4BXWA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
322
structure length
286
Chain Sequence
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR XA
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
total genus 69
structure length 286
sequence length 322
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxwA02
3FZDA 1DY8A 2MGRA 1SGIB 4KTCA 4E06H 3SV8A 2FS8A 1IP0A 2P59A 4K8BA 1C4Y2 2Y82A 1YCPK 1ID5H 1UTOA 3KCGL 1LTOA 4TGFA 1V2TT 1QB1A 4Y79A 4CRBA 6CHAC 1QGFA 1YUKB 2HPQH 4ZKSU 1CVWL 2EI8A 1FF7A 1V2PT 4YO9A 1GWAA 3NT1A 2JH5D 1L2EA 3PMHB 3TK6A 3KHVA 1BTUA 1HAIH 1O3LA 4LZ4B 2BM2A 4FUDA 1ZRKA 3A85A 3TVJB 1KSNA 3P70B 2ZU4A 1RS0A 4B75A 1WHFA 1LCYA 4ZXXL 1AVGH 1DUEA 4U30A 2PV9B 1LPGB 1PPGE 5HMAA 5A8YA 1O39A 3HO3A 1GCTC 2R2WU 1Z6CA 2F9BL 1L1NA 7GCHF 3RXOA 5A09A 1ETRH 3MYWA 1UTLM 3K6YA 3KGPA 1HAGE 2BHGA 2Y5FL 4JK5A 1HAVA 5DGJA 4FUHA 4YOIA 1F5LA 1NFYB 4NA9L 1HAYB 2F3CE 4FUFA 1HDTH 2ZPSA 1MD7A 4IC6A 3W95A 2VWOL 3VB7A 3RUOA 3TJUA 1JXPA 3OY5U 3SOSA 3O8BA 4A1XA 4CRAA 4O1ZA 2J95B 1HT8A 1XFEA 2J9NA 2ZU2A 1UCYK 3ODFA 3BG4B 7KMEH 1IHSH 2W2PE 2H1UA 1ELEE 1NRQH 4YTAA 5LGOA 1P12E 2R0LA 2GGVB 1ARCA 1S6FA 2Z9IA 3SORA 1UVTH 3RM0H 1KTSB 1BOQA 3QH0A 2A7JA 1EJAA 4GCHF 1LO6A 1BTWA 1HIAB 3EA7A 4YLQH 1THSH 3B23B 3LGYA 1VZQH 1BMMH 1DWDH 2ZPQA 4ZROA 1H9LB 5ESBA 1QBOA 1TNHA 4CH8B 1GJ7B 5C67A 2JH0D 4YT7L 3ESTA 2OLGA 1TOZA 2W86A 3GY3A 3Q3XA 1C4V2 3L33A 1F0SA 1K1MA 1FAXL 2ZFPH 1LHCH 4X8UH 4F49A 2TGDA 4CR9A 3HK3B 2P3TB 4ABGA 2UWPA 3UOPA 3PROA 2CGAA 3VB6A 1O5GH 4E1GA 2TRMA 1JV2B 1DOJA 1IOXA 1SG8B 1KLTA 4ZH8B 1MBMA 1TNKA 1IQFA 3FAOA 2K2SB 3MMGA 4H4FA 4JYUH 1K22H 4MPWA 1CX2A 2SGQE 2PKSC 2GT8A 4I8JA 2ZNKH 3QK1A 1GBTA 3I78A 3ATKA 4RS0A 1IQNL 3FANA 2B7DL 1K1LA 3BTEE 1GDNA 5A2MH 1L1JA 1ELTA 1TNIA 3A8CA 2GCTB 1Y5AT 1P2JA 2CV3A 2WPJE 5COXA 2G51A 5EGMB 5GXPA 2J34A 1KDQA 4MTBA 3TK5B 1DSTA 4NWLA 1AGJA 4ESTE 2VH6A 3BIVH 3SI3H 3QUMP 4TYDA 1Y3UA 1LPZB 3LN0A 2AMPA 1W10U 3RP2A 2CF9H 2JETB 1GVZA 1DANH 1K1JA 2GT7A 4X2VA 1VCPA 2H2ZA 4NWKA 1G9IE 2UWLB 3PYHA 2ZFQH 2P93L 5JPMH 4Y7AB 2ZHFH 3AASA 4B73A 1BA8B 2NPRA 1ESTA 2BD5A 1O5DL 1IQEL 2K1QA 3ZV9A 4JZFH 2W2ME 3D62A 2DE8A 1O3OA 1JBUH 2Z9JA 1G3DA 1NU9A 2XC4A 5JBAE 2OTVA 2FM2A 3PO1C 3TK9A 1ATEA 1CHGA 2GMTB 5JBTA 5F03A 1TLDA 4CRGA 4O02B 1NPEB 1SGNE 1CVUA 1GMDG 9ESTA 1V2RT 1J9CL 1DLKB 1O3CA 1G2MB 1PYTD 2O8MA 2FX6A 1GI7B 1GPZA 2UUJB 4I8GA 5H4IB 3RXJA 1IOEL 1DLEA 1L4DA 2VB0A 3TH3L 1UVSH 2P94A 2PGQB 1P9JA 2F9UA 1Z6JH 4ABJA 1HAZB 1QQUA 4THNH 4BAOB 3BTME 4I7YH 4CHAC 3SU6A 5JB8E 1NFUA 2R3UA 1DM4B 1GJ9B 3QLPH 3MHWU 2ZC9H 2SNVA 2J92A 5A8XA 5CISA 1IQHL 4COXA 2A2QH 1C5PA 3ZYIB 1GI4A 2IN2A 1F0TA 4RSPA 3SNEA 2PR3B 4MMYB 2OQ5A 4D90A 1P9SA 2ZCKP 2P3UB 1HUTH 3EA8A 3TPIZ 2FTMA 2ADXA 3N8XA 4BOHA 1CT2E 2FI3E 2ZEBA 3NKKA 1E34B 1WCZA 2NU2E 3MH4A 3KQDL 1GJ5H 2QXIA 3M35A 2Z6BD 1LQDB 3PM3A 3Q00A 5FPTA 1LMJA 4BTIB 4DVAU 3KRKA 4I8KA 1Y5BT 1CT4E 2FZZL 2FOGA 3VB5A 2BQ7A 1BBRE 1EPGA 3A82A 3NUMA 1G37A 4A92A 4AGKA 2Z9KA 3GCNA 4NZQA 1MTWA 4ABHA 1J8AA 3GDUA 1ZAQA 4VGCB 3ATIA 4X6MA 3KL6A 1DVAH 2KAIB 1QHRB 5T6FA 1HFDA 4UE7H 3LIWB 3BV9B 5EW1H 1FE2A 1V2KT 3HPTA 1C5SA 2P94L 3UIRA 2FPZA 4D7FA 5CKQA 1D3DB 1SBWA 1FY5A 1HXEH 4Y71A 3PMAB 5SGAE 1U8CB 2NU3E 4K3JA 1DXWA 2WYGA 1EGFA 4CUEA 2B9LA 3A83A 5F6MA 1C1RA 1KIGL 1VJ9U 1YPLH 1P09A 1EZSC 2BOHB 3A7VA 5C3NA 1N6YA 1K28D 2FO9A 1CBWB 3GOVB 3LPRA 1C5WB 2QY0B 4M7GA 5PTPA 3RU4T 1P04A 5FHTA 1FFMA 3SU2A 4D76A 1EUFA 5KN5C 3QMOA 1O33A 4A5TS 1FLEE 2NU4E 3K9XB 3UPEA 1K9OE 1O3MA 1SLWB 3MU1A 4JYTA 1QB6A 1KXCA 4O9VA 1FIZA 1ESBA 1OP0A 5JBAS 2BDGA 3ZVFA 3T29A 4YM9A 2AERH 4D0FA 3T27A 3UR6A 1YGCL 1FQ3A 3HATH 1P05A 4MG3A 1KXBA 1Z6EA 2I9AA 3MFJA 5CHAB 1LHDH 3C27B 1TOMH 1SLUB 3BTQE 3GCTG 3PLKA 1Z8IB 4DOQA 4DURA 1YPEH 2ZP0H 3ZVAA 3KQBA 1ZRBA 3MDLA 4BAKB 2Q1JB 1BB0B 4GSOA 4Z0KA 2UUKB 3ENSA 1BTPA 4R0IA 1YPHC 3N8ZA 1O3EA 1ZHPA 2NWNA 3BF6H 3O8DA 3TIUA 2ZFSA 1PPBH 1H9HE 5A8ZA 1KXAA 1B0EA 1ZGIA 1GMDF 2ZKSA 2J94B 3AAVA 3ATWA 5E0GA 3C1KA 2VVCA 1TRMA 3T2NA 3UNSA 1VCQA 4GHQA 1T8LA 2C3SA 2QCYA 2ZQ1A 5EQQA 1FPCH 1S83A 3S9CA 1T4UH 3BTHE 1K1OA 4O97A 2XC5A 4CRFA 4X1QU 3E16B 4XBMA 1C2GA 1EPJA 4X0WU 2OINA 1E36B 3SQEE 3ITIA 2G8TA 2Y5GL 2VGCB 5IDKA 1YLDA 1GHBG 2XNIA 1Z8JB 3RXEA 2J4IB 2QYIA 3UQVA 1FJSL 2MGPA 1W13U 3VXEH 2FLRL 1HJ8A 4WH6A 1EOLA 1EPTC 2VWLL 3KQEL 5F8ZA 1XM1A 2UWOA 1YUGA 2OBOA 2VIPA 3SW2B 3S0NA 1O2SA 1VJAU 1T8NA 3NK8A 1A61H 2ILNA 3SJOA 1CA0C 1SGCA 4FXGH 4RKOB 3M7TA 1TQ0B 1F0RB 1FY1A 4DIHH 3K2UA 3A7YA 1ZSKA 1A0HB 4WY3A 1NESE 2Y7ZA 3FFGA 2YGOA 2A4RA 3L6PA 5C1XA 1EKBB 2G55A 2AFQB 1CQQA 1ZZZA 4AB9A 3PV4A 1A0LA 4YOGA 2ZU5A 2B8OH 1KXFA 2EI7B 4UD9H 4AB8A 1S82A 4X8SL 1SR5C 3AAUA 1GI2A 3M5LA 2ZDNA 1S0QA 2ZTXA 3RLYH 4KP0A 3PTNA 4XSKU 1NS3A 1FN8A 3BTDE 1QBVH 1TONA 5AF9H 2VVCK 3SV2H 1GHZA 1AKSB 1GJ4H 4BNRA 2W3IB 3Q3YA 1L0ZA 1PFXL 1OWEA 4SGBE 1ABJH 2BY7X 1C5YB 1FIWA 3NZIA 3V64C 1NFXA 1QA7A 5JBBE 3H7OA 4RN6A 4UEHH 1AQ7A 2V3HH 1GJ6A 3Q3KA 2BD8A 1NU7B 3BTTE 3NJPC 1DE7H 1OSSA 2P3FL 1GBMA 1HB0B 3OU0A 1MCTA 3SU0A 1A7SA 3N8WB 1SPJA 1O2UA 1T8OA 3MU4A 3RU4D 1DUAA 1O37A 1DX5M 1KLJH 1TPAE 2W26A 1DICA 1QCPA 4NZLA 1ZPCA 3V13A 5HXFA 1BCUH 2BQ6B 1NO9H 1MTVA 3MU5A 1RFNB 2VWNA 5FX6A 5BRRE 3SUFA 3BTFE 3CS7L 2H9HA 4ABIA 6CHAB 1HAOH 3H5CB 3GCTF 3HO5A 1TYNA 1WSSH 2Y81A 3LTFB 1XUJA 2XBWA 1UZPA 2ZTYA 4OS1A 1V2WT 1Z7KA 1SL3A 1EPIA 2Y7XB 3BTKE 4ZUHA 1YM0A 1O5CB 3SU1A 1QA0A 2RNLA 4ZAEA 4IC5A 2BLVA 3DA9B 1FAKH 5FBEA 4CRCA 3A7WA 1O35A 1TMUH 1FPHH 5F8XA 1B5GH 3POYA 2ZGHA 4D9RA 1SQOA 4C16A 3RXIA 1FZZA 3K6ZA 2OYUP 1GCTB 3QN7A 1IQLA 1GHAG 4Y8YA 1O2IA 1AY6H 4X6NA 1AE5A 4XFQA 2ALVA 1SQAA 1BF9A 1MQ6A 2FXRA 1MOXC 2FMJA 2TIOA 2BY5X 1NQLB 3MNSA 1ZMLA 4ABFA 2BOKA 2ZFFH 1V2VT 1BIOA 2GDDA 2QN5T 3TGKE 1W7XH 4HTCH 4NGAH 2GD4A 3I77A 4MNWA 2AGGX 1NFWA 2FOHA 1SC8U 3A8DA 1GHBF 1ZR0A 2D2DA 4X1SU 2P16L 4MPUA 1JWTA 1G1QA 2ESTE 4JMYA 1CSOE 1NY22 5L6NH 2O8UA 1JOUB 1C2JA 2VVUL 1Q3XA 2OC1A 4O3TA 3A87A 1Z1JA 1EP6A 1OYTH 5E0HA 3JZ1B 1T31A 1L5GB 2PKAB 2ZGXH 1XXDA 2ZDMA 3KNXA 1MQ5A 2HRVA 4NG9H 3NWUA 1WU1B 1DY9A 3MOCA 1WQVH 3ZYJB 1YPKH 2RDLA 1P0SH 2Y6TA 2YGPA 1O31A 3GICB 3SNDA 1JRSA 2XTTB 4WH8A 4LK4A 1O2PA 5JBBS 3M3TA 1HCGB 2XBXL 1K1IA 2ZDLA 3GYLB 2Y80B 3ELAH 1O2TA 2FI4E 2WYJA 3GY6A 4NIYA 2H9EH 1LMWB 4TY6A 1UHBB 1V2QT 4YESB 1GI5A 1G2LA 2BOKL 4E05H 2OXSA 1C5VA 2ZFRH 4XE4A 1T4VH 3N8YB 1GBBA 3SUEA 4BTUB 5FXLA 2PKSB 3TGFA 1UK2A 1C5OH 1SGFG 1Y3WA 3RXKA 2OC8A 1IQMA 1H9IE 1HRTH 4JZEL 1ELGA 4CBNA 2RHPA 1V2MT 1AZZA 2PUQH 3SJ9A 2BLWA 2FD6A 3QWCH 5I25A 2GX4A 1AFQB 1ZLRA 4DT7B 1C1PA 1FN6A 3DFLA 4K69A 1W3CA 1A4WH 3KEEA 2QA9E 4NA7A 1KLOA 1S0RA 1LHGH 3RXMA 2WUBA 4OGXA 3GISX 3BTWE 3FBYA 1MTNC 1X7AC 3SV9A 1Z8RA 2CJIB 1V3XB 2FLBL 3UNQA 1HAEA 1A3BH 1TBRH 1LHFH 3BEFB 2ZDAH 3A80A 3MNCA 5JVYA 2I6SA 1W14U 3V7TA 3P8GA 5HGGA 2FTLE 1TFXA 2ZU3A 1UTNA 2BY8X 5CKMA 2PFEA 1MU8B 2BVXH 5K7RA 1MZAA 1FONA 1K1PA 2OUAA 2W2QE 1IQIA 1AVWA 1W8BL 1WV7H 1XMNB 3OY6U 2BQWA 1QRWA 3PO1B 3LGUA 1MAXA 4JK6A 1RD3B 5DP4A 5E2OA 1CE5A 2Y82B 2BDCA 1P02A 1OP2A 1P01A 4DY7B 3M7QA 3F6UH 2Z7FE 1TA2A 4Y79B 4GUXA 4E7RG 1PPEE 1BBRH 4WXVA 1K21H 4GLYA 3ZZ7A 1G1SA 1GHAF 2EI8B 3FP8E 1C2FA 4TPYA 3KIDU 4AFSA 3TK6B 2Y5HL 4BAQB 4R8TB 1KSNB 1D4PB 5L2YL 1O3DA 1K36A 3ATMA 2D26C 2F83A 3QGJA 2Q6GA 4CHAB 1P2KA 1SGFA 2G4TA 3RXSA 4TWWA 1J14A 4K1TA 1HAXB 1A5IA 4I33A 4IBLH 1UZQA 3GY7A 1GI0A 4QT8C 3U98H 2C4FH 1MU6B 3F9FA 3KQCA 3RR3A 2IOTA 3NPSA 3SN8A 3PGHA 3IITA 2STAE 2BD4A 1GBJA 4AYVB 4K60A 1ANBA 1C1UH 1EAWA 1IQKA 1WTHD 1PXXA 4ZKNU 1C5XB 1HAVB 1E0FD 2C8YB 1JBUL 1AWHB 1GJDB 4Q2KA 4IMQA 1V2OT 5KIRA 4XLWA 3RXLA 3S69A 3SGAE 3VGCC 2XC0A 4Z6AL 3OTJE 1U6QA 1QFKH 3RXFA 1EQGA 2FOEA 1MH0A 1OOKB 2NU0E 4ISHL 2G5VA 1W7GH 5DP3A 3SO3A 1EBVA 4AOQA 5I46H 3LGWA 1Z8GA 4DG4A 1NC6A 1C5MD 5CE1A 1LVBA 1UTKA 1QJ1B 4FVBA 3ZZ3A 3RXGA 1ELBA 1EQ9A 2Z9GA 4X1PU 1NROH 4WMFA 2GV6A 1O5EH 1O3GA 2VIDA 2WFTA 1BJUA 1YPMH 1SI5H 2F91A 4JCNA 1SHYA 3MTYA 1P2QA 3UQOA 2KB9A 2VJ1A 4FU7A 1O2LA 2BDBA 1MCVA 3MO3A 1C2MA 2VWMA 3VPKA 3F9HA 1TALA 4INKA 4X1RU 2WINI 1CVWH 1F0SB 1TGCA 3ZZ5A 1TWXB 3LOXA 2XWBI 3DEMA 2UWPB 4IN2A 3P8FA 2XBVA 1BQYA 3HKJB 4K1EA 1VGCC 4X2WA 1DDJA 1BMAA 1MKWK 3HGPA 5FPSA 1VITG 1GI8B 4ZXXH 4CRDA 1F92A 1NTPA 2VU8E 3SU3A 3SUDA 5C20A 4BTTA 1JIMA 1APOA 1O3FA 1WYKA 3BT1A 3U69H 1XVOA 4KELA 2F9BH 3TBDA 1APQA 1XKBA 1DVAL 2C8XB 2Y38A 1RTLA 3SQHE 2WG3C 4CR5A 4M10A 4CUFA 2QXHA 3K65B 4NA9H 1C1MA 1EMNA 3URCA 3RXVA 3HS7A 5HYOA 2FS9A 1MBQA 2ZWLH 4MPXA 1QNJA 3M61U 2J34B 1KDQB 4JYVL 5DJ7A 4UDWH 2VH6B 3NCLA 2JKHA 2ZO3H 2BB4A 1IQFL 1O2RA 1PPHE 4BDXA 1F5KU 2QF3A 3UREA 2ULLA 2ZCHP 2P8OC 1QR3E 3LH3A 3FP7E 1GBHA 5L2ZH 3GCXE 4FM5A 1Q4GA 2QXJA 2P26A 2HPPH 5IKTA 1ELFA 1HLTH 2FIRH 4KKDA 1EPTA 2SGEE 5ESTE 1GHXH 1OP8A 4IW4E 2JH6D 1YF4A 1TLEA 1TGSZ 6ESTA 1NN6A 2TGAA 4Y10E 2W7UA 3OLTA 1GBAA 2BZAA 4BANB 1RXPA 4YT7H 1QB9A 2M5TA 2ZGCA 1O3KA 1C1NA 3OX7U 1ANDA 2B0FA 4Y11E 3CENA 1MUEB 1TX7A 1AWFH 4RRXA 3DUXH 2B5TB 1ZPBA 3KN2A 4OS4A 3LKWA 3PB1E 4WJG2 2WPLS 1CGHA 2KL7A 3OYPA 1BZXE 1QL9A 4BXWA 2Z3CA 4Y8ZA 1BHXB 3BN9A 5F1AA 1XVMA 1EZUC 4K5ZA 2XC4L 4WWYA 1OXGA 2VH0A 2WG4B 2B7DH 1NFUB 1FUJA 1NT0A 5FCKA 2BXUH 1YP9A 1ATAA 2BOUA 1O2OA 1PPFE 4ZHAA 3RMMH 2XCFA 1UTQA 4NIVA 4B71A 5K0HA 4FUIA 1O2VA 1B0FA 1TGBA 3CFWA 2V0BA 6COXA 2AGEX 4WMDA 4A7IA 5IKVA 1M1XB 1TX6A 1EPHA 1NPMA 1MKXH 1N1IA 2VVVA 4ISNA 2VIVA 4OGYA 2HGTH 4B1TA 2ZPRA 2BQ7B 2R0KA 2FOAA 5E8EH 1D3PB 2CF8H 3FZZA 1F7EA 2BVSH 2PUXB 3IG6B 3KL6B 2VIWA 4Q7ZA 1O5DH 1S5SA 2BMGA 2G00A 4OS5A 3BEUA 3HPTB 3MNBA 2C93B 3GY4A 4ZKRU 5ABWA 2SGDE 1ZMNA 1HJ9A 1PTHA 4Y71B 1MTSA 4X6OA 1O2KA 1GCDA 3SHAH 2A31A 1ANCA 4X8TL 1J9CH 2WYGB 1EZQA 4X1NU 3F1SB 2GCTC 3BIUH 3M7UA 1SGRE 2D1JA 2G5NA 2I9BA 2DDUA 1WOFA 2RA0A 3G01A 3E6PH 4JZDL 4FUJA 4XDEA 3STIA 2BYAX 1C5ZB 4ISIL 1LPKA 1BT7A 3U8TH 3TH3H 1YPJH 4ISOA 3E1XB 1C1VH 2QAAA 1TGTA 2P95A 1A0JA 3E3TA 2JETC 4B74A 3ATLA 5DP7A 1DT2A 1JL9A 1P03A 2J2UA 1GMHG 2C8ZB 4X6PA 2BZ6L 3N8VA 1AZ8A 1YLCA 4ABAA 2WPHE 3RC4A 3P8OA 4X8VL 4ABBA 1AVXA 2G81E 8LPRA 2A5KA 3QTOH 1XKBC 1XUIA 4AFQA 3E91A 5E2PA 1ELVA 2PSXA 3EYDA 1OKXA 4O3UA 2PLXA 4AFZA 1L1GA 3SZNA 3RXBA 1COUA 1O36A 4ISLA 1GVKB 3MI4A 2FEQH 2A7CA 4CH2B 3GCHC 1HREA 1SQTA 4NSVA 1C9PA 2Q6DA 1UVUH 3QGNB 1L3YA 4Z0KB 1ADXA 1GDQA 3ENSB 1TRNA 3H7TA 1TPSA 5T3HA 1E37B 2TGTA 2W2NE 3RXCA 5IKRA 1UCYE 1S85A 2A5AA 4KGAA 5DKMA 1GBKA 1Z6EL 3HGNA 4FVDA 1HBTH 1G36A 1KXDA 1UTPA 2Q6FA 3Q76A 4ZXYL 3P95A 1YYY1 1K1NA 3LDXH 3UFAA 2UUYA 3KQBL 3LC5A 4M11A 5CKNA 1ZYOA 1VITH 1IQGA 5GCHG 2ZDVH 4J1YA 1C1TA 2CMYA 1KIGH 2FODA 1Y8TA 4HGCA 3I29A 1GBCA 2H5DA 3EQ0H 2PHBA 1YBWA 1CCVA 1SFQB 1XUHA 1ETSH 1C9TA 1RGQA 2XW9A 2YOLA 1EB1H 1XUKA 3CA7A 3GCOA 2UUFB 1MD8A 4Y76A 2EC9H 2ZTZA 1RTKA 2WPIE 5L30L 2UWOB 3TZIA 1A3PA 1SB1H 2FOBA 5LPRA 2VINA 1DDXA 4GAWA 2XC5L 3NTBA 1A46H 4AG2A 3R3GB 1V2JT 1HAHH 1LKAA 4ABEA 3A7ZA 3LC3A 4GVUA 2OD3B 2Y7ZB 1F7ZA 1P8VC 1YGCH 1ELAA 3ODDA 1BDAA 4X2XA 1INCA 1EOJA 1FMGA 1O2ZA 1DIYA 1D3TB 2ASUB 3SU4A 5FDQA 5ETXA 1TNJA 4IGDA 1BTYA 4Z0LA 1TNGA 2FI5E 1TNLA 2QV1A 3ASIA 4NCYA 4MPVA 5JBCE 1C5UA 2HALA 3M37A 2ZDKA 4NIXA 3HS6A 3UNRA 1SSXA 3MWIU 1IQJA 1BMNH 1FY4A 2ZU1A 3E90B 5C1UA 4RUTA 3LGVA 2FESH 5EXNA 2BDHA 5GJ4B 2ZI2H 3FFGL 1PJPA 2WPHS 1MMJN 4Y7BA 1GI1A 3A84A 2OCVB 4YZUA 1HJ7A 1KY9A 1MTNB 1NFXB 1LVOA 1SMFE 4ABDA 2XCNA 3Q3KB 4CUDA 3TNTA 4YT6L 1NRRH 1HNEE 2FDAA 2WV5A 4YLUA 2D8WA 1P10A 3ZZCA 2ZGBH 5TJXA 2IJOB 1ZHRA 3BEIB 1JMOH 4XBCA 3LGTA 2W3KA 2AGIX 1IJQA 1KXEA 1ESAA 2AMQA 2EI6A 2O8WA 1XDTR 1KYNA 2W26B 2XYAA 4AORA 1ZHMA 3BPSE 3SHCH 2FLGA 1UJ1A 1GMHF 1PQ8A 1C2DA 5CHAC 2OC0A 3S9AA 1I0UA 3M36A 3ZZ9A 4XOJA 2QF0A 2BO2A 1RRKA 1SOZA 4XBBA 1TBZH 1X7AL 1ELCA 2PUQL 2TBSA 2YNBA 3PMJA 1AHTH 1CHOG 1H4WA 3T5FH 1UTMA 5DK1A 2ANKH 3TNSA 1N8OC 3TLOA 2Y81B 1SZBA 3D49H 4NFFA 4Y0YE 2KV4A 1XUFA 4ZAEB 2ANMH 2CN0H 4DIIH 4BAHB 1O2YA 4PROA 1H8DH 1PPCE 1SGPE 2ZFTA 1S81A 1UO6A 1WUNH 2GV7A 2TPIZ 2ZECA 1C2HA 4X8SH 3E0PB 1DWEH 2VWNL 1GHYH 3UOUA 1TMTH 1C1SA 5C5OA 2WPIS 2RCEA 2XBYA 3SJKA 2XBWL 1ANEA 1OWHA 2A2XH 1G3BA 3HKIB 3AW1A 4YOJA 1N7DA 2GD4B 3RXUA 1AUJA 1OWJA 1U67A 5GCHF 1NFWB 1GJAB 2QGRA 1HCGA 5DP8A 2AEIH 2BTCE 3R0FA 1BMLA 1LDTT 2SGAA 4XBDA 1C1QA 2NU1E 6GCHG 2P3FH 2Z94A 3MH7A 5F19A 5LPEA 2BD9A 1UTJA 1D3QB 1IQLL 2HVXA 3DHKH 4DJZB 2BDIA 3MU0A 1OB1C 4HFPB 1V2NT 4CREA 2AYWA 4A1VA 3A89A 3D65E 3UWIA 5JBCS 2YNAA 4FU8A 1BBRK 1MQ6L 1UMAH 4KTSA 5AHGH 1N1LA 2AIQA 2ZA5A 4OS2A 3RDZA 1EXFA 4FU9A 2J38A 3ZVCA 1O2QA 2R9PA 5GDSH 3RXTA 1EATA 1O30A 2BD2A 4B76A 1TX8A 1BRBE 1C5TA 4LOYH 1GL0E 2WUCA 3EGKH 3U7UG 1G1TA 1EX3A 1P57B 2BDAA 1ORFA 2THFB 4Y6DA 3U1JB 4NIWA 1DWBH 1LQEA 4MNVA 1WTGH 3BG8A 3VB3A 2A4OA 4U32A 4H6TA 2WYJB 1NM6A 1T7CA 2ZHDA 2GVFA 2ZQ2A 5JYIA 1G2LB 2DUCA 4RKJB 1GDUA 1TAWA 1W2KH 1BRAA 1MQ5L 5EPNA 1AB9C 2Y5FA 4WMEA 1Z1IA 1SLXB 1THRH 1EAIA 4ZMAH 1C1WH 4X8UL 2G4UA 5EW2H 1A5HA 2VWOA 2A7HA 1HGTH 1XKAC 1QRXA 1Y3XA 2WPMS 1D6WA 1THPB 2ZHWH 1TA6A 4AN7A 2ZGJA 3A81A 1LPGA 4JYUL 1SGDE 2H9TH 1GMCG 3RM2H 1YCPM 1C5LH 2PGBB 1TOCB 5DP6A 3A7TA 1LKBA 3QTVH 2SFAA 3ZYDA 4HZHA 3UUZA 1AIXH 2P8OB 2XXLA 3P92A 1IQML 1ELDE 1A3EH 1NFYA 1AD8H 1K2I1 1GGDC 3LU9B 3JZ2B 3RXPA 1CGJE 3PWBA 5BPEA 3EDXB 1HAPH 1CHOF 1LVMA 1SVPA 1OYQA 1WBGB 2PTNA 3QCWA 2J95A 1QJ6B 2EA3A 1C5NH 1RIWC 5DG6A 3TU7H 2H6MA 1GL1A 3ZYEA 2BQWB 4PH9A 5F8TA 5EQSA 2VJ3A 1VCWA 1FDPA 3KF2A 3W94A 2ZF0H 2O8TA 1QL8A 1FAXA 1D9IA 2ANYA 1D6RA 1QY6A 1GG6C 5HM2A 4OS7A 1HT5A 4FUEA 3MNXA 2ODYB 2HNTE 1PGEA 4NSYA 4AZ2B 1KLIH 3GYMA 1DSUA 1HIAA 4JZFL 3GCWE 2BOXA 4BDWA 1O3PB 5FBIA 5GIBA 1CGIE 3A88A 2FP7B 1IQNA 1IQIL 1V2LT 8ESTE 1FNIA 1OS8A 5LPFA 4K2YA 3UY9A 4U01A 5T6DA 3P8NA 3BTGE 2CXVA 5L2ZL 4MMXB 4JZEH 1ACBE 2P3TA 7ESTE 1G3CA 5EOKA 1FI8A 3IITB 1TRYA 2WPLE 4TY7A 3RMOH 1AE8H 3UWJH 6GCHF 1SHHB 1NZIA 3A8BA 5JVZA 1E38B 1TPOA 4ZH8A 3CP7A 1GHWH 1O5FH 3ZZ6A 3TGIE 1YCPH 3MH5A 2HWLB 6LPRA 1ZJKA 1AUTC 3M3SA 1HJAC 3HS5A 2O9QA 5J4SA 4A1TA 3A7XA 5C1YA 2QXGA 2HLCA 1EQHA 1O5AB 2P93A 3M5NA 1V2ST 2FLBH 1O3IA 5FAHA 3KCGH 1QIXB 1MZDA 2AYLA 3FVFB 5EXMA 5EGMA 1ZGVA 1IQEA 4FUBA 3KQCL 4KTUA 3GISB 3MU8A 3TK5A 1IQKL 3O8RA 2RG3A 3P6ZB 3U8RH 5IYTA 1LPZA 3SV7A 1HYLA 1ZPZA 1W8BH 2BY6X 1TPPA 1PQ7A 3VB4A 2GKVE 5J4QA 3NXPA 2XC0L 1ZMJA 1P3EA 3SNBA 2UWLA 3ZZAA 3L3TA 3U1IB 1CCFA 1HV7A 4Y7AA 4CBOA 1GK5A 3HO4A 1IOEA 1RTFB 1BTHH 2SGPE 2GDEH 2EEKA 3S9BA 3ZZDA 5LH8A 1AFQC 4GHTA 1V2UT 1O3HA 1Y3YA 4UFFH 3ZZBA 1YPGH 2GCHG 4SGAE 3P5BL 1TQ7B 3SUGA 1Y3VA 1UCYH 1OX1A 4LMFA 2DE9A 3C9AC 3B8JA 2BD3A 2ZIQH 2CHAC 1BRCE 5G4BA 5L2YH 1OWIA 3DD2H 2F9OA 2ANWA 1GHVH 1IQHA 1G2MA 1P2NA 2FOCA 4BTTB 1O2NA 1GMCF 1OPHB 3GDVA 5A0AE 1BITA 5FCRA 1CT0E 1EAIC 1O5BB 1MKXK 1ZJDA 4CSYA 1T32A 1FY8E 2I6QA 3QZQA 3PLPA 3VFEA 1AN1E 3ZVEA 3KQDA 2V6NA 3DT0H 5AFZH 2W7SA 3RXAA 2VWMK 1W11U 1CA8B 2XBVL 2ALPA 2FZZA 3GCHB 3ZZ8A 4Z6AH 4ZKOU 4AX9H 3F9GA 5E0JA 1SGYE 3LJJA 1YC0A 5FPYA 1JRTA 4ISHH 5C5NA 4K8YA 3SNAA 3RXRA 4I31A 2PR3A 2FOMB 3AVZA 3D23A 1DS2E 3LT3A 2P3UA 2QIQA 1NZQH 2F9PA 1O2MA 2ZG0H 3LH1A 1EPTB 4D9QA 4MNXA 3A86A 1LQDA 4BAMB 1XUGA 3RLWH 4BTIA 1HZ8A 1FV9A 4I32A 3VEQB 1W0ZU 1TB6H 2FX4A 4WVPE 1CA0B 1J17T 2PSYA 3BG4C 3TJVA 3GY2A 1K37A 2A1DB 4JZ1A 4ZHLU 2JKHL 1MTUA 2GZ7A 3Q7DA 1TPGA 2KAIA 1MKWH 2MHPA 5DPAA 3LIWA 3R05A 2FYQA 1C4U2 2C90B 3A8AA 4JZIA 3PTBA 2Z3DA 3P17H 1C2KA 3E8LA 1O2GH 3FCSB 1GI9B 1P2OA 4WF8A 1H1BA 2P3FN 4Q80A 2STBE 9LPRA 1NRSH 2O8LA 1NRPH 1PPZA 4UONA 5IKQA 2OBQA 1CEJA 1SGQE 3RC5A 3T28A 7LPRA 1CQEA 1IGXA 1P2MA 1F2SE 4BXSA 3SGBE 3RXDA 2BOHA 5T6GA 1LVYA 2VH0B 4B2CA 1TABE 2BLQA 5EG4A 3SJIA 1QRZA 1ZTLA 5AVDA 3WY8A 1G3EA 4ZHAB 2OC7A 2WPJS 3CENL 3LONA 5K0HB 1Q31A 1SOTA 3K9XA 8KME2 3V3MA 1P06A 1TIOA 3N7OA 1WQSA 1DX5I 4JYVH 1TE0A 3STJA 4A7IB 4Y8XA 1QL7A 1BHXF 4ZHMU 2W2OE 2VIQA 3OLUA 1VITF 3HK6B 1MAYA 2QC2A 1UVPA 2WV4A 2F9VA 4RRWA 3BSQA 4AGJA 2AIPA 1NT1A 1AFEH 4X2YA 2V3OH 2M74A 4INHA 5B6OA 2BXTH 2K2TA 2TGFA 2AS9A 1ZSJA 3RC6A 1GJ8B 2Q1JA 3LGIA 2GCHF 2BMGB 1S6HA 3E0NB 1EAUA 3SJ8A 1SFIA 4E7NA 1L4ZA 2Y5GA 2G52A 1QURH 1ATDA 4MLFB 1ZOMA 2Z3EA 2XRCA 2BLOA 1KTTB 1O38A 3F68H 1FJSA 2BX3A 2J94A 2VVVL 3S7HB 1EZQB 3TH2H 1AI8H 5DP5A 4OS6A 2VWLA 1O2WA 2BVRH 3KQEA 1DITH 2D1JB 1O2XA 4MMZB 1IHTH 3QX5H 3SOQA 4A6LA 1EP5A 1YO8A 2XWAA 1DFPA 1B9WA 1O0DH 5EQRA 1LPKB 2PW8H 1DPOA 4G1MB 1ZTJA 2BD7A 2GMTC 1EASA 1NRNH 3EGFA 1KLJL 2G00L 1UZKA 1ZTKA 2F9NA 4I8HA 1N8OB 4F4OC 1HRFA 1QJ7B 1S84A 8GCHG 5HM9A 1O3JA 1M9UA 4UFDH 2J2UB 5JB8S 2J4IA 2A45B 1UK4A 4B2AA 1P9UA 5TCAA 3B9FH 3TJOA 5EU8A 1P3CA 2RA0L 1BUIA 1FXYA 1C5MF 5JB9E 4OTYA 3SW2A 1BJVA 4D7GA 3PLBA 2BDYA 1C5QA 2FWWA 3ZVDA 4IMZA 2V35A 2P28B 1F0RA 1JIRA 2A5IA 1ATBA 1ZSLA 1FSBA 2ZHQH 4IS5A 4AFUA 1EAXA 4D0EA 2SNWA 2P95L 3QO6A 1BRUP 2HNTF 2R3YA 3SI4H 4U2WA 2VNTA 1FAKL 1AO5A 2C8WB 1GI6A 1O32A 4J2YB 5EODA 4D8NA 5JDUB 2EI7A 2OYEP 3RU4E 4B2BA 1DXPA 1H8IH 3QDZB 3MO6A 1T8MA 1Y5UT 1YKTA 3U73A 1WAYB 5DP9A 4H42U 1GI3A 1AKSA 2W3IA 3T25A 2FOFA 3EE0B 3IWMA 3T26A 3LC5B 1W7XL 1HX2A 4NGAL 1HPGA 4WXIA 4X8TH 2OP9A 1YUFA 4VGCC 1A1RA 1A2CH 3O8CA 4JZDH 3CS7A 2A4QA 3ZVBA 2PHBB 3N8WA 4ISIH 4MNYA 4INLA 1SGEE 4LXBH 4MQAA 3U8OH 4Y76B 1IAUA 1O2HA 3EA9A 1TBQH 3RMLH 1F5RA 3MH6A 4AG1A 1GJBB 3LAQA 1ARBA 1C2LA 4MDSA 2LNCA 3SV6A 1VR1H 4NA8A 4LORA 4LZ1H 2BQ6A 2BZ6H 4I8LA 2IPHA 1WHEA 2ZHEH 1EJMA 4NG9L 1IQGL 4X8VH 3LC3B 4DGJA 1CBWC 1RFNA 1EB2A 5EPYA 2TGPZ 2R2MB 3M5MA 4Q7XA 1P0SL 2GP9B 2LPRA 1DWCH 1AB9B 3MO9A 1P2IA 1TGNA 3LJOA 4Y0ZE 1ABIH 3DFJA 3ELAL 2Y7XA 3ZZ4A 1G30B 1CO7E 2BX4A 3F9EA 3NTGA 2H9EL 1FY3A 2GZ8A 1G32B 2SGFE 3KK6A 3ZVGA 3SU5A 3V0XA 1RJXB 3SBKA 4FUGA 5A0CA 4NFEA 1GJCB 1PQAA 1IGZA 2P16A 1W12U 3TH4H 3URDA 1B7XB 3EAJA 3T62A 3GDSA 4Y7BB 1EZXC 1PRHA 1N6XA 3AW0A 2FLRH 4YZUB 2ZZUH 2VVUA 4TPIZ 1SGTA 2ODQA 3OSYA 3SOBB 2WPKE 4FUCA 4RRZA 5JB9S 2HNTC 3RXHA 4ZXYH 1GGDB 4TWYA 2WPME 2OQUA 4GPGA 3M37L 2W3KB 1Y59T 3Q77A 1XKAL 1F0UA 2EI6B 1IQJL 8GCHF 3RXQA 3UR9A 1O3BA 1RIWB 1BTZA 1CU1A 1QQ4A 7GCHG 2WFXB 1Z71A 3CS0A 2XBXA 2GTBA 2ODPA 1O3AA 1XXFA 4DCDA 1IVOC 1GG6B 1C1OA 2VIOA 1P11E 3TITA 3QZRA 5GPIB 2W5EA 4UFEH 5L30H 1YPHE 1C5RA 1UVOA 2PKAA 2GZ9A 2VGCC 2HOBA 3RMNH 1HAFA 1WU1A 1A5GH 5GWZA 3VGCB 5FX5A 4ASHA 1QBNA 1EMOA 2H5CA 1AU8A 4Q7YA 5C2ZA 3SNCA 1XX9A 1HXFH 1BTXA 3M5OA 1V6DA 1GBIA 3M36L 1EJNA 3F6UL 2AMDA 2A32A 1F7MA 1O2JA 4GCHG 2Y80A 1QTFA 3PMBB 3PWCA 1UHBA 4H6SB 1G1RA 1GBLA 3SGQE 1UK3A 1PFXC 4MVNA 4XL1A 5AFYH 1ETTH 3VXFH 1PYTC 3N8YA 4BTUA 2RA3A 1HJAB 2AH4X 5JW1A 3UTUH 1C2EA 1O3NA 3V12A 2PTCE 1GBFA 1AMHA 1OWKA 1PQ5A 5A0BA 5TCCA 5CMXH 1E35B 1GBDA 2BY9X 4YT6H 2A4GA 4RRYA 1KLIL 3FP6E 1SLVB 1DQBA 5E8DA 3S7KB 1TMBH 3LN1A 3MQEA 1W0YH 3SOVA 2PWXA 1Q2WA 3M3VA 3BT2A 1OWDA 2XBYL 1VGCB 1QFKL 1AUTL 2A0QB 3LTGD 3V65B 4IN1A 2CJIA 1V3XA 4OTJA 1GVLA 1J16A 1URKA 2J38B 3ZV8A 5I46L 3GY8A 2Z9LA 1C2IA 3GY5A 3IJEB 3TJNA 4AQTA 2FYRA 4DW2U 1J15A 3U9AH 5DO4H 5EXLA 1GBEA 2Y5HA 4K1SA 1O34A 4Y6DB 3ZYGA 2ZCLP 2WPKS 3TGJE 1LHEH 1UZJA 4AYYB 4O03A 2CHAB 4UFGH 4HI3A
chains in the Genus database with same CATH superfamily
3FZDA 1DY8A 2MGRA 1SGIB 4KTCA 4E06H 3SV8A 2FS8A 1IP0A 2P59A 4K8BA 1C4Y2 2Y82A 1YCPK 1ID5H 1UTOA 3KCGL 1LTOA 4TGFA 1V2TT 1QB1A 4Y79A 3KQ5A 4CRBA 6CHAC 1QGFA 1YUKB 2HPQH 4ZKSU 1CVWL 2EI8A 1FF7A 1V2PT 4YO9A 1GWAA 3NT1A 2JH5D 1L2EA 3PMHB 4Z1MD 3TK6A 3KHVA 1BTUA 2L74A 1HAIH 1O3LA 4LZ4B 2BM2A 4FUDA 1ZRKA 3A85A 3TVJB 2AHME 1KSNA 3P70B 2ZU4A 1RS0A 4B75A 1WHFA 1LCYA 4ZXXL 1AVGH 1DUEA 4U30A 2PV9B 1LPGB 1PPGE 2WPDD 5HMAA 5A8YA 1O39A 3HO3A 1GCTC 2R2WU 1Z6CA 2F9BL 1L1NA 7GCHF 3RXOA 5A09A 1ETRH 3MYWA 1UTLM 3K6YA 3KGPA 1HAGE 1E1RD 2Y5FL 1MABB 2BHGA 4JK5A 1HAVA 5DGJA 4FUHA 4YOIA 1F5LA 1NFYB 4NA9L 1HAYB 2F3CE 4FUFA 1HDTH 2ZPSA 1MD7A 4IC6A 3W95A 2VWOL 3VB7A 3RUOA 3TJUA 1JXPA 3OY5U 3SOSA 3O8BA 4A1XA 4CRAA 4O1ZA 2J95B 1HT8A 1XFEA 2J9NA 2ZU2A 1UCYK 3ODFA 3BG4B 7KMEH 1IHSH 2W2PE 2H1UA 1ELEE 1NRQH 4YTAA 5LGOA 1P12E 2R0LA 2GGVB 1ARCA 1S6FA 2Z9IA 4OM9A 3SORA 1UVTH 3RM0H 4F55A 1KTSB 1KMHB 1BOQA 3QH0A 2A7JA 1EJAA 4GCHF 1LO6A 1BTWA 1HIAB 3EA7A 4YLQH 1THSH 3B23B 3LGYA 1VZQH 1BMMH 1DWDH 2ZPQA 4ZROA 1H9LB 5ESBA 1QBOA 1TNHA 4CH8B 1GJ7B 5C67A 2JH0D 4YT7L 3ESTA 2OLGA 1TOZA 2W86A 3GY3A 3Q3XA 2YMSD 1C4V2 3L33A 4Q63A 1F0SA 1K1MA 1FAXL 2ZFPH 1LHCH 4X8UH 4F49A 2TGDA 4CR9A 3HK3B 2P3TB 4ABGA 2UWPA 3UOPA 3PROA 2CGAA 3VB6A 1O5GH 4E1GA 2TRMA 1JV2B 1DOJA 1IOXA 1SG8B 1KLTA 4ZH8B 1MBMA 1TNKA 1IQFA 3FAOA 2K2SB 3MMGA 4H4FA 4JYUH 1K22H 4MPWA 1CX2A 2SGQE 2PKSC 2GT8A 4I8JA 2ZNKH 3QK1A 1GBTA 3I78A 3ATKA 4RS0A 1IQNL 3FANA 2B7DL 1K1LA 3BTEE 1GDNA 5A2MH 1L1JA 1ELTA 1TNIA 3A8CA 2GCTB 1Y5AT 1P2JA 2CV3A 2WPJE 5COXA 2G51A 5EGMB 5GXPA 2J34A 1KDQA 4MTBA 3TK5B 1DSTA 4NWLA 1AGJA 4ESTE 2VH6A 3BIVH 3SI3H 3QUMP 4TYDA 2BSFA 1Y3UA 1LPZB 3LN0A 2AMPA 1W10U 3RP2A 2CF9H 2JETB 1GVZA 1DANH 1K1JA 2GT7A 4X2VA 1VCPA 2H2ZA 4NWKA 1G9IE 2UWLB 3PYHA 2ZFQH 2P93L 5JPMH 4Y7AB 2ZHFH 3AASA 4B73A 1BA8B 2NPRA 1FX0B 1ESTA 2BD5A 1O5DL 1IQEL 2K1QA 3ZV9A 4JZFH 2W2ME 3D62A 2DE8A 2JJ1D 1O3OA 1JBUH 2Z9JA 1G3DA 1NU9A 2XC4A 5JBAE 2OTVA 2FM2A 3PO1C 3TK9A 1ATEA 1CHGA 2GMTB 5JBTA 5F03A 1TLDA 4CRGA 4O02B 1NPEB 1SGNE 1CVUA 1GMDG 9ESTA 1V2RT 1J9CL 1DLKB 4XD7D 1O3CA 1G2MB 4AC9A 1PYTD 2O8MA 3PRBA 2FX6A 1GI7B 1GPZA 2UUJB 4I8GA 5H4IB 3RXJA 1IOEL 1DLEA 1L4DA 4FOUC 2VB0A 3TH3L 1UVSH 2P94A 2PGQB 1P9JA 1YY3A 2F9UA 1Z6JH 2M2AA 4ABJA 1HAZB 1QQUA 4THNH 4BAOB 3BTME 4I7YH 4CHAC 3SU6A 5JB8E 1NFUA 2R3UA 1DM4B 1GJ9B 3QLPH 3MHWU 2ZC9H 2SNVA 2J92A 5A8XA 5CISA 1IQHL 4COXA 2A2QH 1C5PA 3ZYIB 1GI4A 2IN2A 1F0TA 4RSPA 3SNEA 4B6EA 2V3MA 2PR3B 4MMYB 2OQ5A 4D90A 1P9SA 2ZCKP 2P3UB 1HUTH 3EA8A 3TPIZ 2W6JD 2FTMA 2ADXA 3N8XA 4BOHA 1CT2E 2FI3E 2ZEBA 3NKKA 1E34B 1WCZA 2NU2E 3MH4A 3KQDL 1GJ5H 2QXIA 3M35A 2Z6BD 1LQDB 3PM3A 3Q00A 5FPTA 1LMJA 4BTIB 4DVAU 3KRKA 4I8KA 1Y5BT 1CT4E 2FZZL 3WWBA 2FOGA 3VB5A 2BQ7A 1BBRE 1EPGA 1BMFD 3A82A 3NUMA 1G37A 4A92A 4AGKA 2Z9KA 3GCNA 4NZQA 1MTWA 4ABHA 1J8AA 3GDUA 1ZAQA 4VGCB 3ATIA 4X6MA 3KL6A 2IJD1 1DVAH 2KAIB 1QHRB 5T6FA 1HFDA 4UE7H 3LIWB 3BV9B 5EW1H 1FE2A 1V2KT 3HPTA 1C5SA 2P94L 3UIRA 2FPZA 4D7FA 5CKQA 1D3DB 1SBWA 1FY5A 1HXEH 4Y71A 3PMAB 5SGAE 1U8CB 2NU3E 4K3JA 4ACAA 1DXWA 2WYGA 1EGFA 4CUEA 2B9LA 3A83A 5F6MA 1C1RA 1KIGL 1VJ9U 1YPLH 1P09A 1EZSC 2BOHB 3A7VA 5C3NA 1N6YA 1K28D 2FO9A 1CBWB 3GOVB 3LPRA 1C5WB 2QY0B 4M7GA 5PTPA 2OK5A 3RU4T 1P04A 5FHTA 1FFMA 3SU2A 4D76A 1EUFA 2EY4C 4DT4A 5KN5C 3QMOA 1O33A 4A5TS 1FLEE 2NU4E 3K9XB 3UPEA 3FO8D 1K9OE 1O3MA 1SLWB 3MU1A 4JYTA 1QB6A 1KXCA 4O9VA 1FIZA 1ESBA 1OP0A 5JBAS 2BDGA 3ZVFA 3T29A 4YM9A 2AERH 4D0FA 3T27A 3UR6A 2YMSB 1YGCL 1FQ3A 3HATH 1P05A 4MG3A 1KXBA 1Z6EA 2I9AA 1V1HA 3MFJA 5CHAB 1LHDH 3C27B 1TOMH 1SLUB 3MQKC 3BTQE 3GCTG 3PLKA 1Z8IB 4DOQA 4DURA 1YPEH 2ZP0H 3ZVAA 3KQBA 1ZRBA 3MDLA 4BAKB 2Q1JB 1BB0B 4GSOA 4Z0KA 2UUKB 3ENSA 1BTPA 4R0IA 1YPHC 3N8ZA 1O3EA 1ZHPA 2NWNA 3BF6H 3O8DA 3TIUA 2ZFSA 1PPBH 1H9HE 5A8ZA 1KXAA 1B0EA 1ZGIA 1GMDF 2ZKSA 2J94B 3AAVA 3ATWA 5E0GA 3C1KA 2VVCA 1TRMA 3T2NA 3UNSA 1VCQA 4GHQA 1T8LA 2C3SA 2QCYA 2ZQ1A 5EQQA 1FPCH 1S83A 3S9CA 1T4UH 3BTHE 1K1OA 4YXWD 4O97A 2XC5A 4CRFA 4X1QU 3E16B 4XBMA 1C2GA 1EPJA 4X0WU 1EFRD 2OINA 1E36B 3SQEE 3ITIA 2G8TA 2Y5GL 2VGCB 5IDKA 1YLDA 1GHBG 2XNIA 1Z8JB 4P02A 3FOAA 3RXEA 2J4IB 2QYIA 3UQVA 1FJSL 2MGPA 1W13U 3VXEH 2FLRL 1HJ8A 4WH6A 1EOLA 1EPTC 2VWLL 3KQEL 5F8ZA 1XM1A 2UWOA 1YUGA 2OBOA 2VIPA 3SW2B 3S0NA 1O2SA 1VJAU 1T8NA 3NK8A 1A61H 2ILNA 3SJOA 1CA0C 1SGCA 4FXGH 4RKOB 3M7TA 1TQ0B 1F0RB 1FY1A 4DIHH 3K2UA 3A7YA 1ZSKA 1A0HB 4WY3A 1NESE 2Y7ZA 3FFGA 2YGOA 2A4RA 3L6PA 5C1XA 1EKBB 2G55A 2AFQB 1CQQA 1ZZZA 4AB9A 3PV4A 1A0LA 4YOGA 2ZU5A 2B8OH 1KXFA 2EI7B 3VG8A 4UD9H 4AB8A 1S82A 4X8SL 1SR5C 3AAUA 1GI2A 3M5LA 2ZDNA 1S0QA 2ZTXA 3RLYH 4KP0A 3PTNA 4XSKU 1NS3A 1FN8A 3BTDE 1QBVH 1TONA 5AF9H 2VVCK 3SV2H 1GHZA 1AKSB 1GJ4H 4BNRA 2W3IB 3Q3YA 1L0ZA 1PFXL 1OWEA 4SGBE 1ABJH 2BY7X 1C5YB 2J97A 1FIWA 3NZIA 3V64C 1NFXA 1QA7A 5JBBE 3H7OA 4RN6A 4UEHH 1AQ7A 2V3HH 1GJ6A 3Q3KA 2BD8A 1NU7B 2KCAA 3NJPC 3BTTE 1DE7H 1OSSA 2P3FL 1GBMA 1HB0B 3OU0A 1MCTA 3SU0A 1A7SA 3N8WB 1SPJA 1O2UA 1T8OA 3MU4A 3RU4D 1DUAA 1O37A 1DX5M 1KLJH 1TPAE 2W26A 1DICA 1QCPA 4NZLA 1ZPCA 3V13A 5HXFA 1BCUH 2BQ6B 1NO9H 1MTVA 3MU5A 1RFNB 2VWNA 5FX6A 5BRRE 3SUFA 3BTFE 3CS7L 2H9HA 4ABIA 6CHAB 1HAOH 2F43B 3H5CB 3GCTF 3HO5A 1TYNA 1WSSH 2Y81A 3LTFB 1XUJA 2XBWA 1UZPA 2ZTYA 3DSOA 1V2WT 1Z7KA 1SL3A 1EPIA 2Y7XB 3BTKE 4ZUHA 1YM0A 1O5CB 3SU1A 1QA0A 2RNLA 4ZAEA 4IC5A 2BLVA 3DA9B 1FAKH 2J5UA 5FBEA 4CRCA 3A7WA 1O35A 1TMUH 1FPHH 5F8XA 1B5GH 3POYA 2ZGHA 4D9RA 1SQOA 4C16A 3RXIA 1FZZA 3K6ZA 2OYUP 1GCTB 3QN7A 1IQLA 1GHAG 4Y8YA 1O2IA 1AY6H 4X6NA 1AE5A 4XFQA 2ALVA 1SQAA 1BF9A 1MQ6A 2FXRA 1MOXC 2FMJA 3H09A 2TIOA 2BY5X 1NQLB 3MNSA 1ZMLA 4ABFA 2BOKA 2ZFFH 1V2VT 1BIOA 2GDDA 2QN5T 3TGKE 1W7XH 4HTCH 4NGAH 2GD4A 3I77A 4MNWA 2AGGX 1NFWA 2FOHA 1SC8U 1E79D 2CK3D 3A8DA 1GHBF 1ZR0A 2D2DA 4X1SU 2P16L 4MPUA 5HIZA 1JWTA 1G1QA 2ESTE 4JMYA 1CSOE 1NY22 5L6NH 2QE7D 2O8UA 1JOUB 1C2JA 2VVUL 1Q3XA 2OC1A 4O3TA 4RT1A 3A87A 1Z1JA 1EP6A 1OYTH 5E0HA 3JZ1B 1T31A 1L5GB 2PKAB 2ZGXH 1XXDA 2ZDMA 3KNXA 1MQ5A 2HRVA 4NG9H 3NWUA 1WU1B 1DY9A 3MOCA 5C0UA 1WQVH 3ZYJB 1YPKH 2RDLA 1P0SH 2Y6TA 2YGPA 1O31A 3GICB 3SNDA 1JRSA 2XTTB 4WH8A 4LK4A 1O2PA 5JBBS 3M3TA 1HCGB 2XBXL 1K1IA 2ZDLA 3GYLB 2Y80B 3ELAH 1O2TA 3U28C 2FI4E 2WYJA 3GY6A 4NIYA 2H9EH 1LMWB 4TY6A 1UHBB 1V2QT 4YESB 1GI5A 1G2LA 2BOKL 4E05H 5CDFE 2OXSA 1C5VA 2ZFRH 4XE4A 1T4VH 3N8YB 1GBBA 3SUEA 4BTUB 5FXLA 2PKSB 3TGFA 1UK2A 2JDID 1C5OH 1SGFG 1Y3WA 3RXKA 2OC8A 1IQMA 1H9IE 1HRTH 1E1QD 4JZEL 1ELGA 4CBNA 2RHPA 1V2MT 1AZZA 2PUQH 3SJ9A 2BLWA 5DN6D 2FD6A 3QWCH 5I25A 2GX4A 2H9EC 1AFQB 1ZLRA 4DT7B 1C1PA 1FN6A 3DFLA 4K69A 1W3CA 2VBCA 1A4WH 3KEEA 2QA9E 4NA7A 1KLOA 1S0RA 1LHGH 3RXMA 5CHBA 2WUBA 4OGXA 3GISX 3BTWE 2PP6A 3FBYA 1MTNC 1X7AC 3SV9A 1Z8RA 2CJIB 1V3XB 2FLBL 5FL7D 3UNQA 1HAEA 1A3BH 1TBRH 1LHFH 3BEFB 2ZDAH 3A80A 3MNCA 5JVYA 2I6SA 1W14U 3V7TA 3P8GA 5HGGA 2FTLE 1TFXA 2ZU3A 1UTNA 2BY8X 5CKMA 2PFEA 1MU8B 2BVXH 5K7RA 1MZAA 1FONA 1K1PA 2OUAA 2W2QE 1IQIA 1AVWA 1W8BL 1WV7H 1XMNB 3OY6U 2BQWA 1QRWA 3PO1B 2J98B 2KX4A 3LGUA 1MAXA 4JK6A 1RD3B 5DP4A 5E2OA 1CE5A 2Y82B 2BDCA 1P02A 1OP2A 1P01A 4DY7B 3M7QA 3F6UH 2Z7FE 1TA2A 4Y79B 4GUXA 4E7RG 1PPEE 1BBRH 4WXVA 1K21H 4GLYA 3ZZ7A 1G1SA 1GHAF 2WSSD 2EI8B 3FP8E 1C2FA 4TPYA 3KIDU 4AFSA 3TK6B 2Y5HL 4BAQB 4R8TB 1KSNB 1D4PB 5L2YL 1O3DA 1K36A 4OS1A 3ATMA 2D26C 2F83A 3QGJA 2Q6GA 4CHAB 1P2KA 1SGFA 2G4TA 3RXSA 4TWWA 1J14A 4K1TA 1HAXB 1A5IA 4I33A 4IBLH 1UZQA 3GY7A 1GI0A 2WZQA 4QT8C 2C4FH 1MU6B 3F9FA 3U98H 5IK2D 3KQCA 3RR3A 2IOTA 3NPSA 3SN8A 3PGHA 3IITA 2STAE 2BD4A 1GBJA 4AYVB 4K60A 1ANBA 1C1UH 1EAWA 1IQKA 1WTHD 1PXXA 2QF4A 1C5XB 1HAVB 4ZKNU 1E0FD 2C8YB 1JBUL 1AWHB 1GJDB 1VKYA 4Q2KA 4IMQA 1V2OT 5KIRA 4XLWA 3RXLA 3S69A 3SGAE 3VGCC 4GU4A 4Z6AL 2XC0A 1U6QA 1QFKH 3OTJE 3RXFA 1EQGA 2FOEA 1MH0A 1OOKB 2NU0E 4ISHL 2G5VA 1W7GH 5DP3A 3SO3A 1EBVA 4AOQA 5I46H 3LGWA 1W0JD 1COWD 1Z8GA 4DG4A 1NC6A 1C5MD 5HKKD 5CE1A 1LVBA 1UTKA 1QJ1B 4FVBA 2JIZD 3ZZ3A 3RXGA 1ELBA 1EQ9A 2Z9GA 4X1PU 1NROH 4WMFA 2GV6A 1O5EH 1O3GA 2VIDA 2WFTA 1BJUA 1YPMH 1SI5H 2F91A 4JCNA 2KNIA 1SHYA 3MTYA 1P2QA 3UQOA 2KB9A 2VJ1A 4FU7A 1O2LA 2BDBA 3OE7D 1MCVA 3MO3A 1C2MA 2VWMA 3VPKA 3F9HA 1TALA 4INKA 4X1RU 2WINI 3UAIC 1CVWH 1F0SB 1TGCA 3ZZ5A 1TWXB 3LOXA 2XWBI 3DEMA 3S6XA 2UWPB 4IN2A 3P8FA 2XBVA 1BQYA 3HKJB 4K1EA 1VGCC 4X2WA 1DDJA 1BMAA 1MKWK 3HGPA 5FPSA 1VITG 1GI8B 4ZXXH 4CRDA 1F92A 1NTPA 2VU8E 3SU3A 3SUDA 5C20A 4BTTA 1JIMA 3OTPA 1APOA 1O3FA 1WYKA 3BT1A 3U69H 1XVOA 4KELA 2F9BH 3TBDA 1APQA 1XKBA 1DVAL 2C8XB 2Y38A 1RTLA 3SQHE 2WG3C 4CR5A 4M10A 4CUFA 2QXHA 3K65B 4NA9H 1C1MA 1EMNA 3URCA 3RXVA 3HS7A 5HYOA 2FS9A 1MBQA 2ZWLH 4MPXA 1QNJA 3M61U 2J34B 1KDQB 4JYVL 5DJ7A 4UDWH 2VH6B 3NCLA 2JKHA 2ZO3H 2BB4A 1IQFL 1O2RA 1PPHE 4BDXA 1F5KU 2QF3A 3UREA 2ULLA 2ZCHP 4ASUD 2P8OC 1QR3E 3LH3A 3FP7E 1GBHA 5L2ZH 3GCXE 4FM5A 1Q4GA 2QXJA 2P26A 2HPPH 5IKTA 1ELFA 1HLTH 2FIRH 4KKDA 1EPTA 2SGEE 5ESTE 2YGQA 1GHXH 1OP8A 4IW4E 2JH6D 1YF4A 1TLEA 1TGSZ 6ESTA 1NN6A 2TGAA 4Y10E 2W7UA 3OLTA 1GBAA 2BZAA 4BANB 1RXPA 4YT7H 1QB9A 2M5TA 2V7QD 2ZGCA 1V1IA 1O3KA 1C1NA 3OX7U 1ANDA 2B0FA 3PV5A 4Y11E 3CENA 1MUEB 1TX7A 1AWFH 4RRXA 3DUXH 2B5TB 1ZPBA 2KCPA 3KN2A 4OS4A 3LKWA 3PB1E 4WJG2 2WPLS 1CGHA 2KL7A 3SYJA 3OYPA 1BZXE 1QL9A 4BXWA 2Z3CA 4Y8ZA 1BHXB 3BN9A 5F1AA 1XVMA 1EZUC 4K5ZA 2XC4L 4WWYA 1OXGA 2RFKC 2VH0A 2WG4B 2B7DH 1NFUB 1FUJA 1NT0A 5FCKA 2BXUH 1YP9A 1ATAA 2BOUA 1O2OA 1PPFE 4ZHAA 3RMMH 2XCFA 1UTQA 4NIVA 4B71A 5K0HA 4FUIA 1O2VA 1B0FA 1TGBA 3CFWA 2V0BA 6COXA 2AGEX 4WMDA 1LMMA 3PV2A 4A7IA 2HVYB 5IKVA 1M1XB 1TX6A 1EPHA 1NPMA 3CNRA 1MKXH 1N1IA 2VVVA 4ISNA 2VIVA 4OGYA 2HGTH 4B1TA 2ZPRA 2BQ7B 2R0KA 2FOAA 5E8EH 1D3PB 2CF8H 3FZZA 1F7EA 2BVSH 2PUXB 3IG6B 3KL6B 2VIWA 4Q7ZA 1O5DH 1S5SA 2BMGA 2G00A 4OS5A 3BEUA 3HPTB 3MNBA 2C93B 3GY4A 4ZKRU 5ABWA 2SGDE 1ZMNA 1HJ9A 1PTHA 4Y71B 1MTSA 4X6OA 1O2KA 1GCDA 3SHAH 2A31A 1ANCA 4X8TL 1J9CH 2WYGB 1EZQA 4X1NU 3F1SB 2GCTC 3BIUH 3M7UA 1SGRE 1K0HA 2D1JA 2G5NA 2I9BA 2DDUA 1WOFA 2RA0A 3G01A 3E6PH 4JZDL 4FUJA 4XDEA 3STIA 2BYAX 1C5ZB 4ISIL 2KZ4A 1LPKA 1BT7A 3U8TH 3TH3H 1YPJH 4ISOA 3E1XB 1C1VH 2QAAA 1TGTA 5EJLA 2P95A 1A0JA 3E3TA 2JETC 4B74A 3ATLA 5DP7A 1DT2A 1JL9A 1P03A 2J2UA 1GMHG 2C8ZB 4X6PA 2BZ6L 3N8VA 1AZ8A 1YLCA 4ABAA 2WPHE 3RC4A 3P8OA 4X8VL 4ABBA 1AVXA 2G81E 8LPRA 2A5KA 3QTOH 1XKBC 1XUIA 4AFQA 3E91A 5E2PA 1ELVA 2PSXA 3EYDA 1OKXA 4O3UA 5T1VA 2PLXA 4AFZA 1L1GA 3SZNA 3RXBA 1COUA 1O36A 4ISLA 1GVKB 3MI4A 2FEQH 2A7CA 4CH2B 3DCLA 3GCHC 1HREA 1SQTA 4NSVA 1C9PA 2Q6DA 1UVUH 3QGNB 1L3YA 4Z0KB 1ADXA 1GDQA 3ENSB 1TRNA 3H7TA 1TPSA 5T3HA 1E37B 5HIYA 1KKEA 2TGTA 2W2NE 3RXCA 5IKRA 1UCYE 1S85A 2A5AA 4KGAA 5DKMA 1GBKA 1Z6EL 3HGNA 4FVDA 1HBTH 1G36A 1KXDA 1UTPA 2Q6FA 3Q76A 4ZXYL 3P95A 1YYY1 1K1NA 3LDXH 2VRSA 3UFAA 2UUYA 5EJZA 3KQBL 3LC5A 4M11A 5CKNA 1ZYOA 1QZ8A 1VITH 1IQGA 3WWFA 5GCHG 2ZDVH 4J1YA 1C1TA 2CMYA 1KIGH 2FODA 1Y8TA 4HGCA 3I29A 1GBCA 2H5DA 4GU3A 3EQ0H 2PHBA 1YBWA 1CCVA 1SFQB 1XUHA 1ETSH 1C9TA 1RGQA 2XW9A 2YOLA 3OFND 1EB1H 1XUKA 3CA7A 3GCOA 2UUFB 1MD8A 4Y76A 2EC9H 2ZTZA 1RTKA 2KCOA 2WPIE 1OHHD 5L30L 2UWOB 3TZIA 1A3PA 1SB1H 2FOBA 5LPRA 2VINA 1DDXA 4GAWA 2XC5L 3NTBA 1A46H 4AG2A 3R3GB 1V2JT 1HAHH 1LKAA 4ABEA 3A7ZA 3LC3A 4GVUA 2OD3B 2Y7ZB 1F7ZA 1P8VC 1YGCH 1ELAA 3ODDA 1BDAA 4X2XA 1INCA 1EOJA 1FMGA 1O2ZA 1DIYA 1D3TB 2ASUB 3SU4A 5FDQA 5ETXA 1TNJA 4IGDA 1BTYA 4Z0LA 1TNGA 2FI5E 1TNLA 2QV1A 3ASIA 4NCYA 4MPVA 5JBCE 1C5UA 2HALA 3M37A 3WW7A 2ZDKA 4NIXA 3HS6A 3UNRA 1SSXA 3MWIU 1IQJA 1BMNH 1FY4A 2WHXA 2ZU1A 3E90B 5C1UA 4RUTA 3LGVA 2FESH 5EXNA 2BDHA 5GJ4B 2ZI2H 3FFGL 1PJPA 2WPHS 1MMJN 4Y7BA 1GI1A 3A84A 2OCVB 4YZUA 1HJ7A 1KY9A 1MTNB 1NFXB 1LVOA 1SMFE 4ABDA 2XCNA 3Q3KB 4CUDA 3TNTA 4YT6L 1NRRH 1HNEE 2FDAA 2WV5A 4YLUA 2D8WA 1P10A 3ZZCA 2ZGBH 5TJXA 2IJOB 1ZHRA 3BEIB 2JJ2D 1JMOH 4XBCA 3LGTA 2W3KA 2AGIX 1IJQA 1KXEA 1ESAA 2AMQA 2IPQX 2EI6A 2O8WA 4TT3D 1XDTR 1KYNA 2W26B 2XYAA 4AORA 1ZHMA 3BPSE 3SHCH 2FLGA 1UJ1A 1GMHF 1PQ8A 1C2DA 5CHAC 2OC0A 3S9AA 1I0UA 3M36A 3ZZ9A 4XOJA 2QF0A 4ACBA 2BO2A 1RRKA 1SOZA 4XBBA 1TBZH 1X7AL 1ELCA 2PUQL 2TBSA 2YNBA 3PMJA 1AHTH 3SZEA 1CHOG 1H4WA 3T5FH 1UTMA 5DK1A 2ANKH 3TNSA 1N8OC 3TLOA 2Y81B 1SZBA 3D49H 1NBMD 3F2HA 4NFFA 4Y0YE 3OEED 2KV4A 1XUFA 4ZAEB 2ANMH 2CN0H 4DIIH 4BAHB 1O2YA 4PROA 1H8DH 1PPCE 1SGPE 2ZFTA 1S81A 1UO6A 1WUNH 2GV7A 2TPIZ 2ZECA 1C2HA 4X8SH 3E0PB 1H8ED 1DWEH 2VWNL 1GHYH 3UOUA 1TMTH 1C1SA 5C5OA 1H8HD 2WPIS 2RCEA 2XBYA 3SJKA 2XBWL 1ANEA 1OWHA 2A2XH 1G3BA 3HKIB 3AW1A 4YOJA 1N7DA 2GD4B 3RXUA 1AUJA 1OWJA 1U67A 5GCHF 1NFWB 1GJAB 2QGRA 1HCGA 3N99A 5DP8A 2AEIH 2BTCE 3R0FA 1BMLA 1LDTT 2SGAA 4XBDA 1C1QA 2NU1E 6GCHG 2P3FH 2Z94A 3MH7A 5F19A 5LPEA 2WZPP 2BD9A 1UTJA 1D3QB 1IQLL 2HVXA 3DHKH 4DJZB 2BDIA 3MU0A 1OB1C 4HFPB 1V2NT 4CREA 2AYWA 4A1VA 3A89A 3D65E 3UWIA 5JBCS 2YNAA 4FU8A 1BBRK 1MQ6L 1UMAH 4KTSA 5AHGH 1N1LA 2K8IA 2AIQA 2ZA5A 4OS2A 3RDZA 1EXFA 5GNDA 4FU9A 2J38A 3ZVCA 1O2QA 2R9PA 5GDSH 3RXTA 1EATA 1O30A 2BD2A 4B76A 1TX8A 1BRBE 1C5TA 4LOYH 1GL0E 2WUCA 3EGKH 3U7UG 1G1TA 1EX3A 1P57B 2BDAA 1ORFA 2THFB 4Y6DA 3U1JB 4NIWA 1W0KD 1DWBH 3FKSD 4XRNA 1QIUA 1LQEA 4MNVA 1WTGH 3BG8A 3VB3A 2A4OA 4U32A 4H6TA 2WYJB 1NM6A 1T7CA 2ZHDA 2GVFA 2QF5A 2ZQ2A 5JYIA 1G2LB 2DUCA 4RKJB 2RDEA 1GDUA 1TAWA 1W2KH 1BRAA 4F48B 1MQ5L 2KCYA 5EIYA 5EPNA 1AB9C 2Y5FA 4WMEA 1Z1IA 1SLXB 1THRH 1EAIA 4ZMAH 1C1WH 4X8UL 2G4UA 5EW2H 1A5HA 2VWOA 2A7HA 1HGTH 1XKAC 1QRXA 1Y3XA 2WPMS 1D6WA 1THPB 2ZHWH 3UB0A 1TA6A 4AN7A 2ZGJA 3A81A 1LPGA 4JYUL 1SGDE 2H9TH 1GMCG 3RM2H 3F2FA 1YCPM 1C5LH 2PGBB 1TOCB 5DP6A 3A7TA 1LKBA 3QTVH 2SFAA 3ZYDA 4HZHA 3UUZA 1AIXH 2P8OB 2XXLA 3P92A 1IQML 1ELDE 1A3EH 1NFYA 1AD8H 1K2I1 1GGDC 3LU9B 3JZ2B 3RXPA 1CGJE 3PWBA 5BPEA 3EDXB 1HAPH 1CHOF 1LVMA 1SVPA 1OYQA 1WBGB 2PTNA 3QCWA 2J95A 1QJ6B 2EA3A 1C5NH 1RIWC 5DG6A 3TU7H 2H6MA 1GL1A 3ZYEA 2BQWB 4PH9A 5F8TA 5EQSA 2VJ3A 1VCWA 1FDPA 3KF2A 3W94A 2ZF0H 2O8TA 1QL8A 1FAXA 1D9IA 4TSFD 2ANYA 1D6RA 1QY6A 1GG6C 5HM2A 4OS7A 1HT5A 3F0OA 3MNXA 2ODYB 4FUEA 2HNTE 1PGEA 4NSYA 4AZ2B 1KLIH 4P00A 3GYMA 1DSUA 1HIAA 4JZFL 3GCWE 2BOXA 4BDWA 1O3PB 5FBIA 5GIBA 1CGIE 3A88A 2FP7B 1IQNA 1IQIL 1V2LT 4Q4LA 8ESTE 1FNIA 1OS8A 5LPFA 4K2YA 3UY9A 4U01A 4A94C 5T6DA 3P8NA 3BTGE 2CXVA 5L2ZL 4MMXB 4JZEH 1ACBE 2P3TA 7ESTE 1G3CA 2HORA 5EOKA 1FI8A 3IITB 1TRYA 2WPLE 4TY7A 3RMOH 1AE8H 3UWJH 6GCHF 1SHHB 1NZIA 3A8BA 5JVZA 1E38B 1TPOA 4ZH8A 1SQRA 3CP7A 1GHWH 1O5FH 3ZZ6A 3TGIE 1YCPH 3MH5A 2HWLB 6LPRA 5KEDA 1ZJKA 2BT8A 1AUTC 3M3SA 4ZCNA 1HJAC 3HS5A 1UW7A 2O9QA 5J4SA 4A1TA 3A7XA 5C1YA 4RT0A 1WXRA 2QXGA 2HLCA 3GS9A 1EQHA 1O5AB 2P93A 3M5NA 1V2ST 3KYFA 2FLBH 1O3IA 5FAHA 3KCGH 1QIXB 1MZDA 2AYLA 3FVFB 4RI0A 5EGMA 5EXMA 1ZGVA 1IQEA 4FUBA 3KQCL 4KTUA 3GISB 3MU8A 3TK5A 1IQKL 3O8RA 2RG3A 3P6ZB 3U8RH 5IYTA 1LPZA 1SKYE 3SV7A 1HYLA 1ZPZA 1W8BH 2BY6X 1TPPA 1PQ7A 3VB4A 2GKVE 5J4QA 3NXPA 2XC0L 1ZMJA 1P3EA 3SNBA 2UWLA 3ZZAA 2HLDD 3L3TA 3U1IB 1CCFA 1HV7A 4Y7AA 4CBOA 1GK5A 3HO4A 1IOEA 1RTFB 1BTHH 2SGPE 2GDEH 2EEKA 3S9BA 3ZZDA 5LH8A 1AFQC 3DSPA 4GHTA 1V2UT 1O3HA 1Y3YA 4UFFH 3ZZBA 1YPGH 2GCHG 4SGAE 3P5BL 1TQ7B 3SUGA 5KGOA 1Y3VA 1UCYH 1OX1A 4LMFA 2DE9A 3C9AC 3B8JA 2BD3A 2ZIQH 2CHAC 1BRCE 3AK5A 5C17A 5G4BA 5L2YH 1OWIA 3DD2H 2F9OA 2ANWA 3NRLA 1GHVH 1IQHA 1G2MA 1P2NA 2FOCA 4BTTB 1O2NA 1GMCF 1OPHB 2WV9A 3GDVA 5A0AE 2EQNA 1BITA 5FCRA 1CT0E 1EAIC 1O5BB 1MKXK 1ZJDA 4CSYA 1T32A 1FY8E 2I6QA 3QZQA 3PLPA 3VFEA 3FN8A 1AN1E 3ZVEA 3KQDA 2V6NA 3DT0H 3F2GA 5AFZH 2W7SA 3RXAA 2VWMK 1W11U 1CA8B 2XBVL 2ALPA 2FZZA 3GCHB 3ZZ8A 4Z6AH 4ZKOU 4AX9H 3F9GA 5E0JA 1SGYE 3LJJA 1YC0A 5FPYA 1JRTA 4ISHH 5C5NA 4K8YA 3SNAA 3RXRA 4I31A 2PR3A 2FOMB 3AVZA 3D23A 1DS2E 3LT3A 2K0QA 2P3UA 2QIQA 1NZQH 2F9PA 1O2MA 2ZG0H 3LH1A 1EPTB 4D9QA 4MNXA 3A86A 1LQDA 4BAMB 1XUGA 3RLWH 4BTIA 1HZ8A 1FV9A 4I32A 3VEQB 1W0ZU 1TB6H 2FX4A 4WVPE 1CA0B 1J17T 2PSYA 3BG4C 3TJVA 3GY2A 1K37A 2A1DB 4JZ1A 4ZHLU 2JKHL 1MTUA 2GZ7A 3Q7DA 1TPGA 2KAIA 1MKWH 2MHPA 5DPAA 3LIWA 3R05A 2FYQA 1C4U2 2C90B 3A8AA 2XNDD 3PTBA 4JZIA 2Z3DA 3P17H 1C2KA 3E8LA 1O2GH 3FCSB 1GI9B 1P2OA 2XOKD 4WF8A 1H1BA 5DSFA 2P3FN 2LP6A 4Q80A 2STBE 9LPRA 1NRSH 2O8LA 3W1EA 1NRPH 1PPZA 4UONA 5IKQA 2OBQA 1CEJA 1SGQE 3RC5A 3T28A 5C94A 7LPRA 1CQEA 1IGXA 1P2MA 1F2SE 4BXSA 3SGBE 3RXDA 2BOHA 5T6GA 1LVYA 2VH0B 4B2CA 1TABE 2BLQA 5EG4A 3SJIA 1QRZA 1ZTLA 5AVDA 3WY8A 1G3EA 4ZHAB 2OC7A 5KECA 2WPJS 3CENL 3LONA 1YWUA 5K0HB 1Q31A 1SOTA 3K9XA 8KME2 3V3MA 1P06A 1TIOA 3N7OA 1WQSA 1DX5I 4JYVH 1TE0A 3STJA 4A7IB 2LELA 4Y8XA 1QL7A 1BHXF 4ZHMU 2W2OE 2VIQA 2GJGA 3OLUA 1VITF 3HK6B 1MAYA 2QC2A 1UVPA 2WV4A 2F9VA 4RRWA 3BSQA 4AGJA 2AIPA 1NT1A 1AFEH 4X2YA 2V3OH 4B6FA 2M74A 4INHA 5B6OA 2BXTH 2K2TA 2TGFA 2AS9A 1ZSJA 3RC6A 1GJ8B 2Q1JA 3LGIA 2GCHF 2W6ID 2BMGB 1S6HA 3E0NB 1EAUA 3SJ8A 1SFIA 4E7NA 1L4ZA 2Y5GA 2F4LA 2G52A 1QURH 3DSGA 1ATDA 4MLFB 1ZOMA 2Z3EA 2XRCA 2BLOA 1KTTB 1O38A 3F68H 1FJSA 2BX3A 2J94A 2VVVL 3S7HB 1EZQB 3TH2H 1AI8H 5DP5A 4OS6A 2VWLA 1O2WA 2BVRH 3KQEA 1DITH 2D1JB 1O2XA 4MMZB 1IHTH 3F0PA 3SOQA 3QX5H 1EP5A 4A6LA 1YO8A 1WDIA 2XWAA 1DFPA 1B9WA 1O0DH 5EQRA 1LPKB 2PW8H 1DPOA 4G1MB 1ZTJA 2BD7A 2GMTC 1EASA 1NRNH 3EGFA 1KLJL 2G00L 1UZKA 1ZTKA 2F9NA 4I8HA 1N8OB 4F4OC 1HRFA 1QJ7B 1S84A 8GCHG 5HM9A 1O3JA 1M9UA 4UFDH 2J2UB 5JB8S 2J4IA 2A45B 1UK4A 4B2AA 1P9UA 5TCAA 3B9FH 3TJOA 5EU8A 1P3CA 2RA0L 1BUIA 1FXYA 1C5MF 5JB9E 4OTYA 3SW2A 1BJVA 4FETA 4D7GA 5EJ1A 3PLBA 2BDYA 1C5QA 2FWWA 3ZVDA 4IMZA 2V35A 2P28B 1F0RA 1JIRA 2A5IA 1ATBA 1ZSLA 1FSBA 2ZHQH 4IS5A 4AFUA 1EAXA 4D0EA 2SNWA 2P95L 3QO6A 1BRUP 2HNTF 2R3YA 3SI4H 4U2WA 2VNTA 1FAKL 1AO5A 2C8WB 1GI6A 1O32A 4J2YB 5EODA 4D8NA 1S6LA 5JDUB 2EI7A 2OYEP 3RU4E 4B2BA 1DXPA 1H8IH 3QDZB 3MO6A 1T8MA 2L6OA 1Y5UT 1YKTA 3U73A 1WAYB 5DP9A 4H42U 1GI3A 1AKSA 2W3IA 3T25A 2FOFA 3EE0B 3IWMA 3T26A 2BT7A 3LC5B 2KR7A 1W7XL 1HX2A 4NGAL 1HPGA 4WXIA 4X8TH 2OP9A 1YUFA 4VGCC 1A1RA 1A2CH 3O8CA 4JZDH 3CS7A 2A4QA 3ZVBA 2PHBB 3N8WA 4ISIH 2JJLA 4INLA 1SGEE 4LXBH 4MNYA 4MQAA 3U8OH 4Y76B 1IAUA 1O2HA 3EA9A 1TBQH 3RMLH 1F5RA 3MH6A 4AG1A 1GJBB 3LAQA 1ARBA 1C2LA 4I86A 4MDSA 2LNCA 3SV6A 1VR1H 4NA8A 4LORA 4LZ1H 2BQ6A 2BZ6H 4I8LA 2IPHA 1WHEA 2ZHEH 1EJMA 4NG9L 1IQGL 3EE7A 4X8VH 3LC3B 4DGJA 1CBWC 1RFNA 1EB2A 4M9FA 5EPYA 2TGPZ 2R2MB 3M5MA 4Q7XA 3OEHD 1P0SL 1NBME 2GP9B 2LPRA 3KYGA 1DWCH 1AB9B 3MO9A 1P2IA 1TGNA 3LJOA 4Y0ZE 1ABIH 3DFJA 3ELAL 2Y7XA 3ZZ4A 1G30B 1CO7E 2BX4A 3F9EA 1YLNA 3NTGA 2H9EL 1FY3A 2GZ8A 1G32B 2SGFE 3KK6A 3ZVGA 3SU5A 3V0XA 2YMSC 1RJXB 3SBKA 4FUGA 5A0CA 4NFEA 1GJCB 1PQAA 1IGZA 2P16A 1W12U 3TH4H 3URDA 1B7XB 3EAJA 3T62A 3GDSA 4Y7BB 1EZXC 1PRHA 1N6XA 3AW0A 2FLRH 4YZUB 2ZZUH 2VVUA 4TPIZ 1SGTA 2ODQA 3OSYA 3SOBB 2WPKE 4FUCA 4RRZA 5JB9S 2HNTC 3RXHA 4ZXYH 1GGDB 4TWYA 2WPME 2OQUA 4GPGA 3M37L 2W3KB 1Y59T 3Q77A 1XKAL 1F0UA 2EI6B 5B6LA 1IQJL 3F3BA 8GCHF 3RXQA 2KM0A 3UR9A 1O3BA 1RIWB 1BTZA 1CU1A 1QQ4A 7GCHG 2WFXB 1Z71A 3CS0A 3OAAD 2XBXA 2GTBA 2ODPA 1O3AA 1XXFA 4DCDA 1IVOC 1GG6B 1C1OA 2VIOA 1P11E 3TITA 3QZRA 5GPIB 2W5EA 4UFEH 5L30H 3PRDA 3N7EA 1LK9A 1YPHE 1C5RA 3N7DA 1UVOA 2PKAA 2GZ9A 2VGCC 2HOBA 3RMNH 1HAFA 1WU1A 1A5GH 5GWZA 3VGCB 5FX5A 4ASHA 1QBNA 1EMOA 2H5CA 1AU8A 4Q7YA 5C2ZA 3SNCA 1XX9A 2HOXA 1BTXA 1HXFH 3M5OA 1V6DA 1GBIA 3M36L 1EJNA 3F6UL 2AMDA 4HG6A 2A32A 1F7MA 1O2JA 4GCHG 2Y80A 1QTFA 3PMBB 3PWCA 1UHBA 4H6SB 1G1RA 1GBLA 3SGQE 1UK3A 1PFXC 4MVNA 4XL1A 5AFYH 2J98A 1ETTH 3VXFH 1PYTC 3N8YA 4BTUA 2RA3A 1HJAB 2AH4X 5JW1A 3UTUH 1C2EA 1O3NA 3V12A 2PTCE 1GBFA 1AMHA 1OWKA 1PQ5A 5A0BA 5C0TA 5TCCA 5CMXH 1E35B 1GBDA 2BY9X 4YT6H 2A4GA 4RRYA 1KLIL 3FP6E 1SLVB 1DQBA 5E8DA 3S7KB 1TMBH 3LN1A 3MQEA 1W0YH 3SOVA 2PWXA 1Q2WA 3M3VA 3BT2A 1OWDA 2XBYL 1VGCB 1QFKL 1AUTL 2A0QB 3LTGD 3V65B 4IN1A 2CJIA 1V3XA 4OTJA 1GVLA 1J16A 1URKA 2J38B 3ZV8A 5I46L 3GY8A 2Z9LA 1C2IA 3GY5A 3IJEB 3TJNA 4AQTA 2FYRA 2KFWA 4DW2U 1J15A 3U9AH 5DO4H 5EXLA 1GBEA 5F53A 2Y5HA 4K1SA 1O34A 4Y6DB 3ZYGA 2ZCLP 2WPKS 3TGJE 1LHEH 1UZJA 4AYYB 4O03A 3ZIAD 2CHAB 4UFGH 4HI3A
chains in the Genus database with same CATH topology
3FZDA 1DY8A 2MGRA 1SGIB 4KTCA 4E06H 3SV8A 2FS8A 1IP0A 2P59A 4K8BA 1C4Y2 2Y82A 1YCPK 1ID5H 1UTOA 3KCGL 1LTOA 4TGFA 1V2TT 1QB1A 4Y79A 4CRBA 6CHAC 1QGFA 1YUKB 2HPQH 4ZKSU 1CVWL 2EI8A 1FF7A 1V2PT 4YO9A 1GWAA 3NT1A 2JH5D 1L2EA 3PMHB 3TK6A 3KHVA 1BTUA 1HAIH 1O3LA 4LZ4B 2BM2A 4FUDA 1ZRKA 3A85A 3TVJB 1KSNA 3P70B 2ZU4A 1RS0A 4B75A 1WHFA 1LCYA 4ZXXL 1AVGH 1DUEA 4U30A 2PV9B 1LPGB 1PPGE 5HMAA 5A8YA 1O39A 3HO3A 1GCTC 2R2WU 1Z6CA 2F9BL 1L1NA 7GCHF 3RXOA 5A09A 1ETRH 3MYWA 1UTLM 3K6YA 3KGPA 1HAGE 2BHGA 2Y5FL 4JK5A 1HAVA 5DGJA 4FUHA 4YOIA 1F5LA 1NFYB 4NA9L 1HAYB 2F3CE 4FUFA 1HDTH 2ZPSA 1MD7A 4IC6A 3W95A 2VWOL 3VB7A 3RUOA 3TJUA 1JXPA 3OY5U 3SOSA 3O8BA 4A1XA 4CRAA 4O1ZA 2J95B 1HT8A 1XFEA 2J9NA 2ZU2A 1UCYK 3ODFA 3BG4B 7KMEH 1IHSH 2W2PE 2H1UA 1ELEE 1NRQH 4YTAA 5LGOA 1P12E 2R0LA 2GGVB 1ARCA 1S6FA 2Z9IA 3SORA 1UVTH 3RM0H 1KTSB 1BOQA 3QH0A 2A7JA 1EJAA 4GCHF 1LO6A 1BTWA 1HIAB 3EA7A 4YLQH 1THSH 3B23B 3LGYA 1VZQH 1BMMH 1DWDH 2ZPQA 4ZROA 1H9LB 5ESBA 1QBOA 1TNHA 4CH8B 1GJ7B 5C67A 2JH0D 4YT7L 3ESTA 2OLGA 1TOZA 2W86A 3GY3A 3Q3XA 1C4V2 3L33A 1F0SA 1K1MA 1FAXL 2ZFPH 1LHCH 4X8UH 4F49A 2TGDA 4CR9A 3HK3B 2P3TB 4ABGA 2UWPA 3UOPA 3PROA 2CGAA 3VB6A 1O5GH 4E1GA 2TRMA 1JV2B 1DOJA 1IOXA 1SG8B 1KLTA 4ZH8B 1MBMA 1TNKA 1IQFA 3FAOA 2K2SB 3MMGA 4H4FA 4JYUH 1K22H 4MPWA 1CX2A 2SGQE 2PKSC 2GT8A 4I8JA 2ZNKH 3QK1A 1GBTA 3I78A 3ATKA 4RS0A 1IQNL 3FANA 2B7DL 1K1LA 3BTEE 1GDNA 5A2MH 1L1JA 1ELTA 1TNIA 3A8CA 2GCTB 1Y5AT 1P2JA 2CV3A 2WPJE 5COXA 2G51A 5EGMB 5GXPA 2J34A 1KDQA 4MTBA 3TK5B 1DSTA 4NWLA 1AGJA 4ESTE 2VH6A 3BIVH 3SI3H 3QUMP 4TYDA 1Y3UA 1LPZB 3LN0A 2AMPA 1W10U 3RP2A 2CF9H 2JETB 1GVZA 1DANH 1K1JA 2GT7A 4X2VA 1VCPA 2H2ZA 4NWKA 1G9IE 2UWLB 3PYHA 2ZFQH 2P93L 5JPMH 4Y7AB 2ZHFH