPA 2IN2A 3PWCA 1GMHG 1W0ZU 8GCHF 2GD4B 1IQJL 2P3TA 4XE4A 2WYJA 1Y3VA 1LPZA 3CENL 2W26A 4HZHA 3V64C 2IJOB 4X1SU 3SV7A 1ACBE 1PYTD 4DCDA 2O8TA 2F9VA 1XMNB 2VIVA 2ZFFH 5A2MH 1W12U 1JRTA 1A3PA 2OXSA 4MLFB 1OWEA 3PROA 3PGHA 2BXUH 3PMHB 2FIRH 4ZXXH 5KN5C 4H6TA 1P9JA 1AKSB 4NIWA 5L6NH 4K1EA 1O3KA 1C2IA 2A2XH 1C1SA 5FCKA 3VGCC 5ETXA 1GBIA 5HGGA 3VXEH 4DURA 2BQWB 4YOJA 4RS0A 1PPGE 2ZDKA 3QO6A 1A3EH 3A7ZA 2BLWA 1TOMH 1AFQB 1A61H 4JZFL 1MTNB 1IQIA 3IG6B 1FAKL 2ILNA 1A2CH 2ZPQA 1C2KA 1LMWB 5DPAA 1KDQB 4HTCH 5FPSA 1T8OA 1TGSZ 1TPAE 1IOEA 1ZPZA 2BD2A 4JZDL 2XYAA 1TGTA 1ZOMA 5K0HA 3Q77A 1FN8A 2UUJB 3A83A 2VIWA 2Z9IA 1WQSA 3ZZ4A 3VB4A 4NSYA 1IQFA 1EZQA 1ZSJA 4MMZB 2TGDA 4MG3A 4ABAA 1EZQB 2XBXA 2FOFA 4ZKSU 1T31A 1CVUA 1UO6A 3MO9A 3ZV8A 3LGVA 3PLPA 1EMOA 5I25A 4I31A 3C1KA 1C2HA 2Y7ZB 3ZVBA 4FUJA 4CHAC 3ZZ3A 1XFEA 1BITA 3RXCA 3SV9A 1SGNE 4NA7A 1FDPA 3OLUA 3SNEA 1AN1E 1OB1C 1TX7A 2FI4E 2P93A 3S9CA 4X1RU 2W2NE 1O3IA 1EPGA 1URKA 3Q76A 1FJSL 4ZKOU 3M61U 1GBHA 1DWDH 1GCDA 1MTVA 3QMOA 1EGFA 2BY9X 2A7HA 2PR3B 3CA7A 2OBQA 1COUA 1C5WB 4X8SL 1YUKB 3TU7H 1CVWH 3ZYDA 1SZBA 3E8LA 1XUKA 3RC4A 3BT1A 1AY6H 1GBCA 3TNSA 3EAJA 4XBDA 2GKVE 1TPSA 1BJUA 1JMOH 5AFZH 2Z3DA 1CHGA 1A5HA 2WYGA 2B7DL 2WUBA 5ESBA 1U6QA 3TZIA 1XKBA 1K1NA 1EXFA 3SGBE 3N8WB 1L1NA 1BTPA 2ZI2H 3CS7L 1KXFA 1BMAA 1TPOA 2ZGXH 2QXJA 5JBCS 1L1GA 1P57B 2BO2A 1G37A 3MO3A 4MNWA 4ABDA 1KLJH 1TGNA 1S81A 2H5DA 1OXGA 3MNBA 5F19A 1P0SH 2XNIA 3RLWH 2GV7A 3TH4H 1C5YB 2O8MA 1GDQA 1LHCH 2V35A 1SHHB 4YZUB 2ODPA 2GZ8A 2BD4A 2ZFQH 1Q31A 3FFGA 3SNDA 1HRTH 1GK5A 1C4Y2 3S9AA 1QURH 1YC0A 1O5GH 4HGCA 4K60A 5DJ7A 1TGBA 5A0CA 4B2CA 3W95A 3AAVA 2AMDA 1SLUB 1CT2E 3QDZB 2OBOA 3ATIA 1GHYH 2VVVL 1W10U 2GCHG 4UE7H 1C5TA 1DX5M 1BRBE 2SGEE 8GCHG 1O2UA 3GCHB 1HREA 5PTPA 1WHFA 1C4V2 3OY5U 4JYTA 3SU4A 1OOKB 4B76A 1J9CH 3LC3A 2AH4X 4TWYA 3ZZ5A 4X6NA 2BD5A 2BY5X 4A1TA 1CX2A 3MMGA 5LH8A 1ZRKA 5HM9A 4OS6A 1DY9A 4GAWA 4A5TS 3M37A 4D7GA 1G1QA 5JB9S 1T8LA 1SBWA 1ZZZA 1SMFE 4LXBH 1S85A 3M7UA 1PPCE 1TNGA 1LQEA 6CHAB 1HAFA 3RXAA 4X2WA 5TCCA 1GI2A 4ISLA 5DP9A 4MPWA 5LPFA 2P94A 5EXNA 1N1IA 1ZJDA 3P8GA 1UZPA 1QJ1B 1AI8H 3SW2B 1BBRK 1C1TA 1BTUA 1C5NH 2ZIQH 1UK4A 2D8WA 2W7UA 1IP0A 1UTKA 1NZIA 1LPGA 1RFNA 1SGYE 5F6MA 1ZTJA 2P16L 1LPGB 3N7OA 3UWJH 1E37B 4X8VH 2CJIA 2THFB 1EPTC 3M7QA 2O8UA 2EI6B 4Z6AH 2CJIB 2W5EA 4XBMA 3E6PH 4DGJA 4YO9A 4U01A 1GJ8B 1SG8B 2FPZA 1SLWB 1TMTH 2A1DB 3GYLB 3OTJE 3TK6B 1NFYA 3FP6E 3NT1A 2FX4A 4AORA 3U9AH 2VIPA 1NZQH 1QA0A 2J92A 4AFUA 5JYIA 1S83A 1L5GB 1TIOA 4JMYA 2FZZL 3Q00A 1V2TT 1UTOA 3VB5A 4BTTB 1G32B 4MVNA 1T7CA 2ZHQH 5JW1A 1B7XB 1TLEA 4B2BA 1B9WA 2AEIH 5EXMA 4X6OA 1D6RA 1LHFH 5C5OA 2Y5HA 2R2MB 3KRKA 1B5GH 3ENSA 3Q7DA 1K1OA 3CS0A 3NPSA 3AW1A 4ABBA 3AW0A 3GY4A 4Y7BA 2Y7XA 4XLWA 1P09A 1GGDB 2Y82B 4GHQA 2W2ME 3RXPA 3RXHA 1F7EA 1P3CA 4KKDA 1CT0E 1MAYA 1ANCA 1QL7A 2R2WU 1M1XB 1DITH 3SQEE 3A82A 1MU6B 1V2RT 3IJEB 1S6HA 1TBZH 3PMBB 1S5SA 1V2ST 1XDTR 1C5XB 1VR1H 1ZYOA 3NKKA 1OWHA 2FYRA 4FUFA 1DDXA 4DVAU 4A7IA 3IITB 1ZGVA 1LVBA 4CUFA 1MQ5L 2SGAA 2VH6A 4A7IB 2WPJE 4CHAB 4Y79B 2TRMA 3A7WA 1FN6A 1ESBA 1Q4GA 1MBMA 2C93B 1ELCA 1OS8A 5CMXH 3QLPH 3FVFB 3HGPA 2HVXA 4ZXXL 1W3CA 2FOBA 2QXHA 4MDSA 5GJ4B 3RXDA 3BIUH 2BMGB 1V2PT 1Z1IA 1RTKA 5L2YH 1UJ1A 2EI8B 2H1UA 1ELEE 3CFWA 1HJ8A 1GG6C 1Y5UT 1OP2A 2FWWA 4DJZB 2ESTE 1GI9B 1V2JT 1GI3A 2DUCA 2ZDVH 3T25A 3ATKA 1XUFA 1XM1A 4ABEA 1GJ4H 1F0SA 6GCHF 2VVUA 1O5FH 2PHBB 3P92A 1F0SB 1KXAA 1KTTB 1QHRB 1AVWA 2A31A 2G52A 3RMOH 5IYTA 2ASUB 4BDXA 1W7GH 1LHDH 2HRVA 2KAIA 7KMEH 2ZTZA 3MFJA 1DOJA 3RU4E 2PKSC 3MH6A 3A8BA 1AZZA 5JB9E 2XBYL 4ZAEB 5DP7A 3TIUA 1HBTH 2FD6A 2ODYB 1K21H 1BMNH 1CU1A 3FBYA 1KYNA 2P3FL 1Y8TA 3GISX 4XL1A 4ZMAH 1E36B 1F0RB 4F4OC 3HPTA 1HDTH 1DX5I 3K6YA 1ELVA 1IQLA 1GMDG 1O3PB 1GJ9B 5DP4A 2QY0B 2BD3A 1BF9A 1HAXB 4JZFH 1O3DA 1FAKH 3SV6A 1EQGA 4K1TA 3TJOA 1JV2B 4YOGA 2NU4E 3O8RA 1WBGB 2YNBA 5A09A 1VCQA 4WWYA 5BPEA 4RRZA 4YOIA 1H9HE 2AGIX 4J2YB 1C9PA 1CO7E 2Y80A 3DT0H 4M10A 4B75A 1DWEH 2Q6FA 2TGAA 1BJVA 1GMCF 3PO1B 4I8GA 4YTAA 3N8VA 2BOHA 3T26A 1N7DA 1LCYA 3ZZDA 5LPRA 1J17T 1GHZA 3HS6A 1HUTH 4IMZA 1O3FA 3G01A 3EDXB 1C5MF 1K1IA 1IQJA 1KLJL 1QBNA 2WPKS 3UREA 2J34A 3VFEA 4CR9A 2ANMH 2QA9E 1A0JA 1MKXH 5K7RA 2J34B 1SHYA 1MTWA 2Y6TA 2UWOA 3CENA 1P0SL 2PTCE 1NU9A 2BOUA 5G4BA 4AQTA 3HKJB 3VB3A 2UUKB 3AAUA 2BD9A 1HCGB 3TJNA 1HAIH 1FF7A 5EQSA 1EPTB 2O8WA 1Z6EL 4Y71B 1HJAB 1GMHF 1VCPA 4Z0KB 2SNVA 1O3AA 2G51A 1O0DH 3ZZ6A 1UCYE 1GHVH 3F9FA 4ZHLU 1AFQC 1MTNC 1FAXL 4A6LA 1WAYB 2JH5D 1MCTA 1CBWC 2QC2A 3SNAA 1UCYH 2UWLA 2JKHL 1NPEB 1ATDA 2DDUA 2TGFA 2PTNA 1C5SA 1O3OA 1D3QB 4MNVA 2OTVA 2WV4A 1L3YA 4HI3A 1FONA 1K1LA 5COXA 5EPYA 3RM0H 1C1QA 1G1SA 4BTIB 4MQAA 1Q2WA 2G4UA 1C1UH 1C5LH 1P2NA 1GI0A 1ANBA 2OUAA 4WJG2 4Q2KA 1AGJA 3VXFH 1BZXE 1HNEE 1XXDA 3SI3H 1ESTA 1QR3E 1GL1A 5IKRA 3SI4H 1NT1A 3LN1A 1ZSLA 1CHOG 3ZVDA 1BCUH 1ZSKA 5FPTA 1XKAC 1SOZA 3QCWA 1RXPA 1BMLA 3SU3A 3HS7A 1TMUH 2J38A 3LU9B 5C5NA 1PPEE 2J38B 5TCAA 2BQ7A 1V2OT 2BQ7B 1ZMNA 1NM6A 5GWZA 3KHVA 2CN0H 1DQBA 4K1SA 2A7JA 2G55A 3SGAE 1CGJE 2ZTXA 4AX9H 1G3DA 1PPHE 4X8VL 1HAEA 4G1MB 1CA8B 1SLVB 4Z6AL 3V13A 2F9BH 4BDWA 3L6PA 1FJSA 2FP7B 2ZPRA 2VJ3A 1DS2E 3LC5B 2GZ9A 3FANA 5JPMH 2XBVL 4OTYA 3TK5A 4MPVA 5AF9H 1NRRH 2ZCLP 1Z6CA 1SSXA 3E1XB 4I8JA 2Y38A 2PGBB 1BTXA 2BZ6L 1QTFA 2ZDNA 3SQHE 1GBMA 1XKBC 2M74A 1HAGE 2YOLA 2ZO3H 3QTOH 5F8TA 3BTTE 1GHWH 1J14A 5DG6A 4NA8A 1C5QA 2I9BA 3VB7A 1NROH 1O2SA 3SO3A 2SNWA 1ZPBA 3BSQA 2P95L 4A92A 3GDVA 1EP5A 2B5TB 1DUAA 4FUDA 1OSSA 4E7RG 1O2LA 3QTVH 6COXA 2NU2E 1S82A 4Y7AA 1FV9A 1FZZA 4F49A 1EAWA 1GCTC 4JYUH 4WF8A 1E34B 3CS7A 7LPRA 2ZKSA 4WMEA 1BUIA 1QCPA 4BANB
chains in the Genus database with same CATH superfamily
6ESTA 1NN6A 2Y5FL 2BHGA 1ETTH 4XRNA 5C0TA 1GI5A 4FUCA 1WV7H 5DP5A 1WXRA 5LPEA 5H4IB 4X0WU 3AVZA 1V3XB 3QK1A 1FIZA 1O5DH 2WPHE 1CCFA 3D62A 1IQML 2AIQA 1PJPA 1CQQA 1HPGA 1H9IE 2WG3C 1SQTA 3KQEL 2OC0A 1NT0A 5EG4A 1C2FA 1KLIH 1N8OC 1C2EA 1YCPH 1C5UA 1O3GA 1K22H 3A8CA 1JBUL 4NA9H 4O9VA 1HAOH 1XUHA 4GSOA 3KCGH 1NU7B 4UDWH 2VVVA 2P3FN 4RKOB 1LQDB 2OP9A 4RRYA 1MUEB 5L2YL 5E2OA 1AUJA 3UR6A 1UTMA 3K6ZA 3LKWA 2XRCA 3NXPA 1A46H 1HV7A 2VJ1A 1A4WH 5EPNA 1QB6A 2OD3B 3RXVA 3N8XA 1XUJA 2MGRA 1EPHA 2ZQ1A 2JH6D 3BTME 3UIRA 1HAVA 3KL6B 2UWPB 2P26A 4YT7L 2VIQA 1ESAA 4IN1A 2ZGCA 4GLYA 3SJKA 4KTUA 1VITG 1EZUC 1Y5BT 5ABWA 4BXSA 4XBBA 4BTUA 2MHPA 1FIWA 2P3TB 3QH0A 4COXA 3PTNA 1EQ9A 2WYJB 2STBE 1AWHB 1LPZB 1ARCA 1P04A 2OLGA 5AVDA 5C67A 1AUTL 2EA3A 2W26B 1AHTH 4ZH8A 4NG9H 4JK5A 1EZXC 4X1PU 2W6ID 3POYA 2A32A 4IC6A 2XOKD 5EU8A 1YBWA 2PSXA 5GCHG 2FLBH 4FUIA 3Q3YA 3RXOA 5IKVA 3MHWU 2Z9LA 4IC5A 3BEFB 3DFJA 3Q3KA 4ZXYH 2P16A 1H8IH 1QRXA 1MBQA 1YPEH 2FX6A 4JZEH 4RSPA 5C0UA 3NTBA 4DT7B 1FXYA 1NTPA 2OYUP 2YGQA 3LTFB 1CA0C 1SGIB 1IHSH 1HFDA 3OY6U 4I33A 1N1LA 2XCNA 3GDSA 3RXEA 1F7MA 2CF9H 1VZQH 2FLRH 1YYY1 3UNQA 2PFEA 3MU5A 1W7XL 4BNRA 3U8RH 2XXLA 4CH2B 3LGUA 5FCRA 3UAIC 4NCYA 3HATH 3NJPC 5JBAE 2FZZA 1SVPA 3DFLA 1CBWB 2C8ZB 2G5VA 4X1NU 1D6WA 2O8LA 4UFFH 1DANH 1GGDC 1AWFH 3KYFA 3ODDA 1UTJA 2Z3EA 1TYNA 3SV2H 2KR7A 2QV1A 3BG4B 3RXGA 3SJ8A 4IS5A 6LPRA 5K0HB 3NWUA 2SGQE 1D3TB 1F92A 4NFFA 1P03A 1RIWC 2AHME 2BX3A 3BEUA 4CREA 2BB4A 1PTHA 3K9XA 1X7AL 4CH8B 5LGOA 2J95A 4UFEH 3K9XB 4TY6A 4UFGH 1BRUP 1O2RA 4O02B 1FI8A 2FOMB 1AMHA 1HAYB 1O3JA 2P3FH 1O3LA 3EE0B 1IQHL 1O2XA 1IHTH 2B9LA 1EATA 2BDCA 3FOAA 2XC4L 3DHKH 3A7VA 1TRNA 1GJCB 1G2MA 3HO3A 1PPZA 4GCHF 1P2JA 4WVPE 4U2WA 4H6SB 3NUMA 2ZG0H 1W8BH 3M35A 1MQ5A 1EJMA 1QL8A 2XC5L 2HOXA 3BTFE 3RXBA 3U1IB 2BY7X 3K65B 2V0BA 2IPHA 3UFAA 1ZGIA 2RNLA 3A81A 1QBVH 3F3BA 3SUFA 3FKSD 5GXPA 2P8OC 1SLXB 3SGQE 1Z8IB 3LAQA 1K2I1 1HAHH 2F91A 1KTSB 3Q3XA 5DP6A 4WMDA 3HO4A 3TBDA 1TLDA 3T28A 1DICA 1GDUA 1H1BA 3B23B 3BTGE 3R05A 1P05A 2WYGB 4LMFA 1YUFA 2AGEX 4TPYA 1EAIA 3GOVB 5BRRE 2Y5GL 1O35A 1GVZA 1CSOE 3K2UA 2WPJS 1PXXA 4B71A 4Y0YE 2GT7A 4CRBA 3SUDA 3VEQB 1WSSH 2FDAA 1TQ7B 4IGDA 2GGVB 5FX6A 3VPKA 1FY5A 3BTDE 1O36A 4AYYB 3OYPA 1MQ6L 1GCTB 4UD9H 3SOSA 2K8IA 1D9IA 3SU1A 2JETC 3UTUH 4ASUD 1MKWK 1OP8A 3OFND 1DUEA 2XBYA 2LNCA 3QZRA 1T8MA 3DUXH 2BD8A 4CRCA 2H2ZA 3KK6A 1GBBA 3KEEA 2W7SA 2BD7A 2A4QA 3ZYEA 4X2XA 1RJXB 2H9HA 1V1HA 2P28B 1IQNL 3MQKC 4HG6A 2XCFA 5C3NA 1O5BB 1C9TA 1EASA 2AFQB 3KQ5A 2F9BL 1U67A 4O03A 3ZYJB 4IMQA 3UNSA 4NIYA 5KIRA 1YUGA 3MDLA 3SJOA 3RXFA 2BM2A 1N8OB 2QF5A 3BTHE 5KGOA 3GCTG 3GY6A 1IQEL 2HORA 1Z8GA 5TJXA 5EGMA 1EKBB 2HNTE 2BQ6A 3LC3B 5EGMB 2CV3A 1A0LA 3B9FH 4KTSA 1VJ9U 2ZQ2A 5EQRA 2RG3A 3TJUA 4WH6A 5EXLA 4CSYA 2A4GA 1ZAQA 4AG1A 1RTFB 3PO1C 4NFEA 3RXTA 1QA7A 3U1JB 2ZGHA 1YM0A 2R3YA 2H9EC 2TPIZ 2QN5T 3I29A 4WXVA 1GMDF 1ETRH 1WOFA 3C27B 1TMBH 1GI7B 1EX3A 3RXKA 1GJBB 3HGNA 2ZFRH 1ELDE 2BLOA 1SI5H 1MOXC 1ZRBA 2KX4A 1UZJA 3M36L 4WH8A 1MD7A 2QGRA 1HZ8A 2Z9GA 4JYUL 1YF4A 1AIXH 1M9UA 1E1QD 1DXWA 5C1UA 4LK4A 1RFNB 1BB0B 2XNDD 4MMYB 1EB1H 1TPGA 2PV9B 1HJAC 3UY9A 2VWOL 3AASA 2ZU3A 4B1TA 3LONA 3FP7E 3TJVA 2BDYA 1ADXA 1K36A 1O2KA 1GBTA 1G2LA 1ANEA 1O5DL 1FY4A 1V2NT 3NTGA 1YO8A 2VIDA 1O2TA 4WMFA 2FM2A 1NBME 3I77A 3UR9A 1NFYB 3MOCA 2K2SB 3ZVCA 2ODQA 1Z6EA 2BZ6H 3NK8A 4FUEA 1Y3XA 1CA0B 1KLIL 1DM4B 4A1VA 1MMJN 2AMQA 3URCA 4NA9L 1FAXA 3KCGL 3JZ2B 3LIWA 4FXGH 3PMJA 4ISHH 4XDEA 1V2KT 2IPQX 4YLUA 5A8YA 3RU4T 4DOQA 3HKIB 2AERH 2JKHA 1UVSH 1ZTKA 1IQGL 4FUGA 1ELFA 3BTEE 5F53A 2AGGX 1EP6A 4AYVB 4GCHG 4JZIA 3ENSB 4CUDA 1ZHPA 2PSYA 3LOXA 4Y7BB 2Y7XB 2Z94A 5CHAB 5CKQA 3T29A 4GVUA 2FOCA 3SHCH 2RA0L 4B73A 2BX4A 5C20A 2BLQA 1GBAA 5GNDA 2RHPA 1O3HA 1LO6A 2FOAA 3BEIB 1RIWB 3DA9B 1SB1H 1YCPM 4D9QA 4OGYA 1QJ6B 3MYWA 3UOPA 1F2SE 1TA6A 3GCOA 3RM2H 3KQBL 1VCWA 3GICB 1P10A 3GISB 2FOEA 1GHXH 1FQ3A 2VH6B 4NG9L 3PB1E 1EMNA 2FLBL 3VB6A 2IJD1 3ZZ8A 2QCYA 3S9BA 1JBUH 4TWWA 3WWFA 1FNIA 2ZDAH 2GTBA 4ZXYL 1CHOF 2NU0E 2VGCC 1YKTA 1QZ8A 5JBBE 4JZEL 3E3TA 4AOQA 1GVLA 2YMSD 4ABIA 4GHTA 1ABIH 1GHBG 1S0QA 1YLCA 2OQ5A 3EA8A 4CUEA 1UMAH 1C2DA 4NWLA 5F8ZA 2VIOA 5I46H 3KQDL 1HJ7A 4MMXB 2FTLE 2P8OB 1SFIA 1OWKA 2XBVA 2FLRL 3RDZA 1MKXK 2JH0D 1CT4E 4D9RA 1O2MA 1MD8A 1GBJA 1SC8U 1THSH 5HIZA 1HAPH 1T4VH 4YT7H 3SOVA 1G30B 1TFXA 2D1JA 2VVCK 1BBRH 5C17A 4KGAA 2BVRH 4JK6A 2SGDE 2MGPA 3MQEA 4C16A 4AZ2B 3GDUA 2KAIB 3EGKH 4CBNA 1O2HA 9ESTA 9LPRA 3HK6B 3DEMA 2P95A 1C1OA 1SGRE 4FM5A 2WV9A 1NFUA 2KB9A 5GIBA 2ZECA 1NFUB 1UTLM 2NU1E 5JDUB 1AFEH 1PQAA 3ODFA 2PP6A 3SUEA 2Q1JA 1GVKB 2RDLA 1SQAA 2JETB 2Y5FA 1V2QT 2ZU4A 3PWBA 3QGJA 2FOGA 2GCTB 1BDAA 3HPTB 1Z1JA 1IQMA 2ANKH 1O38A 8ESTE 1O30A 1O2WA 3KQCL 1W8BL 1W7XH 1W0KD 1ARBA 4IN2A 1SQOA 3MH5A 4JZ1A 3QGNB 1JOUB 5HYOA 1CQEA 3R3GB 1NFWA 5E0JA 3SNBA 4FOUC 4KTCA 3SV8A 1V2VT 3M5LA 1TB6H 1YPKH 1LMJA 1HX2A 4AN7A 1O2QA 4O3UA 2VB0A 2Y80B 3N8YA 1KXCA 5AHGH 1V2LT 1ZMLA 4WY3A 2WPHS 1O32A 4RRWA 2ZFTA 3M3TA 4LZ4B 1O2YA 2VINA 1QQ4A 4DG4A 2BOHB 4Y8YA 1P9SA 2ZPSA 5C2ZA 1LTOA 1G9IE 5B6OA 1PQ7A 2BYAX 1EBVA 1E38B 3A8DA 3CP7A 4ISNA 4OS2A 1KLOA 2A2QH 4E05H 2R0LA 1XX9A 2ZF0H 3LGWA 2HOBA 1GI4A 4MPXA 3RU4D 2UWOB 2K1QA 4ISIH 1LVMA 2XWAA 4BAHB 1YY3A 1V2UT 4X1QU 4RRXA 1V6DA 1ATEA 2WG4B 4Z0LA 3MU4A 4DW2U 3MNSA 4D0FA 1L4DA 1OWJA 8KME2 2G5NA 1VITF 3BPSE 3L3TA 2J5UA 2FEQH 3RC5A 1WYKA 1LHEH 1PQ5A 4H4FA 2ZFSA 1QB1A 2ZP0H 2NWNA 4XSKU 2V3MA 1YPMH 1YPHC 1TALA 2BDAA 3OLTA 2VH0A 4X8UH 2RFKC 2J4IA 3CNRA 2YGOA 2P59A 4TPIZ 2GJGA 2UWLB 3BF6H 5GDSH 5GCHF 3BG4C 3SJ9A 5F03A 3PM3A 1IOXA 2BVSH 2W6JD 2QIQA 3WY8A 1Y3YA 1PPFE 1OP0A 5EW1H 1UHBA 4INHA 1N6XA 1HYLA 3EA7A 4FU7A 2D2DA 1W14U 3IWMA 3LT3A 4Y8XA 1AB9B 1ZHRA 2BDIA 2ALVA 1EJNA 1QQUA 1KSNA 4HFPB 7GCHG 5JB8E 2R3UA 4FVBA 3S7KB 4GPGA 1AU8A 1KY9A 1IGXA 1A1RA 7ESTE 1QIXB 3MU0A 1K1PA 1ZHMA 1L2EA 1YGCH 3LGTA 5IKTA 1P2QA 1ELTA 1G3CA 3GYMA 1G3BA 3KYGA 1IQHA 1ZTLA 2LELA 5JBAS 1P11E 3U8OH 2XC4A 5A8ZA 1P12E 1Y5AT 3UB0A 1JL9A 1VGCB 3JZ1B 5FPYA 4CBOA 1LKBA 3KGPA 4RI0A 1O3EA 4Y6DA 3T2NA 3OX7U 5DP3A 4ZHAA 1K28D 2XC5A 5EJLA 2VWNL 3TK5B 1AE5A 1E79D 2CMYA 4ZHAB 2VGCB 2VVCA 1S6FA 1APQA 3LJOA 4LZ1H 1J15A 4KELA 2BT8A 3GY7A 2H9TH 4LORA 2V3HH 1EAIC 1OX1A 2M5TA 1INCA 4UFDH 4YLQH 3U8TH 1C5PA 2O9QA 3F6UH 2VWLL 4RN6A 3RXSA 2RCEA 3PLKA 2GDEH 1TNJA 2UUYA 2DE8A 1FLEE 3MWIU 4ISHL 1MTSA 2UUFB 4NIXA 1KXDA 1CE5A 1W0JD 3GCXE 4JCNA 2WPME 2HALA 1Q3XA 4I8HA 2KV4A 4MNXA 1L1JA 3PYHA 4PROA 4Y7AB 3KN2A 2G4TA 4OM9A 1O31A 5JBTA 1F5KU 2I6QA 3GY3A 4AFZA 2ZHEH 1FMGA 1O2PA 5E8EH 1GI8B 4ABFA 3ZZ7A 2AIPA 2ZWLH 1LDTT 3TPIZ 3P8NA 3M3SA 1ATAA 2ZEBA 4IW4E 1C1RA 1MQ6A 2A4RA 3DSGA 3H7OA 2H6MA 4GU4A 3E0PB 2ZGBH 4JYVH 1BA8B 1MABB 5L30H 4XBCA 1SR5C 3PV2A 4I8KA 2W3IA 3ESTA 1BHXB 1DDJA 1O3MA 3T62A 2W3IB 2W86A 1D3PB 2K2TA 3EE7A 2GVFA 4ABHA 2XW9A 3ZVFA 3H5CB 2OCVB 3S0NA 3V12A 2QYIA 4X6MA 1PFXC 2W3KA 1BTWA 1BTYA 1C1WH 1MU8B 2CHAB 3EQ0H 4D8NA 4Y76A 1IQNA 1BTHH 1IQLL 4Y76B 4YT6H 1CGIE 1HAZB 1XVOA 2EQNA 2GX4A 4X8TH 1NC6A 2FMJA 2KZ4A 4Q7YA 3ZVEA 1P2MA 3N7DA 2G00L 1NFXA 3M5MA 1XXFA 5I46L 1IQEA 1RTLA 2EI7A 3P6ZB 1OWDA 4RKJB 1H9LB 1IJQA 1MH0A 4K8BA 1O2GH 4K2YA 4IBLH 4K69A 1H4WA 2AS9A 2KCAA 1HAVB 3SOQA 3LPRA 1WTGH 4Q80A 4BAKB 4DY7B 1OWIA 2RA3A 2ALPA 1FSBA 1GI6A 5EOKA 4MNYA 1HXFH 2XC0L 3ZYIB 2FTMA 2V6NA 4UONA 2OC8A 1G3EA 4BTUB 1OYQA 3GCTF 1SL3A 3GCWE 1BMFD 1F5LA 3LH3A 4R8TB 1DT2A 4RUTA 2FESH 4BAQB 4ZH8B 3M36A 4CRFA 3SNCA 2P3UA 4OS7A 1TNKA 3A86A 4K5ZA 1DIYA 1MAXA 3A84A 4NZLA 3ZZCA 4A94C 2P3UB 2GD4A 2GMTB 1NPMA 5L2ZH 3LGYA 3DSPA 3PV4A 2FI3E 3O8DA 3A7TA 5HXFA 4I32A 3Q3KB 2WFXB 2KL7A 1O2OA 3STIA 3LN0A 4XFQA 1ZLRA 2VWOA 1A5IA 3GY8A 1UVUH 1GI1A 4FUHA 2QAAA 4ASHA 1CCVA 1COWD 1O2ZA 3ATWA 3FAOA 1A0HB 1AKSA 3B8JA 4ZKRU 2J97A 3OEED 2WINI 3U73A 4NIVA 1IVOC 3OAAD 2L74A 1K37A 1GJ6A 3RMNH 4K8YA 3BV9B 3QX5H 1S0RA 4DT4A 3RC6A 1GBDA 2BQWA 1GJDB 2ANYA 3E91A 4GUXA 5CHAC 3SUGA 3D65E 2A0QB 2PW8H 1BHXF 5C1XA 2XTTB 2WFTA 1NRQH 3S6XA 1IQGA 3HO5A 1P3EA 2VWMA 3UQOA 4NSVA 1TRYA 2HNTC 1NRNH 1C4U2 1KDQA 2G81E 2ULLA 4Y11E 5C1YA 3ZV9A 2J95B 2GT8A 4SGAE 1TONA 5DKMA 5DN6D 1OHHD 1W0YH 4VGCC 3BG8A 3ZZAA 1QB9A 2C3SA 2RA0A 5EODA 2HLCA 4ZCNA 5E0GA 4O3TA 3UOUA 3F1SB 3HS5A 4OTJA 1UZKA 3V3MA 3ZVGA 4AG2A 1BMMH 3BTWE 1K9OE 5FX5A 4AFSA 3M3VA 1JWTA 2Z9JA 2KFWA 1G2MB 1EUFA 3KQBA 4ISIL 1ZMJA 1GBKA 2Y7ZA 2ZC9H 4AC9A 1UZQA 1O2VA 2Y81A 1O2IA 3QN7A 1DE7H 5A0BA 4GU3A 3URDA 2Y81B 2EEKA 1GJ7B 2C8WB 1C1MA 3RXMA 1TOZA 4Q4LA 3S7HB 2A4OA 1KXBA 2I6SA 2PR3A 1DSTA 2YMSC 1P02A 2A5AA 3TNTA 2WPIE 2F9OA 1ZR0A 5FXLA 4X8UL 3RXLA 1FFMA 2LP6A 3VG8A 3A85A 2FO9A 3KQDA 4U30A 2ZHDA 3GY5A 3F9EA 1F0TA 2HLDD 2I9AA 4FVDA 1KIGL 1PRHA 1RRKA 1UTNA 4CRAA 2SGPE 3TH2H 1C5VA 1GHAG 1ETSH 2XBWL 1OPHB 1VJAU 1IQKL 1AZ8A 3UWIA 2C8XB 2BDGA 3F9HA 1ORFA 1AO5A 1GHBF 2PUQH 5CHBA 2IOTA 4BAMB 4AGJA 5J4QA 1SGPE 3TK9A 4NZQA 5JBBS 2CXVA 3FO8D 4E7NA 3N8WA 1PQ8A 4FETA 2BDBA 4B6EA 5KEDA 1TGCA 2BDHA 2TGTA 2GCTC 3RXIA 1SFQB 3TITA 1YGCL 3A80A 1GBEA 1JXPA 3LDXH 2K0QA 1FPCH 1TE0A 3F9GA 1WTHD 2Z9KA 1OKXA 1C1NA 4XD7D 1Z6JH 3TGFA 3ATLA 4Y8ZA 4B6FA 1DLKB 1SGEE 4NWKA 4D76A 1IGZA 2ZFPH 3DCLA 1SGTA 4KP0A 4YZUA 3ZYGA 1BIOA 4E1GA 3EYDA 1DVAH 3LGIA 3P95A 1AVXA 1SGCA 3KQCA 4U32A 2A5IA 2TIOA 3QWCH 1L0ZA 3D49H 4Y0ZE 2BQ6B 4OS5A 1LK9A 4M11A 1NESE 1NS3A 1O37A 1P2KA 3S69A 2B0FA 3UQVA 5GPIB 1G1TA 5T6GA 3LTGD 3RMMH 3F6UL 2W2OE 3TH3H 2BOKL 2W2PE 1A3BH 1DFPA 2FYQA 1LVOA 5CKNA 1HGTH 1ANDA 1O39A 1O3CA 4NGAH 1NY22 3I78A 1RD3B 1YPGH 2FXRA 1MTUA 1BTZA 4X6PA 3ATMA 3M5OA 3UNRA 1THPB 4AGKA 1FPHH 3EGFA 1AUTC 4ISOA 4I7YH 2OC7A 3DD2H 3TVJB 3PTBA 2R0KA 4D90A 2BOXA 2HPPH 5DK1A 1QNJA 3LJJA 2BTCE 3SW2A 1HRFA 2WPLS 1LMMA 2TBSA 4JYVL 5F1AA 5L30L 1HB0B 1G2LB 1W11U 5SGAE 3ELAH 4ABJA 2J9NA 2J2UA 5A8XA 2EI6A 2R9PA 3QUMP 2J2UB 2BSFA 1C2LA 1DXPA 5E2PA 4X2YA 3KF2A 3O8BA 1T32A 1BRAA 3U69H 1WCZA 3BTKE 3TK6A 2ZU2A 3LIWB 5EW2H 4TT3D 4YT6L 2ZZUH 1AB9C 3UPEA 1KXEA 4X8TL 1IQIL 1NQLB 3VGCB 3TGIE 2B8OH 4BTTA 4CRDA 4OS4A 1VITH 2G8TA 1O2NA 2ZU1A 1MKWH 1IOEL 2QF3A 3FN8A 1K1JA 2PLXA 2A45B 1SGFA 1O2JA 1X7AC 3ZZ9A 2KM0A 1FY1A 3A88A 3HK3B 1IQFL 2EY4C 2AYLA 1CEJA 2Y82A 4CRGA 2XBXL 1QJ7B 3E16B 3P17H 4VGCB 3SHAH 2Z6BD 1XKAL 1VGCC 5ESTE 4THNH 1P9UA 2C90B 8LPRA 1AE8H 2GP9B 3ASIA 1JIMA 1KMHB 3FZZA 3V0XA 2WZPP 1TOCB 2VU8E 4TGFA 2QXGA 4Q7ZA 5L2ZL 4D7FA 2P93L 1APOA 1QY6A 4INLA 7GCHF 3P8OA 1C2MA 2STAE 3IITA 1QFKH 1Z8RA 4M9FA 4F48B 2PKAA 3L33A 2OINA 1MZDA 2PKAB 4Y79A 3MI4A 1P2OA 1O3NA 1QGFA 1QBOA 4ZHMU 2ZA5A 1UVOA 1LPKA 5JBCE 3EA9A 5JB8S 1O3BA 1YLDA 1BBRE 1LPKB 1NBMD 1O33A 4ZKNU 1SGQE 1C5MD 2VWNA 3FZDA 3WWBA 5T3HA 1C5ZB 1DPOA 3RR3A 1J16A 2ZCKP 3N8ZA 3D23A 2BMGA 2YMSB 2EI8A 5DO4H 1GPZA 1YWUA 4F55A 2D1JB 1SGDE 2HPQH 4B74A 1THRH 2VWLA 1HT5A 4O97A 3MH7A 1EPJA 3U28C 5J4SA 1ZPCA 4BOHA 2A7CA 3U98H 1TABE 2H9EH 1HLTH 3FP8E 3STJA 3PLBA 1HIAA 3F68H 2LPRA 2BXTH 1HIAB 2PHBA 4DIHH 1W2KH 3F2HA 1RS0A 5EQQA 1FE2A 3BN9A 2GZ7A 1WQVH 2OYEP 1S84A 1UCYK 4MTBA 1O5CB 3TGJE 1HJ9A 2ZDLA 2HWLB 4ACAA 2YNAA 1Z71A 2XWBI 3M7TA 1FY3A 2QF0A 2OC1A 2Q1JB 1B0EA 1UK2A 1LKAA 3RP2A 1ATBA 1FUJA 3OSYA 1MCVA 5E0HA 1EQHA 3LH1A 3SZEA 4QT8C 1LVYA 1P8VC 4OGXA 3SZNA 4ZAEA 1RGQA 2F9NA 1TX6A 3FFGL 2CHAC 4AB8A 1Y59T 1WDIA 5HM2A 2PGQB 3MTYA 4ZUHA 4H42U 2WPMS 3A7XA 1BOQA 2J94A 3KQEA 2J94B 1P01A 1U8CB 1NO9H 1T8NA 1J8AA 1F0RA 1C1VH 2HNTF 1AQ7A 1H8DH 1NFWB 2OK5A 1SOTA 2HVYB 1EB2A 2WPLE 1BRCE 1K1MA 4I8LA 4J1YA 1Y3UA 2PUXB 3A8AA 1PFXL 3KNXA 2W2QE 4UEHH 4MPUA 1UK3A 2G00A 1DY8A 1CVWL 2BT7A 3N8YB 4BXWA 3U7UG 1PGEA 1C2GA 2BVXH 3M37L 4A1XA 2NPRA 3RXQA 1CGHA 2ZU5A 4Q7XA 4B2AA 3C9AC 4JZDH 3SN8A 1A5GH 5FHTA 2FLGA 3NZIA 2C8YB 3DSOA 5DGJA 2PUQL 2XC0A 2P94L 1TWXB 2GMTC 1IAUA 1Z8JB 1EAUA 4FU8A 1ELBA 2NU3E 1TPPA 4K3JA 2Z3CA 1O5EH 2QXIA 1EAXA 3RXRA 5CISA 2Q6GA 3BTQE 1ABJH 4SGBE 3ITIA 1YPLH 2HGTH 5IK2D 1EOJA 3H7TA 1HT8A 1O5AB 5CKMA 3V7TA 1JRSA 4TYDA 2FI5E 2FS9A 1G36A 3PMAB 5FDQA 2FS8A 3T5FH 2ZTYA 2VNTA 5IKQA 4YM9A 3R0FA 2TGPZ 2F83A 3O8CA 1HCGA 1PYTC 3OEHD 3UUZA 2VH0B 1EPTA 2ZDMA 4X8SH 4E06H 4Y71A 2BY6X 1DVAL 2J4IB 4Z0KA 4DIIH 1KIGH 2FOHA 2A5KA 1V1IA 1WU1A 4M7GA 1WU1B 2V3OH 1YPJH 2D26C 1UHBB 2ZCHP 4BAOB 5T1VA 1DSUA 2B7DH 2BZAA 3ZZBA 1W13U 4R0IA 1D4PB 1QIUA 1MZAA 3P70B 3TH3L 2Y5HL 3MU1A 2ADXA 5JVZA 2ZHWH 1OYTH 1KSNB 5F8XA 1G1RA 1YCPK 2WSSD 1EOLA 3RMLH 2EC9H 2F43B 3RXJA 3SORA 3ZVAA 3E0NB 3QZQA 3H09A 1J9CL 4CR5A 3GY2A 4BTIA 4NGAL 2F9UA 4LOYH 1F5RA 3OU0A 1HXEH 4X2VA 1JIRA 2VWMK 1QRZA 2CK3D 3MNCA 1C5RA 3TLOA 1F0UA 1I0UA 1TNHA 4Z1MD 3MO6A 3SU2A 1O34A 1PPBH 1GWAA 3N99A 4YESB 3V65B 5FAHA 4ESTE 4P02A 2H5CA 1GJAB 4FU9A 4D0EA 4Y6DB 1ZJKA 3ELAL 3SU0A 5DSFA 3GCNA 2ZNKH 1TNLA 2ZHFH 1GBFA 6GCHG 5HMAA 1TNIA 1C5OH 2M2AA 5IDKA 4INKA 3SBKA 3LC5A 1XVMA 1NRSH 2GDDA 1XUGA 1T4UH 4P00A 3SU6A 3W94A 2BLVA 1L4ZA 3P8FA 4OS1A 2FODA 2CGAA 2AYWA 3PRBA 2C4FH 5FBEA 2Y5GA 2V7QD 2VVUL 1LHGH 3GS9A 2OQUA 2SGFE 5T6DA 1DWCH 1GJ5H 2XBWA 3T27A 3NCLA 3MU8A 1IQKA 1GG6B 1XUIA 4XOJA 1ELAA 1SGFG 3BIVH 3M5NA 1WHEA 4RT1A 1D3DB 1K0HA 3A87A 1SPJA 4TY7A 4PH9A 1B0FA 5DP8A 1EPIA 3AK5A 1V2WT 2GV6A 2F3CE 1N6YA 2WV5A 3A7YA 1ID5H 4TSFD 5EIYA 1GHAF 2WPIS 3MNXA 3KIDU 1QRWA 1NRPH 5A0AE 1C2JA 1P06A 1AVGH 1FY8E 4FUBA 2F9PA 2PKSB 5JVYA 3SJIA 1E35B 1C1PA 1GL0E 2AMPA 1DWBH 4ABGA 3A89A 1TAWA 5FBIA 1AD8H 1BQYA 1TQ0B 1V3XA 1YPHE 2DE9A 3E90B 3TGKE 1GDNA 2W3KB 1UTPA 1QFKL 4AB9A 1TBRH 2RDEA 1QL9A 2Z7FE 1P2IA 1BT7A 3BT2A 5AFYH 1F7ZA 1UVPA 3MH4A 1GMCG 3P5BL 1UTQA 1Y3WA 3GCHC 2CF8H 3RLYH 1NFXB 5T6FA 2BY8X 1TRMA 2SFAA 2WPKE 1ELGA 1TA2A 2EI7B 1UVTH 1V2MT 4RT0A 1DLEA 5E8DA 1LQDA 4ZROA 5CE1A 3SU5A 4Y10E 4WXIA 1WUNH 2ANWA 2ZGJA 1EZSC 1KLTA 1YP9A 2BOKA 1TBQH 1EJAA 1TX8A 3FCSB 2H9EL 6CHAC 2Q6DA 1YLNA 1A7SA 2JJ2D 1E0FD 3KL6A 3RUOA 1Z7KA 4AFQA 4O1ZA 2WUCA 3RXUA 2UWPA 1GBLA 2PWXA 3SOBB 2GCHF 2YGPA 2IN2A 3PWCA 1GMHG 1W0ZU 8GCHF 2GD4B 1IQJL 2P3TA 4XE4A 2WYJA 1Y3VA 1LPZA 3CENL 2W26A 4HZHA 3V64C 2IJOB 4X1SU 3SV7A 1ACBE 1PYTD 4DCDA 2O8TA 2F9VA 1XMNB 2VIVA 2ZFFH 5A2MH 1W12U 1JRTA 1A3PA 2OXSA 4MLFB 1OWEA 3PROA 3PGHA 2BXUH 3PMHB 2FIRH 4ZXXH 5KN5C 4H6TA 1P9JA 1AKSB 4NIWA 5L6NH 4K1EA 1O3KA 2JJLA 1C2IA 2A2XH 1C1SA 5FCKA 3VGCC 5ETXA 1GBIA 5HGGA 3VXEH 3WW7A 2JDID 4DURA 2BQWB 4YOJA 4RS0A 1PPGE 2ZDKA 3QO6A 1A3EH 3A7ZA 2BLWA 1TOMH 1AFQB 1A61H 4JZFL 1MTNB 1IQIA 3IG6B 1FAKL 2ILNA 1A2CH 2ZPQA 1C2KA 1LMWB 5DPAA 1KDQB 4HTCH 5FPSA 1T8OA 1TGSZ 1TPAE 1IOEA 1ZPZA 2BD2A 4JZDL 2XYAA 1TGTA 1ZOMA 5K0HA 3Q77A 1FN8A 2UUJB 3A83A 2VIWA 2Z9IA 1WQSA 3ZZ4A 3VB4A 4NSYA 1IQFA 1EZQA 1ZSJA 4MMZB 2TGDA 4MG3A 4ABAA 1EZQB 2XBXA 2FOFA 4ZKSU 1T31A 1CVUA 1UO6A 3MO9A 3ZV8A 3LGVA 3PLPA 1EMOA 5I25A 4I31A 3C1KA 1C2HA 2Y7ZB 3ZVBA 4FUJA 3F2GA 4CHAC 3ZZ3A 1XFEA 1BITA 3RXCA 3SV9A 1SGNE 4NA7A 1FDPA 3OLUA 3SNEA 1AN1E 1OB1C 1TX7A 2FI4E 2P93A 3S9CA 4X1RU 2W2NE 1O3IA 1EPGA 1URKA 3Q76A 1FJSL 4ZKOU 3M61U 1GBHA 1DWDH 1GCDA 1MTVA 3QMOA 1EGFA 2BY9X 2A7HA 2PR3B 3CA7A 2OBQA 1COUA 1C5WB 4X8SL 1YUKB 3TU7H 1CVWH 3ZYDA 1SZBA 3E8LA 1XUKA 3RC4A 3BT1A 1AY6H 1GBCA 3TNSA 5HIYA 3EAJA 4XBDA 2GKVE 1TPSA 1BJUA 1JMOH 5AFZH 2Z3DA 1CHGA 1A5HA 2WYGA 5FL7D 2B7DL 2WUBA 5ESBA 1U6QA 3TZIA 1XKBA 1K1NA 1EXFA 3SGBE 3N8WB 1L1NA 1BTPA 2ZI2H 3CS7L 1KXFA 1BMAA 1TPOA 2ZGXH 2QXJA 5JBCS 1L1GA 1P57B 2BO2A 1G37A 3MO3A 4MNWA 4ABDA 1KLJH 1TGNA 1S81A 2H5DA 1OXGA 3MNBA 5F19A 1P0SH 5EJZA 2XNIA 3RLWH 2GV7A 3TH4H 1C5YB 2O8MA 1GDQA 1LHCH 2V35A 1SHHB 4YZUB 2ODPA 2GZ8A 2BD4A 1EFRD 1Q31A 2ZFQH 3FFGA 1HRTH 1KKEA 3SNDA 1GK5A 1C4Y2 3S9AA 1QURH 1YC0A 1O5GH 4HGCA 4K60A 5DJ7A 1TGBA 5A0CA 4B2CA 3W95A 3AAVA 2AMDA 1SLUB 1CT2E 3QDZB 2OBOA 3ATIA 1GHYH 2VVVL 1W10U 2GCHG 4UE7H 1C5TA 1DX5M 1S6LA 1BRBE 2SGEE 8GCHG 1O2UA 3GCHB 1HREA 5PTPA 1WHFA 1C4V2 3OY5U 4JYTA 3SU4A 1OOKB 4B76A 1J9CH 3LC3A 2AH4X 4TWYA 3ZZ5A 4X6NA 2BD5A 2BY5X 4A1TA 1CX2A 3MMGA 5LH8A 1ZRKA 5HM9A 4OS6A 1DY9A 4GAWA 3W1EA 3M37A 4A5TS 4D7GA 1G1QA 5JB9S 1T8LA 1SBWA 1ZZZA 1SMFE 4LXBH 1S85A 2JJ1D 2VRSA 3M7UA 1PPCE 1TNGA 1LQEA 6CHAB 1HAFA 2KNIA 3RXAA 4X2WA 5TCCA 1GI2A 4ISLA 5DP9A 4MPWA 5LPFA 2P94A 5EXNA 1N1IA 1ZJDA 3P8GA 1UZPA 1QJ1B 1AI8H 3SW2B 1BBRK 1C1TA 1BTUA 1C5NH 2ZIQH 1UK4A 2D8WA 2W7UA 1IP0A 1UTKA 1NZIA 1LPGA 1RFNA 1SGYE 5F6MA 1ZTJA 2P16L 1LPGB 5CDFE 3N7OA 3UWJH 1E37B 4X8VH 2CJIA 2THFB 1EPTC 3M7QA 2O8UA 2EI6B 4Z6AH 2CJIB 2W5EA 4XBMA 3E6PH 1SKYE 2F4LA 4DGJA 4YO9A 4U01A 1GJ8B 1SG8B 2FPZA 1SLWB 1TMTH 2A1DB 3GYLB 3OTJE 3TK6B 1NFYA 3FP6E 3NT1A 2FX4A 2VBCA 2J98A 4AORA 3U9AH 2J98B 2VIPA 1NZQH 1QA0A 2J92A 4AFUA 5JYIA 1S83A 1L5GB 1TIOA 1SQRA 4JMYA 2FZZL 3Q00A 1V2TT 1UTOA 3VB5A 4BTTB 1G32B 4MVNA 1H8HD 1T7CA 2ZHQH 3SYJA 5JW1A 1B7XB 1TLEA 4B2BA 1B9WA 2AEIH 5EXMA 4X6OA 1D6RA 1LHFH 5C5OA 2KCYA 2R2MB 2Y5HA 2QF4A 3KRKA 1B5GH 3ENSA 3Q7DA 1K1OA 3CS0A 3NPSA 3AW1A 3NRLA 3AW0A 3GY4A 4Y7BA 4ABBA 2Y7XA 4XLWA 1H8ED 1GGDB 1P09A 2Y82B 4GHQA 2W2ME 3RXPA 3RXHA 1F7EA 1P3CA 4KKDA 1CT0E 1MAYA 1ANCA 1QL7A 2R2WU 1M1XB 1DITH 3SQEE 3A82A 1MU6B 1V2RT 3IJEB 3F2FA 1S6HA 1TBZH 3PMBB 1S5SA 1V2ST 1XDTR 1C5XB 1VR1H 1ZYOA 3NKKA 1OWHA 2FYRA 4FUFA 1DDXA 1UW7A 4A7IA 3IITB 1ZGVA 4DVAU 1LVBA 2WZQA 4CUFA 1MQ5L 2SGAA 2VH6A 4A7IB 2WPJE 4CHAB 4Y79B 2TRMA 3A7WA 1FN6A 1ESBA 1Q4GA 1MBMA 2QE7D 2C93B 1ELCA 1OS8A 2KCPA 5CMXH 2JIZD 3QLPH 3FVFB 3HGPA 2HVXA 4ZXXL 1W3CA 2FOBA 2QXHA 4MDSA 5GJ4B 3RXDA 3BIUH 2BMGB 3PV5A 1V2PT 1Z1IA 1RTKA 5L2YH 1UJ1A 2EI8B 2H1UA 1ELEE 3N7EA 3CFWA 1HJ8A 1GG6C 1Y5UT 1OP2A 3F0PA 2FWWA 4Q63A 2ESTE 1GI9B 4DJZB 1V2JT 1GI3A 2DUCA 2ZDVH 3T25A 3ATKA 1XUFA 1XM1A 4ABEA 1GJ4H 1F0SA 6GCHF 2VVUA 1O5FH 2PHBB 3P92A 1F0SB 1KXAA 1KTTB 1QHRB 1AVWA 2A31A 2G52A 3PRDA 3RMOH 4YXWD 5IYTA 2ASUB 4BDXA 1W7GH 4ACBA 1LHDH 2HRVA 2KAIA 3OTPA 7KMEH 2ZTZA 3MFJA 1DOJA 3RU4E 2PKSC 3MH6A 3A8BA 1AZZA 5JB9E 2XBYL 4ZAEB 5DP7A 3TIUA 1HBTH 2FD6A 2ODYB 1K21H 1BMNH 1CU1A 3FBYA 1KYNA 2P3FL 1Y8TA 3GISX 4XL1A 4ZMAH 1E36B 1FX0B 1F0RB 4F4OC 3HPTA 1HDTH 1DX5I 3K6YA 1ELVA 1IQLA 1GMDG 1O3PB 1GJ9B 5DP4A 2QY0B 2BD3A 1BF9A 1HAXB 4JZFH 1O3DA 1FAKH 3SV6A 1EQGA 4K1TA 3TJOA 1JV2B 4YOGA 2NU4E 3O8RA 1WBGB 2YNBA 5A09A 1VCQA 3ZIAD 4WWYA 5BPEA 5C94A 4RRZA 4YOIA 1H9HE 2AGIX 4J2YB 5HKKD 1C9PA 1CO7E 2Y80A 3DT0H 4M10A 4B75A 1DWEH 2Q6FA 2TGAA 1BJVA 5KECA 1GMCF 3PO1B 4I8GA 4YTAA 3N8VA 2BOHA 3T26A 1N7DA 1LCYA 3ZZDA 5LPRA 1J17T 1GHZA 3HS6A 1HUTH 4IMZA 1O3FA 3G01A 3EDXB 1C5MF 1K1IA 1IQJA 1KLJL 1QBNA 2WPKS 3UREA 2J34A 3VFEA 4CR9A 2ANMH 2QA9E 1A0JA 1MKXH 5K7RA 2J34B 1SHYA 1MTWA 2Y6TA 2UWOA 3CENA 1P0SL 2PTCE 1NU9A 2BOUA 5G4BA 4AQTA 4I86A 3HKJB 2WPDD 3VB3A 2UUKB 3AAUA 2BD9A 1HCGB 3TJNA 1HAIH 1FF7A 5EQSA 1EPTB 2O8WA 1Z6EL 4Y71B 1HJAB 1GMHF 1VCPA 4Z0KB 2SNVA 1O3AA 2G51A 1O0DH 3ZZ6A 1UCYE 1GHVH 3F9FA 4ZHLU 1AFQC 1MTNC 1FAXL 4A6LA 1WAYB 2JH5D 1MCTA 1CBWC 2QC2A 3SNAA 1UCYH 2UWLA 2JKHL 1NPEB 1ATDA 2DDUA 2TGFA 2PTNA 1C5SA 1O3OA 1D3QB 4MNVA 2OTVA 2WV4A 1L3YA 4HI3A 1FONA 1K1LA 5COXA 5EPYA 3RM0H 1C1QA 1G1SA 4BTIB 4MQAA 1Q2WA 2G4UA 1C1UH 1C5LH 1P2NA 1GI0A 1ANBA 2OUAA 4WJG2 4Q2KA 1AGJA 3VXFH 1BZXE 1HNEE 1XXDA 3SI3H 1ESTA 1QR3E 1GL1A 5IKRA 3SI4H 1NT1A 3LN1A 1ZSLA 1CHOG 3ZVDA 1BCUH 1ZSKA 5FPTA 1XKAC 1SOZA 3QCWA 1RXPA 1BMLA 3SU3A 3HS7A 1TMUH 2J38A 3LU9B 5C5NA 5EJ1A 1PPEE 2J38B 5TCAA 2BQ7A 3F0OA 1V2OT 2BQ7B 1ZMNA 1NM6A 5GWZA 3KHVA 2CN0H 1DQBA 4K1SA 2A7JA 2G55A 3SGAE 1CGJE 2ZTXA 4AX9H 1G3DA 1PPHE 4X8VL 1HAEA 4G1MB 1CA8B 1SLVB 4Z6AL 3V13A 2F9BH 4BDWA 3L6PA 1FJSA 2FP7B 2ZPRA 2VJ3A 1DS2E 3LC5B 2GZ9A 3FANA 5JPMH 2XBVL 4OTYA 3TK5A 4MPVA 5AF9H 1NRRH 2ZCLP 1Z6CA 1SSXA 3E1XB 4I8JA 2Y38A 2PGBB 1E1RD 1BTXA 2BZ6L 5B6LA 1QTFA 2ZDNA 3SQHE 1GBMA 1XKBC 2M74A 1HAGE 2YOLA 2ZO3H 3QTOH 2KCOA 3BTTE 5F8TA 1GHWH 1J14A 5DG6A 4NA8A 1C5QA 2I9BA 3VB7A 1NROH 1O2SA 3SO3A 2SNWA 1ZPBA 3BSQA 2P95L 3OE7D 3GDVA 1EP5A 2B5TB 4A92A 1DUAA 2WHXA 1OSSA 4FUDA 1O2LA 3QTVH 4E7RG 6COXA 2NU2E 1S82A 4Y7AA 1FV9A 1FZZA 4F49A 1EAWA 1GCTC 4JYUH 4WF8A 1E34B 1VKYA 3CS7A 2L6OA 2ZKSA 7LPRA 4WMEA 1BUIA 1QCPA 4BANB
chains in the Genus database with same CATH topology
6ESTA 1NN6A 2Y5FL 2BHGA 1ETTH 1GI5A 4FUCA 1WV7H 5DP5A 5LPEA 5H4IB 4X0WU 3AVZA 1V3XB 3QK1A 1FIZA 1O5DH 2WPHE 1CCFA 3D62A 1IQML 2AIQA 1PJPA 1CQQA 1HPGA 1H9IE 2WG3C 1SQTA 3KQEL 2OC0A 1NT0A 5EG4A 1C2FA 1KLIH 1N8OC 1C2EA 1YCPH 1C5UA 1O3GA 1K22H 3A8CA 1JBUL 4NA9H 4O9VA 1HAOH 1XUHA 4GSOA 3KCGH 1NU7B 4UDWH 2VVVA 2P3FN 4RKOB 1LQDB 2OP9A 4RRYA 1MUEB 5L2YL 5E2OA 1AUJA 3UR6A 1UTMA 3K6ZA 3LKWA 2XRCA 3NXPA 1A46H 1HV7A 2VJ1A 1A4WH 5EPNA 1QB6A 2OD3B 3RXVA 3N8XA 1XUJA 2MGRA 1EPHA 2ZQ1A 2JH6D 3BTME 3UIRA 1HAVA 3KL6B 2UWPB 2P26A 4YT7L 2VIQA 1ESAA 4IN1A 2ZGCA 4GLYA 3SJKA 4KTUA 1VITG 1EZUC 1Y5BT 5ABWA 4BXSA 4XBBA 4BTUA 2MHPA 1FIWA 2P3TB 3QH0A 4COXA 3PTNA 1EQ9A 2WYJB 2STBE 1AWHB 1LPZB 1ARCA 1P04A 2OLGA 5AVDA 5C67A 1AUTL 2EA3A 2W26B 1AHTH 4ZH8A 4NG9H 4JK5A 1EZXC 4X1PU 3POYA 2A32A 4IC6A 5EU8A 1YBWA 2PSXA 5GCHG 2FLBH 4FUIA 3Q3YA 3RXOA 5IKVA 3MHWU 2Z9LA 4IC5A 3BEFB 3DFJA 3Q3KA 4ZXYH 2P16A 1H8IH 1QRXA 1MBQA 1YPEH 2FX6A 4JZEH 4RSPA 3NTBA 4DT7B 1FXYA 1NTPA 2OYUP 2YGQA 3LTFB 1CA0C 1SGIB 1IHSH 1HFDA 3OY6U 4I33A 1N1LA 2XCNA 3GDSA 3RXEA 1F7MA 2CF9H 1VZQH 2FLRH 1YYY1 3UNQA 2PFEA 3MU5A 1W7XL 4BNRA 3U8RH 2XXLA 4CH2B 3LGUA 5FCRA 4NCYA 3HATH 3NJPC 5JBAE 2FZZA 1SVPA 3DFLA 1CBWB 2C8ZB 2G5VA 4X1NU 1D6WA 2O8LA 4UFFH 1DANH 1GGDC 1AWFH 3ODDA 1UTJA 2Z3EA 1TYNA 3SV2H 2QV1A 3BG4B 3RXGA 3SJ8A 4IS5A 6LPRA 5K0HB 3NWUA 2SGQE 1D3TB 1F92A 4NFFA 1P03A 1RIWC 2BX3A 3BEUA 4CREA 2BB4A 1PTHA 3K9XA 1X7AL 4CH8B 5LGOA 2J95A 4UFEH 3K9XB 4TY6A 4UFGH 1BRUP 1O2RA 4O02B 1FI8A 2FOMB 1AMHA 1HAYB 1O3JA 2P3FH 1O3LA 3EE0B 1IQHL 1O2XA 1IHTH 2B9LA 1EATA 2BDCA 2XC4L 3DHKH 3A7VA 1TRNA 1GJCB 1G2MA 3HO3A 1PPZA 4GCHF 1P2JA 4WVPE 4U2WA 4H6SB 3NUMA 2ZG0H 1W8BH 3M35A 1MQ5A 1EJMA 1QL8A 2XC5L 3BTFE 3RXBA