4BXWA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
322
structure length
286
Chain Sequence
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
molecule keywords FACTOR XA
total genus 69
structure length 286
sequence length 322
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxwA02
1W13U 1XKAC 3RXJA 1Y5AT 3NK8A 2A4OA 1NTPA 3IWMA 3S9AA 1F7MA 1GGDB 4FU8A 5GDSH 2VWOL 2WPMS 1ZRBA 4JMYA 1E37B 8GCHF 1P10A 2OLGA 2FTLE 4CUDA 2AGEX 1QB1A 1C4V2 2G8TA 4E7NA 1CQQA 1W8BH 4I8KA 5HYOA 1GVZA 1A4WH 1QBOA 3P8NA 1SGTA 1FAXL 1LHEH 2F9PA 2ALPA 2BOKA 3RXBA 2XBWL 1UTJA 1GDNA 3LOXA 1AUTC 1RD3B 4NIXA 1JIRA 1TFXA 1GJ5H 4MMXB 2G81E 2A2XH 4CH8B 1G1TA 4X1RU 1ZTLA 1F5LA 2SGAA 4B2CA 1IJQA 1G1RA 2BD7A 2IPHA 2SGFE 1FNIA 2Z9IA 5FPYA 1C4U2 1YO8A 1PPCE 2WPKS 3DA9B 5AVDA 4K8BA 1GBMA 1DUAA 1ELDE 2GCTB 1IQLL 2PR3B 3LKWA 5IYTA 3LGWA 1O5FH 1C2GA 1SGEE 3PWBA 5ESBA 1OP2A 1SL3A 4Y0YE 2STBE 1WOFA 5BRRE 1E0FD 2VVUA 5E8EH 1CA0B 7KMEH 2BD9A 3RXQA 1KLTA 1UMAH 2OBOA 4BTUA 1Z71A 2O9QA 2P8OC 2J34A 2OC0A 2ZC9H 2OQUA 4NIYA 4ZXXH 5DP9A 1C1MA 1GJ4H 5C1YA 2FLRL 2FOEA 1TQ7B 1TX8A 5COXA 1GJ7B 3ZZ7A 2ASUB 2A5AA 1ZAQA 2C8YB 1A0LA 1SGNE 1A1RA 3MWIU 2NU1E 1VJ9U 2EC9H 1NN6A 3T5FH 1YPMH 3SORA 1GVLA 2PUQL 4D0FA 1ZYOA 3CS0A 4ISLA 4OS6A 4RSPA 1P9SA 4A7IB 1YPHE 1TA6A 4ISIH 5EXMA 1GMCG 1PFXL 3FZDA 4Z0KA 1T31A 1H9IE 3A88A 5A0CA 3MU5A 4GAWA 4MPWA 4YT6H 1TMBH 3SOVA 2VH0B 2UUFB 3RC4A 3FP7E 1BZXE 2QC2A 4Q2KA 4WJG2 3LC3B 2A7CA 3F9EA 4A1XA 3POYA 3F6UH 4MNVA 1O3KA 5A8ZA 1CU1A 2WPLS 1SQTA 4H42U 4JCNA 5A2MH 2GD4B 2FP7B 2CXVA 1XXDA 3AW1A 2WYGA 1NY22 2DE9A 4K69A 2Y5HA 1P2IA 3A7VA 2ZP0H 2D2DA 2FOGA 1ZJKA 3SV6A 4FM5A 1GCTC 3FP8E 1UO6A 3GOVB 3CENL 1UCYE 4ABFA 4A7IA 1EPHA 1GBCA 2CV3A 4DG4A 1ADXA 2ZKSA 1TRMA 4H4FA 3KQEL 1K1PA 2ZHWH 1B9WA 4THNH 1TGNA 1C1VH 3DT0H 2ZGJA 3ZVCA 3I77A 2A0QB 3RXTA 2VIQA 1IOEA 1NRNH 1O2PA 3MU1A 1O5AB 3H7TA 1V2VT 3QX5H 4DCDA 1TPGA 1LVMA 3E1XB 4MPVA 3EGKH 2AMPA 5GCHG 1TONA 1EOLA 3Q3YA 3LGIA 1GPZA 1HBTH 1O3PB 1Z1JA 4K60A 2H9TH 3HGPA 1L1JA 1WCZA 1S82A 4NCYA 3FBYA 1G3BA 3BEUA 4JYVH 3PLPA 3TU7H 1MU8B 2ZWLH 1FY5A 3DEMA 1C2HA 1FIWA 3KCGL 2XWAA 1GI5A 1MH0A 3MU0A 2ZGXH 3TITA 2OYUP 1C1SA 1C5VA 2BVXH 2ZDLA 4I32A 1Z6EA 1S84A 5L30L 4XBCA 1O2VA 3GICB 3ZZBA 2R0LA 2PHBB 2G4UA 3K6ZA 1PXXA 3LTFB 1P05A 3QDZB 1SMFE 2XTTB 1THPB 2VB0A 2ZHEH 2P3FH 4Q7ZA 1EAIC 4U2WA 2F9VA 4ISOA 1V2NT 3NCLA 3V65B 3NZIA 2J2UB 1C5MD 3ELAL 1P2JA 1TNKA 3SOSA 1SLXB 1BTWA 2BD3A 2GX4A 5DP3A 2RA0A 2JETB 3DFJA 1MTWA 1P09A 2Y7XB 1LHFH 3V7TA 2BXTH 1ZGVA 3ZZDA 3F68H 3N8WA 1IGZA 2F9BL 2QF0A 3M36L 1LPZB 1O33A 1O2LA 2C8WB 1MKXH 1HCGB 2VIWA 1HAVA 1ACBE 5CKNA 1EZXC 2HPQH 2B9LA 2Z3EA 2ZCKP 1SVPA 1PPHE 4I8GA 3UFAA 1K1MA 2QXJA 2GCHG 1A5IA 1K28D 4M7GA 1W10U 1DVAL 3URDA 4AN7A 1AI8H 1LO6A 1O3LA 2QY0B 3KQDA 1X7AC 4GHQA 1ZPBA 2FM2A 3A7TA 1A3EH 8LPRA 2BLOA 2W2QE 1GMDG 1RS0A 2GTBA 1O39A 1T8LA 1UTPA 2UWLA 1WBGB 5GPIB 1TQ0B 3UQOA 1PPEE 2QXGA 2P16L 1XUHA 2O8WA 3BTQE 4BTTA 1HAYB 1W7XL 2UWOA 2RNLA 4YOIA 2BOHA 1CVWL 4XBMA 1YPKH 4BXWA 3ENSB 1T8NA 2C3SA 4Y7AA 1FXYA 4VGCC 3PV4A 3TGKE 3TGIE 3BEFB 3FFGL 2K2SB 1A3BH 1SGIB 3P8FA 1IQJA 5L2ZL 4OS2A 5L2YH 3M5OA 1ARCA 2EI8B 1QRXA 3GY8A 8KME2 4UE7H 4X0WU 1K21H 1CBWB 1L4DA 2BDGA 4B1TA 3RXAA 2I6QA 3LIWA 3CS7A 1KXEA 2P3TA 1DLEA 1RTLA 3UR6A 1G32B 4LOYH 1QL8A 1MZDA 5EW1H 4GUXA 2VIDA 4KTUA 3LT3A 3RMNH 1V2RT 3VB6A 4LMFA 2H9EL 2NU4E 1UZKA 1OWJA 3M3TA 3KRKA 4JYTA 2KAIB 2F3CE 1EZUC 4AFUA 2V3HH 2Y7ZA 3MQEA 4F49A 2O8UA 2VVVA 3V64C 1G2LB 5DGJA 1S81A 4CH2B 3VB4A 4YLUA 1ANDA 2Y7ZB 1DUEA 4GCHG 3MDLA 1NFUB 1YCPH 3F6UL 2FOCA 2QCYA 4U30A 1O3AA 7GCHF 4COXA 1ZZZA 4KTSA 3NTGA 4XLWA 2AFQB 1O3MA 1HJ9A 1ABIH 1QNJA 1ZLRA 2R0KA 3Q7DA 1HZ8A 4INKA 1ZOMA 1EBVA 1Q3XA 3HS7A 1JMOH 4MLFB 1Y8TA 3VXFH 4ABEA 1O30A 3LIWB 1UVPA 2BD8A 5JBBE 4X8UH 2OBQA 3F9HA 3RLYH 4BAHB 2WPIS 1O2UA 4YOJA 1GJDB 1LQDB 2O8MA 4Y8XA 5FHTA 1EB1H 1D6WA 4AB9A 4AYYB 2XNIA 2Y5HL 4OS5A 4YTAA 1SLUB 4NA8A 1IQKL 5DG6A 4YT7L 4CUEA 3M5NA 1GDUA 4M11A 2P95A 2FOBA 3A83A 2H1UA 5EW2H 1BT7A 3U69H 1P12E 3MH7A 3GYMA 1AU8A 3SHAH 1UVUH 1ZR0A 5EODA 3SNBA 4K1TA 4ZHAA 3ZZ4A 2D1JA 5A8YA 3A86A 3DFLA 1FONA 3A8DA 4ZUHA 2BOXA 5FXLA 3A80A 4ABJA 1QURH 2XC5L 3PWCA 1ATEA 3OX7U 3D62A 1V3XA 2EEKA 2PFEA 3N8YA 2JH0D 1FQ3A 3S9CA 1E35B 1JWTA 4BTIA 1F7EA 5EQQA 1EPJA 1B7XB 1ESAA 2A31A 5AFYH 4CBNA 1F92A 5C5NA 3TGFA 1C5RA 4ASHA 1DWBH 3F9FA 5FCRA 5FPSA 1MBQA 4YLQH 1QBNA 3BIUH 2ZO3H 3A81A 1HAVB 3N8ZA 5EXNA 2HWLB 1UTOA 2GZ7A 1PFXC 1GBBA 4XL1A 2V0BA 1MQ5L 1TNLA 2PWXA 3UWIA 3U8RH 1SGDE 3RXUA 1G2LA 3VB3A 5JBAE 1EJMA 1GBHA 2WPLE 4ISIL 3D49H 2BZAA 1C5XB 3SV8A 3T26A 4IS5A 2HRVA 5ETXA 1FI8A 1DX5I 1RIWB 3RMLH 4ABGA 3NPSA 1GL1A 1T4VH 2ADXA 3RXRA 1ZSKA 1HJAC 1YUGA 1A46H 2P3FL 4Y76B 3ATMA 5TCCA 3L6PA 3SJOA 5L2YL 1G36A 3HK3B 1O3FA 2HNTE 1OYTH 5HM2A 5C3NA 1O5DL 2P3TB 1S83A 2EI6B 4IMQA 2BOKL 1RFNA 3RXGA 4E1GA 1DXPA 2ZFFH 1GGDC 3MNBA 3T27A 4NIWA 5DJ7A 1UK3A 1XUKA 1FV9A 2XRCA 2CJIB 2A5KA 1GK5A 2C4FH 2IN2A 1A0HB 3MI4A 3P70B 4E7RG 5CKQA 1P2MA 4Y8YA 1EATA 1NU7B 1MCTA 2YNBA 2QGRA 4AFQA 5EQRA 4GHTA 2CMYA 1EJNA 4O03A 3ZZCA 4ZKNU 1O36A 1OP8A 5EPYA 2PV9B 4X6NA 2BDAA 2FD6A 3ENSA 2AYLA 1OPHB 3SBKA 5CE1A 4ZH8B 1Z1IA 2JH5D 4KKDA 1EMNA 3ZVBA 1DDJA 1QJ1B 2TPIZ 3A7ZA 2SGEE 2SNWA 1TRYA 1IHSH 1RXPA 3NWUA 1O5GH 4BOHA 5A0BA 1O2JA 1GBJA 1ZPZA 2GCTC 1F0RA 1BQYA 5T3HA 3K2UA 2P94L 1UVOA 1BMMH 3C1KA 4O97A 3ZYDA 2ILNA 2BXUH 1ATAA 1VITG 5HM9A 2G00A 1EPTC 1LVOA 4OTYA 4I7YH 3P17H 1CA0C 4D9QA 3PLKA 5F1AA 4JZIA 1KDQB 1P02A 4MVNA 1AN1E 4TWYA 1V2MT 2ZU4A 2H2ZA 4X2YA 4B76A 3LH3A 3RXLA 3KQBA 4WVPE 2WYGB 3MHWU 3KQBL 1WSSH 1O3NA 3UR9A 2BQ6B 3IG6B 4LORA 1O37A 1YF4A 1LPGB 1HCGA 3QTVH 2NU0E 3E8LA 1FY4A 1FLEE 1O2NA 2FLRH 4UFGH 3M5MA 2ZFRH 2P94A 2F9NA 2AH4X 1IOEL 3TJUA 1W7GH 1D3TB 2ZDNA 5DP8A 2Y81B 2HNTC 1TOCB 2XWBI 3O8BA 4TYDA 1O34A 3HATH 5EPNA 3ELAH 2Q6GA 1NFWB 4AG2A 1GJ6A 2WV5A 3ATLA 2FOHA 3RXPA 9ESTA 3UIRA 3ATIA 2ZECA 2K1QA 3ZVEA 5GWZA 1IP0A 2WUCA 1GHBG 3LGTA 4YM9A 2XBYL 5JB8E 1ESTA 1QBVH 1TLEA 1K9OE 3RXKA 1DOJA 2XBXA 3M61U 1CT0E 1AVWA 1PYTD 1V2LT 1AKSA 1ELGA 2A4GA 3M35A 3FANA 1COUA 3RR3A 2PUXB 1TNJA 1NC6A 1ZMJA 3SI4H 1QFKH 4K5ZA 1C1PA 3RC6A 1N1LA 3RU4E 1H8DH 2PR3A 2SGPE 2UUKB 1FDPA 1Z6JH 3R05A 1GCTB 1Z7KA 3U1IB 1J8AA 3SU6A 3VGCB 2CHAC 4MPXA 3STIA 4DIHH 1H4WA 3PMBB 1W12U 2FPZA 3GY7A 1A2CH 2CN0H 3OTJE 1IQFL 1QL9A 4CREA 3GDSA 1B5GH 1MTVA 4DT7B 4X8TH 3SJ9A 3AAVA 1YUFA 2B7DL 1BRAA 1EKBB 3EQ0H 1SC8U 5J4QA 2XCNA 1Z6CA 1FPCH 1TGSZ 2HLCA 1THRH 4JK6A 6GCHF 2PSYA 1GG6B 4X6MA 3A7XA 3P8OA 1ETTH 1O3BA 2ANWA 1O2GH 1IGXA 1XDTR 2F91A 1Y3XA 1CE5A 2ANMH 3SU4A 1Z8GA 1SGRE 2VWNA 1J16A 1O5EH 1CVUA 1IOXA 4H6SB 2VVUL 1BRBE 3MMGA 2FODA 1PQ7A 4X8VL 1KLJH 2RA0L 2Z94A 1UTLM 4LZ4B 4MNXA 5JBAS 1X7AL 2P59A 1LVBA 4RRXA 4KELA 1IQNA 1SLWB 4ABBA 1TNGA 1LPKA 1SB1H 3ATKA 1SGCA 5JVZA 3URCA 3QUMP 3DD2H 3HO5A 1G1QA 2BY8X 3D65E 2MGRA 1PJPA 1SZBA 1N1IA 3QH0A 1K1LA 1TYNA 5BPEA 2GDEH 2GV7A 2NU3E 2Y6TA 1IQEL 1XUIA 1V2ST 4ZROA 4FUEA 4MMYB 1Z8IB 4PH9A 4MNYA 3SW2B 4HGCA 2FZZL 3E16B 5JB9S 1W8BL 4O1ZA 2PKSC 1FAXA 3QTOH 1LHGH 1GMHF 1XVMA 3ZVFA 2BLQA 2BD2A 1D9IA 5JBBS 2FLBH 4JZEL 1DSUA 1HAIH 2GMTB 1O2YA 1YGCL 4Z0LA 1RRKA 1P06A 1YYY1 2OYEP 1MBMA 3A87A 4INLA 4WY3A 2W3KA 4RRYA 2Y5FL 2Z3DA 3SJ8A 3LC5B 2ZEBA 3OY6U 5C20A 1T4UH 1ZHPA 3ODDA 1BTXA 3UREA 1DVAH 2FOAA 1AY6H 1P0SL 1AIXH 2Y80B 1HAOH 3HPTA 2Y5GL 1S0QA 4X6PA 3FVFB 3RXCA 1BA8B 1VR1H 3RUOA 1V2UT 1O2TA 3ZYJB 1C2KA 1EAUA 1SQAA 3E3TA 1YP9A 3WY8A 3GCHC 1VJAU 4NGAL 1EPTA 1TBZH 1NQLB 4ZAEA 2VWLA 5E0JA 3SUEA 1HJ7A 1ID5H 1NPMA 3E91A 2H6MA 3RU4D 1DT2A 4TGFA 1BHXF 1HAXB 1S6HA 1MCVA 2QN5T 2FYQA 3H7OA 4CRDA 1J9CH 2R3UA 4Y11E 1TGTA 4FUJA 2YGPA 1BJVA 1F0SB 1EP6A 1NFWA 2P3UA 5JDUB 4B75A 2ZQ1A 1CCVA 1DQBA 4NFFA 2FLGA 2WG4B 2ZHQH 4XSKU 4D8NA 5CKMA 1O31A 2XW9A 3BTWE 3TJOA 5K0HB 3QCWA 2ZPSA 2HGTH 2VJ1A 3SO3A 1QQUA 2BDCA 1UCYK 1AWFH 1EAWA 3UQVA 2PKAA 4OTJA 1L0ZA 1BF9A 2ZU2A 2BY5X 5E0HA 1OKXA 4WH8A 1EAXA 1GMHG 1XKAL 4BAKB 1INCA 2ZG0H 1U6QA 2F9BH 4CUFA 4NA9L 4D7FA 1P2NA 1NRQH 1FZZA 1CBWC 1GBEA 3W95A 1HAFA 3TK6B 1GCDA 2BDYA 1F5KU 1JRSA 2C8ZB 3E90B 5JW1A 2EI7B 3FAOA 4UEHH 5EGMB 1HUTH 1TOMH 1QTFA 4RN6A 4GPGA 2H5CA 2SGQE 2B0FA 1O3EA 3M37L 1ETRH 3P6ZB 1C5WB 3MOCA 3SV2H 4JZEH 2A32A 3VXEH 2XBVL 2GVFA 3I29A 1UZPA 4FVBA 4OS7A 4GSOA 1ELFA 1BBRH 3SV9A 3RDZA 1O2MA 4PROA 1GI7B 1EZQB 2VWMA 4ZHAB 2FWWA 4XBBA 1FE2A 2OCVB 4CR9A 5KN5C 2UWPA 5CHAB 1H1BA 3S0NA 3SN8A 1IQMA 3EA7A 4U32A 1O2KA 4TY6A 1KY9A 1WU1B 5T6DA 2J9NA 5DP6A 2OXSA 3HK6B 3R0FA 3TH3H 3CA7A 1MTSA 1Y59T 1IQFA 1C2DA 1Y3WA 2R2WU 2AGIX 2AEIH 2FO9A 5DKMA 1UHBB 5C2ZA 3QGNB 1GHYH 4A92A 3T2NA 1WQVH 3U73A 1GHBF 2RHPA 1C2LA 1TPPA 3KL6A 1GMDF 4ZXXL 3Q00A 1IQML 3TK5B 1SOTA 2ZGCA 1YPHC 1P01A 1GMCF 2WFXB 5G4BA 2VWOA 4DURA 2Y82B 1HAEA 1IAUA 2BMGB 2XC0L 1FY3A 1T8OA 1UVTH 3B23B 4UFFH 2Y38A 1GBIA 2QV1A 4Y7BA 1HFDA 2BDHA 3M37A 2PTCE 1BDAA 1JBUL 4Z6AL 1GBAA 1WTHD 2VVCK 1GJ9B 2W3IB 1C2MA 3KNXA 2J4IB 2WYJB 3U8TH 1D3PB 3U8OH 1O2IA 1D4PB 3HKIB 3U1JB 1GI8B 1KLJL 5CISA 1LVYA 4X8VH 2K2TA 3PMAB 2KAIA 2H5DA 1O2ZA 2VJ3A 1CT2E 5FBEA 4D0EA 3RLWH 1MTNC 2ZGHA 3QZQA 4AZ2B 2PGQB 1UK2A 4YT6L 1LCYA 2TIOA 1XFEA 5E8DA 2TRMA 4LZ1H 3FZZA 2VIPA 3K65B 1PPBH 4RUTA 2SFAA 4ZKSU 1GHAF 3BT1A 1TNHA 2J94A 2CHAB 3PO1C 1EPIA 5FPTA 2GZ9A 2P28B 4Y0ZE 1V6DA 2G5VA 3GISB 1CCFA 1EJAA 2M5TA 2QYIA 1KXFA 1ELAA 1NO9H 1OS8A 5GCHF 2BOUA 2GP9B 1MKWK 3KGPA 1CHOG 5EXLA 2M74A 2XC4A 2ZZUH 4JZDH 1GHZA 4ISHH 5F6MA 1SFQB 1C4Y2 3K9XA 2A7HA 5DPAA 1TGBA 1RGQA 2G52A 5FDQA 2PW8H 5SGAE 1SSXA 1K1NA 3RM2H 1KIGL 1KTTB 1EMOA 4TPIZ 1UJ1A 3TH2H 3SNAA 2ZDMA 1IQIL 1HX2A 1JBUH 1HRTH 3TIUA 4Z6AH 3A7WA 1C5PA 2FS9A 4Y71A 1VGCB 4XFQA 3QLPH 3KQCA 3SUDA 2BQ7B 1APQA 1P11E 4K1EA 4XE4A 1C5OH 2OUAA 5IKVA 1PRHA 3HS6A 2KL7A 1K1OA 1FPHH 2WPJE 1KLIL 1DE7H 4AGKA 1C1OA 4AGJA 2KV4A 3GYLB 3TK6A 3AAUA 4DIIH 1FN8A 5DP4A 4DVAU 1IQEA 4Y8ZA 3SQEE 3L3TA 3STJA 3H5CB 2R3YA 2A7JA 3SGQE 1GJCB 1LPZA 2V3OH 3UNSA 3N8VA 2FDAA 1QCPA 2F9UA 5LPEA 1GI4A 1P03A 2GCHF 2GV6A 4FUIA 4NA7A 1TOZA 3RMOH 2J4IA 3E6PH 4UONA 3GCXE 1FAKH 1B0FA 3Q76A 3M7UA 1RJXB 2Z9LA 1C5LH 1URKA 1CHOF 3EDXB 4U01A 1MQ5A 3T25A 4JYUH 4JK5A 3R3GB 3BTDE 1TIOA 4GVUA 5J4SA 4X8SL 4NWKA 2GDDA 2THFB 1OWEA 2BB4A 2UUJB 2WG3C 4CHAB 1U67A 2XCFA 1BRCE 1ATDA 1N6YA 3Q3XA 1TMTH 3BT2A 2W2NE 3GISX 5PTPA 3KL6B 4WXIA 3ZYEA 2O8TA 5AFZH 4FUGA 1L3YA 1HYLA 4O9VA 2EI8A 4TPYA 2W2ME 3SI3H 1CQEA 4YZUB 5B6OA 3BTFE 4Y79A 2BVRH 2XC5A 2ZFTA 3A8AA 3ESTA 3BTKE 1LKBA 2GZ8A 3S7KB 2ZDKA 3SNCA 9LPRA 3HPTB 1C1QA 4NG9L 1YCPK 1BTUA 1NZIA 3MO6A 1SPJA 2IOTA 1F0UA 1W2KH 1PGEA 1AB9B 2G55A 3MNSA 2ZPRA 5TJXA 6ESTA 1WU1A 1WTGH 3MYWA 2W3KB 2BO2A 2UUYA 1J17T 3A8CA 3KN2A 3A84A 3PB1E 1UTQA 3SZNA 1S5SA 2UWPB 1ELTA 1HRFA 1QB9A 2C8XB 1DY9A 1F0TA 1OOKB 1VCPA 2ZTYA 1ZSLA 1G1SA 1ZMNA 1P0SH 3S9BA 3SW2A 1HT8A 4JZ1A 3Q77A 5GIBA 4BXSA 1EAIA 2W7UA 3ZV8A 4ZKRU 1L2EA 2XBXL 3KIDU 5JVYA 4X8SH 3BTTE 3UUZA 3BSQA 4CRCA 2XBYA 1C5TA 2J95B 5EOKA 1GVKB 3MO9A 2ZA5A 1I0UA 2VWLL 2ODYB 2QXIA 3RP2A 5TCAA 4KGAA 4D7GA 1Q4GA 4Y79B 1GI1A 1IVOC 4YZUA 1LTOA 2I9BA 3SJIA 7GCHG 3ZYGA 3SV7A 3TBDA 2HALA 2BZ6L 3LJOA 2Q6FA 2ESTE 2P8OB 1QJ7B 3RXFA 3U98H 1ZRKA 1O3DA 4BNRA 1HPGA 3QN7A 5JB8S 1CO7E 3RC5A 1SHHB 2XC4L 3N8WB 4X6OA 1ZTKA 3BF6H 1V2KT 4ABIA 1AZ8A 2AIPA 1T32A 5EG4A 4KP0A 5K0HA 2Y5FA 1QRZA 4B2AA 3BTEE 2ZPQA 4IN1A 1GJBB 2WV4A 5T6GA 2P3UB 1WHFA 1F0SA 1N8OC 3BG8A 4AQTA 3N7OA 3LONA 5L6NH 1JXPA 1FFMA 2ZDVH 4UFEH 2PTNA 2ZU3A 1OB1C 2J34B 4AFZA 1BHXB 1SQOA 2FX6A 1C9TA 4BTUB 5GXPA 2G5NA 1NRPH 1G3EA 1LMJA 3SNDA 5JBTA 4AG1A 3LTGD 5C1XA 2QA9E 4B71A 5GJ4B 3S69A 1UZQA 1UZJA 3CS7L 3PYHA 1D3QB 1O3HA 2OD3B 4O3TA 3UNRA 1RIWC 2FMJA 3DHKH 2P26A 1UK4A 1PYTC 3NJPC 5CHAC 5E2PA 1IQNL 1HDTH 1GJ8B 1FUJA 1HJAB 1T8MA 3BV9B 1MQ6L 1AGJA 1MU6B 4IC6A 1AKSB 1AB9C 2BX4A 1EQ9A 3TK9A 1AFEH 1VCWA 1ZHRA 3GDUA 3ZVAA 5LH8A 2WPKE 2XC0A 2BD5A 4B2BA 1BBRE 2B5TB 3SU3A 2BQ7A 1YGCH 1ELBA 1HXEH 3LPRA 1G37A 1O32A 4MTBA 4OGXA 4KTCA 3TVJB 2CF9H 3GCTF 1Q31A 2VU8E 3CP7A 1ZGIA 4ZHLU 4MPUA 1XMNB 2NPRA 2BDIA 3SGBE 1MTNB 1FMGA 3F1SB 3BIVH 1EQGA 1UTMA 2OC7A 4IW4E 1GI2A 4MMZB 1ELEE 3BPSE 2FS8A 2LPRA 2R2MB 3ZVGA 1HAHH 1GBTA 1NZQH 1A7SA 1C2EA 1DWDH 4I31A 3RU4T 2A4QA 3MH6A 1GBFA 4OS1A 3K9XB 2VGCC 1TWXB 3HS5A 3NXPA 1BMLA 1IQGA 4IMZA 1V2TT 2BZ6H 5FX6A 1GBKA 4NIVA 1B0EA 4FUHA 1P8VC 3GCOA 2WFTA 2ZFQH 1ABJH 2TGDA 4CR5A 3TGJE 2BQ6A 2TGPZ 3MH4A 4RKOB 1C2JA 2VINA 1BBRK 1EP5A 2GMTC 3MNCA 4BDWA 1C1WH 2TGTA 8GCHG 3A8BA 3ASIA 4NWLA 4JYUL 1DXWA 1DWEH 1BOQA 1P04A 1KDQA 4I33A 3Q3KA 1EZSC 2BY6X 4BAMB 3RXDA 1ESBA 2VH0A 2JKHL 3TLOA 5IDKA 5LPFA 2WPME 1GHXH 3ZZAA 1QA7A 1ZJDA 1KLOA 2VVCA 5A09A 1O3GA 1YUKB 3K6YA 2XBVA 2BDBA 4MNWA 1GJAB 2GKVE 3ZV9A 1F0RB 1HIAA 3BTHE 1GI9B 1PTHA 1MAYA 4OS4A 3UNQA 2J38A 4CRFA 3KK6A 1NFYA 1MQ6A 1OYQA 2GT8A 1FIZA 2ZIQH 3KEEA 3TH4H 2FI5E 1CT4E 1DPOA 4HTCH 4RRZA 1J14A 3PGHA 2TGAA 6LPRA 2Q1JB 1C2FA 3UOPA 1VCQA 1V2JT 1P2QA 1NM6A 4DOQA 1P9UA 3B9FH 4IBLH 3N8XA 2R9PA 3ZZ8A 1CA8B 1DSTA 3V0XA 1XUFA 4R0IA 1FJSA 1EQHA 3FCSB 1DDXA 4NSYA 3SOBB 4CRGA 1HAPH 3ZVDA 3SOQA 2P95L 1YPGH 1OX1A 1S85A 2D26C 1Y3YA 2AMDA 3SGAE 3AASA 4D90A 1C5MF 1IQKA 1YC0A 1XUJA 2ZFPH 3GY3A 1Y5BT 6GCHG 1K36A 4X1PU 4Y10E 3LDXH 1NROH 1QL7A 1BITA 2DDUA 1C1UH 1V2OT 1JL9A 1RTKA 2Q1JA 3BN9A 1O2QA 2WPJS 4HI3A 4X1NU 5IKTA 1V2WT 3NT1A 3A7YA 3KCGH 4HZHA 5EQSA 2Z9KA 1P2KA 1L1NA 1APOA 3SU1A 1H9HE 4WH6A 3BEIB 3LGUA 3M5LA 4UDWH 1C9PA 3SNEA 2LNCA 4K3JA 1AD8H 1HIAB 1EPGA 1SGFG 3P92A 1PPFE 3PMJA 2IJOB 1IQHA 1BRUP 5F03A 2PUQH 2CGAA 1WAYB 4X1SU 3TZIA 3RM0H 3TNSA 2V6NA 3VB7A 2KB9A 1KXCA 4AX9H 1RTFB 4ABDA 2VVVL 2BY9X 1C5NH 5HGGA 3RXIA 3IITB 3BG4B 2EI7A 1BTHH 2FZZA 1FJSL 4Y71B 1ZTJA 4A6LA 2PSXA 3KHVA 4A1TA 1SLVB 1KSNA 3MU4A 5HMAA 5E0GA 2V35A 1HV7A 1BUIA 1O3OA 4GCHF 2C93B 3SHCH 1G2MA 5IKQA 1CVWH 3LN1A 3RXSA 1MKXK 3PTNA 1XKBC 2PLXA 1AHTH 1GL0E 5KIRA 2PKAB 3AW0A 3O8RA 4X2WA 1XX9A 4ZH8A 4BDXA 1AFQC 2STAE 1H8IH 1A61H 1DLKB 3OYPA 4X2VA 1BJUA 1FAKL 1NFXA 4ABHA 1C1RA 4XDEA 2VH6A 5F19A 1C1TA 3SU0A 1W3CA 2H9HA 3UY9A 5IKRA 1F5RA 2PKSB 3SUFA 1LQDA 2W2OE 4H6TA 1OWKA 1AUTL 1ZSJA 3P8GA 3D23A 4FUFA 3FFGA 3GY4A 5FAHA 4X8TL 4C16A 1CHGA 4B74A 1J9CL 2ALVA 1VGCC 1C1NA 3FP6E 4FVDA 4O02B 3EE0B 4FUBA 4BANB 2BD4A 1C2IA 2ZGBH 1FF7A 1RFNB 6COXA 5DO4H 1EPTB 4NG9H 3HO3A 1N7DA 1O2SA 1L5GB 5A8XA 1IHTH 4SGBE 5JYIA 4CSYA 2P16A 3T29A 1V2QT 2FIRH 3C9AC 2G4TA 1H9LB 1KXAA 2A1DB 1A0JA 4FXGH 1HREA 1YKTA 1A5GH 2AYWA 4SGAE 3M7TA 2BQWB 1IQGL 2ZQ2A 5F8TA 3SQHE 1MTUA 2WUBA 2Y80A 4D9RA 5DP5A 1TB6H 2WPIE 1MUEB 4K2YA 1NFUA 2XBWA 2AIQA 2F9OA 2AS9A 1QA0A 4ZHMU 1U8CB 3CFWA 1DWCH 1OWIA 3TJVA 1SGPE 1AVGH 1D3DB 1JOUB 4JYVL 3QO6A 3W94A 2RDLA 5K7RA 5E2OA 4MDSA 2A5IA 3PROA 1BTYA 1A3PA 1IQHL 1LKAA 1CGHA 3G01A 1TX6A 1VZQH 1XUGA 3V3MA 1E34B 2ZHFH 1AFQB 5HXFA 1KXDA 5C1UA 1IQIA 5LPRA 2JETC 1O2WA 1S0RA 1YCPM 3M7QA 2BY7X 3VGCC 2Q6DA 1LHDH 3Q3KB 1XKBA 2FOFA 2ZCLP 3QGJA 4X2XA 2H9EH 3JZ2B 2FI3E 3OY5U 1ELVA 2DUCA 2QIQA 1VITH 4RKJB 3GCTG 1EOJA 2ZI2H 2A2QH 4Y6DB 1GHVH 1K1IA 4ZXYH 4D76A 2GGVB 1SBWA 2HNTF 3L33A 1Z6EL 1QY6A 1TE0A 4WMEA 1G9IE 2QXHA 1BMAA 3GDVA 5JPMH 2ZTXA 4YT7H 2MGPA 4WMDA 4F4OC 1XVOA 5C5OA 2ZFSA 4ZKOU 4QT8C 1K2I1 2ZHDA 1FSBA 1ANCA 1EZQA 3ODFA 1TAWA 4DGJA 2UWLB 1G3DA 1L1GA 2G00L 1NU9A 1CGJE 2PGBB 3LGYA 3LH1A 2A45B 4CRBA 1W7XH 3MU8A 1DICA 5ABWA 2FLBL 1DANH 5FCKA 3VPKA 2VIOA 4I8LA 2YNAA 1AUJA 4VGCB 3VFEA 4TWWA 3NUMA 3MO3A 5JBCE 3RMMH 1Y3VA 3KQEA 1K22H 1YPEH 2W86A 1TNIA 2OTVA 1DIYA 2RCEA 1HNEE 2FX4A 2OC1A 4CHAC 4TY7A 5FX5A 3OLUA 1TGCA 1IQJL 1F2SE 1C5YB 1ZHMA 1OWDA 1PQ5A 1HJ8A 1PPGE 7ESTE 2OINA 2OQ5A 5F8ZA 1SOZA 2GT7A 3RXMA 3IJEB 1AWHB 3BTGE 1O3IA 3PTBA 4NA9H 3TPIZ 3UTUH 2W7SA 4K8YA 3OLTA 2BX3A 3EAJA 4Q7XA 3HKJB 1CX2A 1MAXA 3MFJA 2Y81A 4JZDL 1Z8JB 2FYRA 1ZPCA 1MD7A 2I6SA 5F8XA 5CMXH 1WQSA 5FBIA 2NU2E 1SGFA 4NGAH 3T62A 3TJNA 4E05H 2C90B 3S7HB 2B7DH 3SJKA 1O3JA 2I9AA 1A5HA 1TABE 4ZXYL 4UD9H 2P3FN 5T6FA 2P93L 4J1YA 2FESH 2AMQA 1TRNA 1NRRH 1GHAG 3TNTA 1ELCA 2F83A 2J95A 3NTBA 2ZCHP 1P9JA 1UVSH 3M36A 1CEJA 3VB5A 3BG4C 4YOGA 1AVXA 2CF8H 2WPHS 2ZDAH 1EUFA 5I46L 1SGYE 2ZF0H 5AF9H 2OP9A 1O5CB 3UOUA 2YOLA 4BTTB 2BLVA 1HT5A 2BLWA 2ODQA 2W5EA 4RS0A 1O5BB 3GY2A 2TGFA 2ZU1A 2W2PE 3O8DA 5LGOA 1LHCH 1LQEA 4B73A 2FEQH 3A85A 3NKKA 1GI0A 2ODPA 3ZZ9A 1P57B 1YPLH 1E38B 1WUNH 2QF3A 1OWHA 1TPSA 3PMHB 3SU5A 4AFSA 1JV2B 3OSYA 2VWMK 1G30B 1OXGA 3EGFA 4YESB 2MHPA 3JZ1B 1O35A 5A0AE 2GD4A 1YBWA 1XXFA 4Y6DA 1AZZA 2JH6D 4OGYA 1CSOE 1QGFA 1XM1A 1DM4B 1P2OA 4FUCA 1AQ7A 4WF8A 3RXOA 5C67A 1S6FA 1EXFA 4WWYA 2Z3CA 1DX5M 2EI6A 4NFEA 1TPAE 1C5UA 2Z6BD 2HPPH 2SGDE 1NPEB 5H4IB 2Y7XA 2ULLA 2SNVA 1FY1A 1BTPA 3UPEA 3RXVA 4Y76A 3B8JA 4E06H 4G1MB 2EA3A 2J2UA 3MNXA 1O2HA 2ZU5A 4M10A 1GBLA 1KXBA 3LU9B 1QJ6B 5I25A 1M9UA 2A4RA 1F7ZA 3T28A 2PHBA 1BIOA 1MD8A 1DFPA 2QAAA 2W3IA 1NT0A 1ETSH 3C27B 1ANEA 4ESTE 2XXLA 5DP7A 2Y5GA 1AO5A 1Q2WA 1EB2A 1Y5UT 3A89A 3DUXH 3PLBA 3ZZ3A 1NT1A 2FOMB 3U7UG 2BVSH 1TBRH 1O3CA 4FU9A 4BAOB 1EX3A 2Y82A 1BB0B 4CRAA 1C5ZB 1GG6C 1YLDA 1SFIA 6CHAC 3LN0A 1DS2E 1WHEA 3HGNA 4MG3A 3RXHA 1QQ4A 1THSH 2G51A 1ATBA 2ANYA 1QIXB 1TALA 2HOBA 4K1SA 1W14U 1W0YH 2Z9GA 3QK1A 1L4ZA 1V3XB 4UFDH 5I46H 3AVZA 1K1JA 3V13A 4ZMAH 1KYNA 1N6XA 3QWCH 2WPHE 3E0NB 4JZFL 1O0DH 1AE8H 1GI6A 2D1JB 2J92A 1UHBA 1BTZA 1DY8A 1NS3A 1KLIH 1SGQE 1OSSA 2TBSA 1MMJN 2OC8A 1UTKA 2XYAA 1O5DH 1C5QA 3ATWA 2ZTZA 1P3CA 1M1XB 1SG8B 2RA3A 1O2OA 1CGIE 4XOJA 1G3CA 3LJJA 3SUGA 4CBOA 3QMOA 3PO1B 1GDQA 4IGDA 4J2YB 1GHWH 4I8HA 3EA9A 8ESTE 1DITH 1G2MB 1ARBA 1MKWH 1ANBA 1SI5H 2VWNL 1ZMLA 1LPGA 3BTME 2BYAX 1GWAA 3P5BL 2AERH 4GLYA 1HLTH 1ORFA 1KSNB 1YM0A 2BTCE 1EASA 1V2PT 1QR3E 3GCNA 3HO4A 2JKHA 4INHA 3SU2A 1E36B 2WINI 2P93A 2DE8A 4AORA 4R8TB 4MQAA 1YPJH 5EU8A 1IQLA 3LC3A 3U9AH 1O2XA 2BM2A 2J94B 2NWNA 5JB9E 3QZRA 4Z0KB 3LGVA 5L2ZH 1O2RA 4AOQA 1FY8E 1WV7H 1D6RA 3MH5A 3GCHB 3V12A 4A5TS 1TMUH 1JIMA 4JZFH 5ESTE 3KQDL 2Z7FE 1BCUH 3MTYA 4FUDA 1GBDA 5DK1A 5AHGH 1NRSH 2ANKH 3ITIA 1AE5A 2WYJA 1P3EA 4DY7B 1O38A 2ZNKH 1UTNA 5JBCS 1PPZA 4Y7BB 3KQCL 1BMNH 2BQWA 1SHYA 2D8WA 2O8LA 2BMGA 3F9GA 4NSVA 6CHAB 1Z8RA 1PQ8A 4YO9A 1QRWA 2W26A 2HVXA 1N8OB 3A82A 3ZYIB 2CJIA 4AYVB 3OU0A 2AGGX 4ABAA 1QHRB 3PM3A 1FN6A 7LPRA 4DJZB 4IC5A 3VEQB 3TK5A 4ZAEB 1TLDA 1LDTT 2YGOA 1KTSB 1W11U 1UCYH 3UWJH 2W26B 1NESE 1TA2A 4FU7A 3P95A 4O3UA 1J15A 1LMWB 1HAGE 1MOXC 1EGFA 1VITF 2VH6B 4NZLA 1NFXB 4X1QU 2VNTA 2B8OH 3M3SA 3ZZ6A 4AB8A 3GCWE 4Y7AB 2VGCB 2RG3A 3LC5A 3LAQA 1WYKA 1QFKL 2BOHB 3E0PB 2UWOB 4X8UL 1AMHA 1JRTA 2FTMA 4IN2A 1MZAA 1YLCA 3GY6A 1NFYB 1K37A 4Q7YA 2J38B 2BHGA 4BAQB 1GI3A 3M3VA 1PQAA 4LXBH 1HGTH 4WXVA 1KIGH 1HXFH 2VIVA 4XBDA 1HB0B 3TH3L 1Y3UA 2FXRA 1OP0A 4A1VA 4HFPB 2Z9JA 1SR5C 4WMFA 4BTIB 3IITA 1TPOA 3N8YB 3KF2A 3GY5A 3ZZ5A 1TX7A 1TBQH 4Q80A 4ISHL 5EGMA 1T7CA 4LK4A 1LPKB 1C5SA 1QB6A 4ISNA 3EYDA 1HAZB 4RRWA 1W0ZU 2FI4E 3EA8A 3RXEA 4NZQA 4DW2U 4I8JA 3O8CA 3I78A 5L30H 3CENA
chains in the Genus database with same CATH superfamily
1W13U 1XKAC 3RXJA 2KX4A 1Y5AT 3NK8A 2A4OA 1H8HD 1NTPA 3IWMA 3S9AA 1F7MA 1GGDB 2J97A 4FU8A 2VWOL 2WPMS 1ZRBA 4JMYA 5GDSH 1E37B 3PV2A 8GCHF 1P10A 2OLGA 2FTLE 5HIZA 4CUDA 2AGEX 1QB1A 1C4V2 2G8TA 4E7NA 1CQQA 1W8BH 4I8KA 5HYOA 1GVZA 1A4WH 1QBOA 3P8NA 1SGTA 1FAXL 1LHEH 2F9PA 2ALPA 2BOKA 3RXBA 2XBWL 1UTJA 1GDNA 3LOXA 1AUTC 1RD3B 4NIXA 1JIRA 1TFXA 1GJ5H 4MMXB 2G81E 2A2XH 4CH8B 1G1TA 4X1RU 1ZTLA 1F5LA 2SGAA 4B2CA 1IJQA 1G1RA 2BD7A 2IPHA 2SGFE 3S6XA 1FNIA 2Z9IA 5FPYA 1C4U2 1YO8A 1PPCE 2WPKS 3DA9B 5AVDA 4K8BA 1GBMA 1DUAA 1ELDE 2GCTB 1IQLL 2PR3B 3LKWA 5IYTA 3OEHD 3LGWA 1O5FH 1C2GA 1SGEE 3PWBA 5ESBA 1OP2A 1SL3A 4Y0YE 2STBE 1WOFA 5BRRE 1E0FD 2VVUA 5E8EH 1CA0B 7KMEH 2BD9A 3RXQA 1KLTA 1UMAH 2OBOA 4BTUA 1Z71A 2O9QA 2P8OC 2J34A 2OC0A 2ZC9H 2OQUA 4NIYA 4ZXXH 5DP9A 1C1MA 1GJ4H 5C1YA 2FLRL 2FOEA 1TQ7B 1TX8A 5COXA 2WSSD 3H09A 1GJ7B 2J98A 3ZZ7A 2ASUB 2A5AA 1ZAQA 2C8YB 1A0LA 1SGNE 1A1RA 3MWIU 2NU1E 1VJ9U 2EC9H 1NN6A 1SKYE 3T5FH 1YPMH 3SORA 1GVLA 2PUQL 4D0FA 1ZYOA 3CS0A 4ISLA 4OS6A 4RSPA 1P9SA 4A7IB 1YPHE 1TA6A 4ISIH 5EXMA 1GMCG 1PFXL 3FZDA 4Z0KA 1T31A 1H9IE 3A88A 5A0CA 3MU5A 4GAWA 4MPWA 4YT6H 1TMBH 3SOVA 2VH0B 2UUFB 3RC4A 3FP7E 1BZXE 2QC2A 4Q2KA 4WJG2 3LC3B 2A7CA 3F9EA 4A1XA 3POYA 3F6UH 4MNVA 2L74A 1O3KA 5A8ZA 1CU1A 2WPLS 1SQTA 4H42U 4JCNA 5A2MH 2GD4B 2FP7B 2CXVA 1XXDA 3AW1A 2WYGA 1NY22 2DE9A 4K69A 2Y5HA 1P2IA 3A7VA 2ZP0H 2D2DA 2FOGA 1ZJKA 3SV6A 4FM5A 1GCTC 3FP8E 1UO6A 3GOVB 3CENL 2YMSC 1UCYE 4ABFA 4A7IA 1EPHA 1GBCA 2CV3A 4DG4A 1ADXA 2ZKSA 1TRMA 4H4FA 3KQEL 1K1PA 2ZHWH 1B9WA 4THNH 1TGNA 1C1VH 3DT0H 2ZGJA 4OM9A 3I77A 3ZVCA 2A0QB 3RXTA 2VIQA 1IOEA 1NRNH 1O2PA 3MU1A 1O5AB 3H7TA 1V2VT 1WDIA 3QX5H 4DCDA 1TPGA 1LVMA 3E1XB 4MPVA 3EGKH 2AMPA 5GCHG 1TONA 1QIUA 1EOLA 3Q3YA 4A94C 3LGIA 1GPZA 1HBTH 1O3PB 3OAAD 1Z1JA 4K60A 2H9TH 3HGPA 1L1JA 1WCZA 1S82A 5DSFA 4NCYA 3FBYA 1G3BA 3BEUA 2KFWA 4P02A 4JYVH 3PLPA 3TU7H 1MU8B 2ZWLH 1FY5A 3DEMA 1C2HA 1FIWA 3KCGL 2XWAA 1GI5A 1MH0A 3MU0A 2ZGXH 3TITA 2OYUP 1C1SA 1C5VA 2BVXH 2ZDLA 4I32A 1Z6EA 1S84A 5L30L 4XBCA 1O2VA 3GICB 3ZZBA 2R0LA 2PHBB 2G4UA 3K6ZA 1PXXA 3LTFB 1P05A 3QDZB 1SMFE 2XTTB 1THPB 2VB0A 2WV9A 2M2AA 2ZHEH 2P3FH 4Q7ZA 1EAIC 4U2WA 2F9VA 4ISOA 1V2NT 3NCLA 5DN6D 3V65B 3NZIA 2J2UB 1C5MD 3ELAL 1P2JA 1TNKA 3SOSA 1SLXB 1BTWA 2BD3A 2GX4A 5DP3A 2RA0A 2JETB 3DFJA 1MTWA 1P09A 2Y7XB 1LHFH 3V7TA 2BXTH 1ZGVA 3ZZDA 3F68H 3N8WA 1IGZA 2F9BL 1H8ED 2QF0A 3M36L 1LPZB 1O33A 1E1QD 1O2LA 2C8WB 1MKXH 1HCGB 2VIWA 2GJGA 1HAVA 1ACBE 5CKNA 1EZXC 2HPQH 2B9LA 2Z3EA 2ZCKP 1SVPA 1PPHE 4I8GA 3UFAA 1K1MA 2QXJA 2GCHG 1A5IA 1K28D 4M7GA 5HKKD 1W10U 1DVAL 3URDA 4AN7A 1AI8H 5IK2D 1LO6A 1O3LA 2QY0B 5EJLA 3KQDA 1X7AC 4GHQA 1ZPBA 2FM2A 3A7TA 1A3EH 3PV5A 8LPRA 2BLOA 2W2QE 1GMDG 1RS0A 2GTBA 1O39A 1T8LA 1UTPA 2UWLA 1WBGB 5GPIB 1TQ0B 3UQOA 1PPEE 2QXGA 2P16L 1XUHA 2O8WA 3BTQE 4BTTA 1HAYB 1W7XL 2UWOA 2RNLA 4YOIA 2BOHA 1CVWL 4XBMA 1YPKH 4BXWA 3ENSB 1T8NA 2BSFA 2C3SA 4Y7AA 1FXYA 4VGCC 3PV4A 3TGKE 3TGIE 3BEFB 3FFGL 2K2SB 1A3BH 1SGIB 3KYGA 3P8FA 1IQJA 5L2ZL 4OS2A 5L2YH 3M5OA 1ARCA 2EI8B 1QRXA 3GY8A 8KME2 4UE7H 4X0WU 1K21H 1CBWB 1L4DA 2BDGA 4B1TA 3RXAA 2I6QA 3LIWA 3CS7A 1KXEA 2P3TA 1DLEA 1RTLA 3UR6A 1G32B 4LOYH 1QL8A 1MZDA 5EW1H 3VG8A 4GUXA 2VIDA 4KTUA 3LT3A 3RMNH 1V2RT 3VB6A 4LMFA 2H9EL 2NU4E 1UZKA 1OWJA 3M3TA 3KRKA 4JYTA 2KAIB 2F3CE 2J98B 1EZUC 4AFUA 2V3HH 2Y7ZA 3MQEA 4F49A 2O8UA 2VVVA 3V64C 1G2LB 5DGJA 1S81A 4CH2B 3VB4A 4YLUA 1ANDA 5EJZA 2Y7ZB 1DUEA 4GCHG 2V3MA 3MDLA 1NFUB 1YCPH 3F6UL 2FOCA 2QCYA 4U30A 3DSGA 1O3AA 2KNIA 7GCHF 4COXA 1ZZZA 4KTSA 3NTGA 4XLWA 2AFQB 3WWFA 2RDEA 1O3MA 1HJ9A 1ABIH 1QNJA 1ZLRA 2R0KA 3Q7DA 1HZ8A 4INKA 1ZOMA 1EBVA 1Q3XA 3HS7A 1JMOH 4MLFB 1Y8TA 3VXFH 4ABEA 1O30A 3LIWB 1UVPA 2BD8A 5JBBE 4X8UH 2OBQA 3F9HA 3RLYH 4BAHB 2WPIS 1O2UA 4YOJA 1GJDB 1LQDB 2O8MA 4Y8XA 5FHTA 1KKEA 1EB1H 1D6WA 4AB9A 4AYYB 2XNIA 2Y5HL 4OS5A 4YTAA 1SLUB 4NA8A 1IQKL 2LELA 5DG6A 4YT7L 4CUEA 3M5NA 1GDUA 4M11A 2P95A 2FOBA 3A83A 2H1UA 5EW2H 1BT7A 3U69H 1P12E 3MH7A 3GYMA 1AU8A 3SHAH 1UVUH 1ZR0A 5EODA 3SNBA 4K1TA 4ZHAA 3ZZ4A 2D1JA 5A8YA 3A86A 3DFLA 1FONA 3A8DA 3DSOA 4ZUHA 2BOXA 5FXLA 3A80A 4ABJA 1QURH 2XC5L 3PWCA 1ATEA 3OX7U 3D62A 1V3XA 2EEKA 2PFEA 3N8YA 2JH0D 1FQ3A 3S9CA 1E35B 1JWTA 4BTIA 1F7EA 5EQQA 1EPJA 1B7XB 1ESAA 2A31A 5AFYH 4CBNA 1F92A 5C5NA 3TGFA 1C5RA 4ASHA 1DWBH 3F9FA 5FCRA 5FPSA 1MBQA 4YLQH 2YGQA 1OHHD 1QBNA 3BIUH 2ZO3H 3A81A 1HAVB 3N8ZA 2F4LA 5EXNA 2HWLB 1UTOA 2YMSD 2GZ7A 1PFXC 1GBBA 4XL1A 4FETA 2V0BA 1MQ5L 1TNLA 2PWXA 3UWIA 3U8RH 1SGDE 3RXUA 1G2LA 3VB3A 5JBAE 1EJMA 1GBHA 2WPLE 4ISIL 4XRNA 3D49H 2BZAA 1C5XB 3SV8A 3T26A 1V1HA 2HRVA 4IS5A 1FI8A 1DX5I 1RIWB 5ETXA 3RMLH 4ABGA 3NPSA 1GL1A 1T4VH 2ADXA 3RXRA 1ZSKA 1HJAC 1YUGA 1A46H 2P3FL 4Y76B 3ATMA 5TCCA 3L6PA 3SJOA 5L2YL 1G36A 3HK3B 1O3FA 2HNTE 1OYTH 2YMSB 5HM2A 5C3NA 1O5DL 2P3TB 1S83A 2EI6B 4IMQA 2BOKL 1RFNA 3RXGA 4E1GA 1DXPA 2ZFFH 1GGDC 3MNBA 3T27A 5EIYA 4NIWA 5DJ7A 1UK3A 1XUKA 1FV9A 2F43B 2XRCA 1LMMA 2CJIB 2A5KA 1GK5A 2C4FH 2IN2A 1A0HB 3MI4A 3P70B 4E7RG 5CKQA 1P2MA 4Y8YA 1EATA 1NU7B 1MCTA 2YNBA 3KYFA 2QGRA 4AFQA 5EQRA 4GHTA 2CMYA 1EJNA 4O03A 3ZZCA 3UB0A 4ZKNU 5KEDA 1O36A 1OP8A 5EPYA 2PV9B 4X6NA 2BDAA 2FD6A 4RT1A 3ENSA 2AYLA 1OPHB 3SBKA 5CE1A 4ZH8B 1Z1IA 2JH5D 4KKDA 1EMNA 3ZVBA 1DDJA 1QJ1B 2TPIZ 2H9EC 3A7ZA 2SGEE 2SNWA 1TRYA 1IHSH 1RXPA 3NWUA 1O5GH 4BOHA 5A0BA 1O2JA 1GBJA 1ZPZA 2GCTC 1F0RA 1BQYA 5T3HA 3K2UA 2P94L 1UVOA 1BMMH 3C1KA 4O97A 3ZYDA 2ILNA 2BXUH 1ATAA 1VITG 3OE7D 5HM9A 2G00A 1EPTC 1LVOA 4OTYA 4I7YH 3P17H 1CA0C 3MQKC 4D9QA 3PLKA 5F1AA 4JZIA 1KDQB 1P02A 4MVNA 1AN1E 4TWYA 1V2MT 2ZU4A 2H2ZA 4X2YA 4B76A 3LH3A 3RXLA 3KQBA 4WVPE 2WYGB 3MHWU 3KQBL 1WSSH 1O3NA 3UR9A 2BQ6B 3IG6B 4LORA 1O37A 1YF4A 1LPGB 1HCGA 3QTVH 2NU0E 3E8LA 1FY4A 1FLEE 1O2NA 2FLRH 4UFGH 3M5MA 2ZFRH 2P94A 2F9NA 2AH4X 1IOEL 3TJUA 1W7GH 5CHBA 1D3TB 2ZDNA 5DP8A 2Y81B 2BT8A 2HNTC 1TOCB 2XWBI 3O8BA 1K0HA 4TYDA 1O34A 3HATH 5EPNA 4YXWD 3ELAH 2Q6GA 1NFWB 4AG2A 1GJ6A 2WV5A 3ATLA 2FOHA 3RXPA 9ESTA 3UIRA 3ATIA 2WZPP 2ZECA 2K1QA 3ZVEA 5GWZA 1IP0A 2WUCA 1GHBG 3LGTA 4YM9A 2XBYL 5JB8E 1ESTA 1QBVH 1TLEA 1K9OE 3RXKA 1DOJA 2XBXA 3M61U 1CT0E 1AVWA 1PYTD 1V2LT 1AKSA 1ELGA 2A4GA 3M35A 4GU4A 3FANA 1COUA 3RR3A 2PUXB 1TNJA 1NC6A 1ZMJA 3SI4H 1QFKH 4K5ZA 1C1PA 3RC6A 1N1LA 3RU4E 1H8DH 2PR3A 2SGPE 2UUKB 1FDPA 1Z6JH 3R05A 1GCTB 1Z7KA 3U1IB 1J8AA 3SU6A 3VGCB 2CHAC 4MPXA 3STIA 4DIHH 1H4WA 3PMBB 1W12U 2FPZA 3GY7A 1A2CH 2CN0H 3OTJE 1IQFL 1QL9A 4CREA 3GDSA 1B5GH 1MTVA 4DT7B 4X8TH 3SJ9A 3AAVA 1YUFA 2B7DL 1BRAA 1EKBB 3EQ0H 1SC8U 4DT4A 5J4QA 2XCNA 1Z6CA 1FPCH 1TGSZ 2HLCA 3F0PA 1THRH 1YWUA 1FX0B 4JK6A 6GCHF 2PSYA 1GG6B 4X6MA 3A7XA 3P8OA 1ETTH 1O3BA 2ANWA 1O2GH 1IGXA 1XDTR 2F91A 1Y3XA 1CE5A 2ANMH 3SU4A 1Z8GA 1SGRE 2VWNA 1J16A 1O5EH 1CVUA 1IOXA 4H6SB 2VVUL 1BRBE 3MMGA 2FODA 1PQ7A 4X8VL 1KLJH 2RA0L 2Z94A 1UTLM 4LZ4B 4MNXA 5JBAS 1X7AL 2P59A 1LVBA 4RRXA 2QF4A 4KELA 1IQNA 1SLWB 4ABBA 3FN8A 1TNGA 1LPKA 1SB1H 3ATKA 1SGCA 5JVZA 2CK3D 3URCA 3QUMP 3DD2H 3HO5A 1G1QA 2BY8X 3D65E 2MGRA 1PJPA 1SZBA 1N1IA 3QH0A 1K1LA 1TYNA 5BPEA 2GDEH 2VRSA 2GV7A 2NU3E 4TT3D 2Y6TA 1IQEL 1XUIA 1V2ST 2KCYA 4FUEA 4MMYB 4ZROA 1Z8IB 4PH9A 4MNYA 3SW2B 4HGCA 2FZZL 3E16B 5JB9S 1W8BL 4O1ZA 2PKSC 1FAXA 3QTOH 1LHGH 1GMHF 1XVMA 3ZVFA 2BLQA 2BD2A 1D9IA 5JBBS 2FLBH 4JZEL 1DSUA 1HAIH 2GMTB 1O2YA 1YGCL 4Z0LA 1RRKA 1P06A 1YYY1 2OYEP 1MBMA 3A87A 4INLA 4WY3A 2W3KA 4RRYA 2Y5FL 2Z3DA 3SJ8A 3LC5B 2ZEBA 3OY6U 5C20A 3F2GA 1T4UH 1ZHPA 3ODDA 1BTXA 3UREA 1DVAH 2FOAA 1AY6H 1P0SL 1AIXH 2Y80B 1HAOH 3HPTA 2Y5GL 1S0QA 4X6PA 3FVFB 3RXCA 1BA8B 1VR1H 3RUOA 1V2UT 1O2TA 3ZYJB 1C2KA 1EAUA 1SQAA 3E3TA 5B6LA 1YP9A 3WY8A 3GCHC 1VJAU 4NGAL 1EPTA 1TBZH 1NQLB 4ZAEA 2VWLA 5E0JA 3SUEA 1HJ7A 1ID5H 1NPMA 3E91A 2H6MA 3RU4D 1DT2A 4TGFA 1BHXF 1HAXB 1S6HA 1MCVA 2QN5T 2FYQA 3H7OA 4CRDA 1J9CH 2R3UA 4Y11E 1TGTA 4FUJA 2YGPA 1BJVA 1F0SB 1EP6A 1NFWA 2P3UA 5JDUB 4B75A 2ZQ1A 1CCVA 1DQBA 2WZQA 4NFFA 2FLGA 2WG4B 2ZHQH 4XSKU 4D8NA 5CKMA 1O31A 2XW9A 3BTWE 3TJOA 5K0HB 3QCWA 2ZPSA 2HGTH 2VJ1A 2BT7A 3SO3A 1QQUA 2BDCA 1UCYK 1AWFH 1EAWA 3UQVA 2PKAA 4OTJA 1L0ZA 1BF9A 2ZU2A 2BY5X 5E0HA 1OKXA 4WH8A 1EAXA 1GMHG 1XKAL 4BAKB 1INCA 2ZG0H 1U6QA 2F9BH 4CUFA 4NA9L 4D7FA 1P2NA 1NRQH 1FZZA 1CBWC 1GBEA 3W95A 1HAFA 3TK6B 1GCDA 2BDYA 1F5KU 1JRSA 2C8ZB 1KMHB 5JW1A 3E90B 2EI7B 3FAOA 4UEHH 5EGMB 1HUTH 1TOMH 1QTFA 2JDID 4RN6A 4GPGA 2H5CA 2SGQE 2B0FA 2VBCA 1O3EA 3M37L 1ETRH 3OEED 3P6ZB 1C5WB 3MOCA 3SV2H 4JZEH 2A32A 3VXEH 2XBVL 2GVFA 3I29A 1UZPA 4FVBA 4OS7A 4GSOA 1ELFA 1BBRH 3SV9A 3RDZA 1O2MA 4PROA 1GI7B 1EZQB 2VWMA 4ZHAB 2FWWA 4XBBA 1FE2A 2OCVB 4CR9A 5KN5C 2UWPA 5CHAB 1H1BA 3S0NA 3SN8A 1IQMA 3EA7A 4U32A 1O2KA 4TY6A 1KY9A 1WU1B 1EFRD 5T6DA 2J9NA 5DP6A 2OXSA 3HK6B 3R0FA 3TH3H 1E79D 3CA7A 1MTSA 1Y59T 1IQFA 1C2DA 1Y3WA 2R2WU 2AGIX 2AEIH 2FO9A 5DKMA 1UHBB 5C2ZA 3QGNB 1GHYH 4A92A 3T2NA 1WQVH 3U73A 1GHBF 2RHPA 2IPQX 1C2LA 1TPPA 3KL6A 1GMDF 4ZXXL 3Q00A 1IQML 3TK5B 1YLNA 1SOTA 2ZGCA 1YPHC 1P01A 1GMCF 2WFXB 5G4BA 2VWOA 4DURA 2Y82B 1HAEA 2HOXA 1IAUA 2BMGB 2XC0L 1FY3A 1T8OA 1UVTH 3B23B 4UFFH 2Y38A 1GBIA 2QV1A 4Y7BA 1HFDA 2BDHA 3M37A 2PTCE 1BDAA 1JBUL 4Z6AL 1GBAA 1WTHD 2VVCK 4ACBA 1GJ9B 4FOUC 2W3IB 1C2MA 3KNXA 2J4IB 2WYJB 3U8TH 1D3PB 3U8OH 3SYJA 1O2IA 1D4PB 3HKIB 3U1JB 1GI8B 1KLJL 5CISA 1LVYA 4X8VH 2K2TA 3PMAB 2KAIA 3CNRA 2H5DA 1O2ZA 2VJ3A 1CT2E 5FBEA 4D0EA 3RLWH 1MTNC 2ZGHA 3QZQA 4AZ2B 2PGQB 1UK2A 4YT6L 1LCYA 2TIOA 1XFEA 5E8DA 2TRMA 4LZ1H 3FZZA 2VIPA 3K65B 1PPBH 4RUTA 2SFAA 4ZKSU 1GHAF 3BT1A 1TNHA 3F0OA 2J94A 2CHAB 3PO1C 1EPIA 5FPTA 2GZ9A 2P28B 2HLDD 4Y0ZE 1V6DA 2G5VA 3GISB 1CCFA 1EJAA 2M5TA 2QYIA 1KXFA 1ELAA 1NO9H 5C94A 1OS8A 5GCHF 2BOUA 2GP9B 1MKWK 3KGPA 1CHOG 5EXLA 2M74A 2XC4A 2ZZUH 4JZDH 1GHZA 4ISHH 5F6MA 1SFQB 1C4Y2 3K9XA 2A7HA 5DPAA 1TGBA 1RGQA 2G52A 5FDQA 2PW8H 5SGAE 1SSXA 1SQRA 1K1NA 3RM2H 2LP6A 1KIGL 1KTTB 1EMOA 4TPIZ 1UJ1A 3TH2H 3SNAA 2ZDMA 4Q4LA 1IQIL 1HX2A 1JBUH 1HRTH 3TIUA 4Z6AH 3A7WA 1C5PA 2FS9A 4Y71A 1VGCB 4XFQA 3QLPH 3KQCA 3SUDA 2BQ7B 1APQA 1P11E 4K1EA 4XE4A 1C5OH 2K8IA 2OUAA 5IKVA 1PRHA 3HS6A 2KL7A 1K1OA 1FPHH 2WPJE 4ASUD 1KLIL 1DE7H 4AGKA 1C1OA 4AGJA 2KV4A 3GYLB 3TK6A 2J5UA 3AAUA 4DIIH 1FN8A 5DP4A 4DVAU 1IQEA 4Y8ZA 3SQEE 3L3TA 2KCPA 3STJA 3H5CB 2R3YA 2A7JA 3SGQE 1GJCB 1LPZA 2V3OH 3UNSA 3N8VA 2FDAA 1QCPA 2F9UA 5LPEA 1GI4A 4B6FA 1P03A 5T1VA 2GCHF 2GV6A 4FUIA 4NA7A 1TOZA 3RMOH 2J4IA 3E6PH 4UONA 3GCXE 1FAKH 1B0FA 3Q76A 1NBMD 3M7UA 1RJXB 2Z9LA 1C5LH 1URKA 1CHOF 3EDXB 4U01A 1MQ5A 3T25A 4GU3A 4JK5A 4JYUH 3R3GB 3BTDE 1TIOA 4GVUA 5J4SA 4X8SL 4NWKA 2GDDA 2THFB 1OWEA 2BB4A 2UUJB 2WG3C 4CHAB 1U67A 2XOKD 2XCFA 1BRCE 1ATDA 1N6YA 3Q3XA 1TMTH 3BT2A 2W2NE 3GISX 5PTPA 4I86A 3KL6B 4WXIA 3ZYEA 2KZ4A 2O8TA 5AFZH 4FUGA 1L3YA 1HYLA 4O9VA 2EI8A 4TPYA 2W2ME 3SI3H 1CQEA 4YZUB 5B6OA 2QE7D 3BTFE 4Y79A 2BVRH 2XC5A 2ZFTA 3A8AA 3ESTA 3GS9A 3BTKE 1LKBA 2GZ8A 3S7KB 2ZDKA 3SNCA 9LPRA 3HPTB 1C1QA 1WXRA 4NG9L 1YCPK 1BTUA 1NZIA 3MO6A 1SPJA 2IOTA 1F0UA 1W2KH 1PGEA 1AB9B 2G55A 3MNSA 2ZPRA 5TJXA 6ESTA 1WU1A 1WTGH 3MYWA 2W3KB 2BO2A 2UUYA 1J17T 3A8CA 3KN2A 2RFKC 3A84A 3PB1E 1UTQA 3SZNA 1S5SA 2UWPB 1ELTA 1HRFA 1QB9A 2C8XB 1DY9A 1F0TA 1OOKB 1VCPA 2ZTYA 1ZSLA 1G1SA 1ZMNA 1P0SH 2JJ1D 3S9BA 3SW2A 1HT8A 4JZ1A 3Q77A 5GIBA 4BXSA 1EAIA 2W7UA 3ZV8A 4ZKRU 1L2EA 2XBXL 3KIDU 5JVYA 4X8SH 3BTTE 3UUZA 3BSQA 4CRCA 2XBYA 1C5TA 2J95B 5EOKA 1GVKB 3DSPA 3MO9A 2ZA5A 1I0UA 2VWLL 2ODYB 2QXIA 3RP2A 5TCAA 4KGAA 4D7GA 1Q4GA 4Y79B 1V1IA 1GI1A 1IVOC 4YZUA 1LTOA 2I9BA 3SJIA 7GCHG 3ZYGA 3SV7A 3TBDA 2HALA 2BZ6L 3LJOA 2Q6FA 2ESTE 2P8OB 1QJ7B 3RXFA 3U98H 1ZRKA 1O3DA 4BNRA 1HPGA 3QN7A 5JB8S 1CO7E 2WPDD 3RC5A 1SHHB 2XC4L 3N8WB 3F2HA 4X6OA 1ZTKA 3BF6H 1V2KT 2EQNA 4ABIA 1AZ8A 2AIPA 1T32A 5EG4A 4KP0A 5K0HA 2Y5FA 2HVYB 2JJLA 1QRZA 4B2AA 3BTEE 2ZPQA 4IN1A 1GJBB 2WV4A 5T6GA 2P3UB 1WHFA 1F0SA 1N8OC 3BG8A 4AQTA 3N7OA 3LONA 5L6NH 1JXPA 1FFMA 2ZDVH 4UFEH 2PTNA 2ZU3A 1OB1C 2J34B 4AFZA 1BHXB 1SQOA 2FX6A 1C9TA 4BTUB 5GXPA 2G5NA 1NRPH 1G3EA 1LMJA 3SNDA 5JBTA 4AG1A 3LTGD 5C1XA 2QA9E 4B71A 5GJ4B 3S69A 1UZQA 1UZJA 3CS7L 3PYHA 1D3QB 1O3HA 2OD3B 4O3TA 3UNRA 1RIWC 2FMJA 3DHKH 2P26A 1UK4A 1PYTC 3NJPC 5CHAC 5E2PA 1IQNL 1HDTH 1GJ8B 1FUJA 1HJAB 1T8MA 3BV9B 1MQ6L 1AGJA 1MU6B 4IC6A 1AKSB 1AB9C 2BX4A 1EQ9A 3TK9A 1AFEH 1VCWA 1ZHRA 3GDUA 3ZVAA 5LH8A 2WPKE 2XC0A 2BD5A 4B2BA 1BBRE 2B5TB 3SU3A 2BQ7A 1YGCH 1ELBA 1HXEH 3LPRA 4HG6A 1G37A 1O32A 4MTBA 3FO8D 4OGXA 4ZCNA 4KTCA 3TVJB 2CF9H 2AHME 3EE7A 1Q31A 2VU8E 3GCTF 3CP7A 1ZGIA 4ZHLU 4MPUA 1XMNB 2NPRA 2BDIA 3SGBE 1MTNB 1FMGA 3F1SB 3BIVH 1EQGA 1UTMA 2OC7A 4IW4E 1GI2A 4MMZB 1ELEE 3BPSE 2FS8A 2LPRA 2R2MB 3ZVGA 1HAHH 1GBTA 1NZQH 1A7SA 1C2EA 1DWDH 4I31A 3RU4T 2A4QA 3MH6A 1GBFA 4OS1A 3K9XB 2VGCC 1TWXB 3HS5A 3NXPA 1BMLA 1IQGA 4IMZA 1V2TT 2BZ6H 5FX6A 1GBKA 4NIVA 1B0EA 4FUHA 1P8VC 3GCOA 2WFTA 2ZFQH 1ABJH 2TGDA 4CR5A 5CDFE 3TGJE 2BQ6A 2TGPZ 3MH4A 4RKOB 1C2JA 2VINA 1BBRK 1EP5A 2QF5A 2GMTC 3MNCA 4BDWA 1C1WH 3ZIAD 3WW7A 2TGTA 8GCHG 3A8BA 3ASIA 2KCAA 4NWLA 4JYUL 1DXWA 1DWEH 1BOQA 1P04A 1KDQA 4I33A 3Q3KA 1EZSC 2BY6X 4BAMB 3RXDA 1ESBA 2VH0A 2JKHL 3TLOA 5IDKA 5LPFA 2WPME 1GHXH 3ZZAA 1QA7A 1ZJDA 1KLOA 2VVCA 5A09A 1O3GA 1YUKB 3K6YA 2XBVA 2BDBA 4MNWA 1GJAB 2GKVE 3ZV9A 1F0RB 1HIAA 3BTHE 1GI9B 1PTHA 1MAYA 4OS4A 3UNQA 2J38A 4CRFA 3KK6A 1NFYA 1MQ6A 1OYQA 2GT8A 1FIZA 2ZIQH 3KEEA 3TH4H 2FI5E 1CT4E 1DPOA 4HTCH 4RRZA 1J14A 3PGHA 2TGAA 6LPRA 2Q1JB 1C2FA 3UOPA 1VCQA 1V2JT 1P2QA 1NM6A 4DOQA 1P9UA 3B9FH 4IBLH 5FL7D 3N8XA 2R9PA 3ZZ8A 1CA8B 1DSTA 3V0XA 1XUFA 4R0IA 1FJSA 1EQHA 3FCSB 1DDXA 4NSYA 3SOBB 4CRGA 1HAPH 3F2FA 3ZVDA 3SOQA 2P95L 1YPGH 1OX1A 1LK9A 1S85A 2D26C 1MABB 5GNDA 1Y3YA 2AMDA 3SGAE 3AASA 4D90A 1C5MF 1IQKA 1YC0A 1XUJA 1QZ8A 2HORA 2ZFPH 3GY3A 1Y5BT 6GCHG 1K36A 4X1PU 4Y10E 3LDXH 4XD7D 1NROH 1S6LA 1QL7A 1BITA 2DDUA 1C1UH 1V2OT 1JL9A 1RTKA 2Q1JA 3BN9A 1O2QA 2WPJS 4HI3A 4X1NU 5IKTA 1V2WT 3NT1A 3A7YA 3KCGH 4HZHA 5EQSA 2Z9KA 1P2KA 1L1NA 1APOA 3SU1A 1H9HE 4WH6A 3BEIB 3LGUA 3M5LA 4UDWH 1C9PA 3SNEA 3DCLA 2LNCA 4K3JA 1AD8H 1HIAB 1EPGA 1SGFG 3P92A 1PPFE 3PMJA 2IJOB 1IQHA 1BRUP 5F03A 2PUQH 2CGAA 1WAYB 4X1SU 3TZIA 3RM0H 5F53A 3TNSA 2V6NA 3VB7A 2KB9A 1KXCA 4AX9H 1RTFB 4ABDA 2VVVL 2BY9X 2L6OA 1C5NH 5HGGA 3RXIA 3IITB 3BG4B 2EI7A 1BTHH 2FZZA 1FJSL 4Y71B 1ZTJA 4A6LA 2PSXA 3KHVA 4A1TA 3FKSD 5C0UA 1SLVB 1KSNA 3MU4A 5HMAA 5E0GA 2V35A 1HV7A 1BUIA 1O3OA 4GCHF 2C93B 3SHCH 1G2MA 5IKQA 1CVWH 3LN1A 3RXSA 1MKXK 3PTNA 1XKBC 2PLXA 1AHTH 1GL0E 5KIRA 2PKAB 3AW0A 3O8RA 4X2WA 1XX9A 4ZH8A 4BDXA 1AFQC 2STAE 1H8IH 1A61H 1DLKB 2EY4C 3OYPA 4X2VA 1BJUA 1FAKL 1NFXA 4ABHA 1C1RA 3NRLA 4XDEA 2VH6A 5F19A 1C1TA 3SU0A 1W3CA 2H9HA 3UY9A 5IKRA 1F5RA 2PKSB 2XNDD 1LQDA 3SUFA 2W2OE 4H6TA 1OWKA 1AUTL 1E1RD 1ZSJA 3P8GA 3D23A 4FUFA 3FFGA 3GY4A 5FAHA 4X8TL 4C16A 1CHGA 4B74A 1J9CL 2ALVA 1VGCC 1C1NA 3FP6E 4FVDA 4O02B 3EE0B 4FUBA 4BANB 2BD4A 1C2IA 2ZGBH 1FF7A 1RFNB 6COXA 5DO4H 1EPTB 4NG9H 3HO3A 1N7DA 3F3BA 1O2SA 1L5GB 5A8XA 1IHTH 4SGBE 5JYIA 4CSYA 2P16A 3T29A 1V2QT 2FIRH 3C9AC 2G4TA 1H9LB 1KXAA 2A1DB 1A0JA 4FXGH 1YY3A 1HREA 1YKTA 1A5GH 2AYWA 4SGAE 3M7TA 2BQWB 1IQGL 2ZQ2A 5F8TA 3SQHE 1MTUA 2WUBA 2Y80A 4D9RA 5DP5A 1TB6H 2WPIE 1MUEB 4K2YA 1NFUA 2XBWA 2AIQA 2F9OA 2AS9A 2PP6A 1QA0A 4ZHMU 1U8CB 3CFWA 1DWCH 1OWIA 3TJVA 1SGPE 1AVGH 1D3DB 1JOUB 4JYVL 3QO6A 3W94A 2RDLA 2V7QD 5E2OA 4MDSA 5K7RA 2A5IA 3PROA 1BTYA 1A3PA 1IQHL 1LKAA 4Q63A 1CGHA 3G01A 1TX6A 1VZQH 1XUGA 3V3MA 4F55A 1E34B 2ZHFH 1AFQB 5HXFA 1KXDA 5C1UA 1IQIA 5LPRA 2JETC 1O2WA 1S0RA 1YCPM 3M7QA 2BY7X 3VGCC 2Q6DA 3FOAA 1LHDH 3Q3KB 1XKBA 2FOFA 2ZCLP 3QGJA 4X2XA 2H9EH 3JZ2B 2FI3E 3OY5U 1ELVA 2DUCA 2QIQA 1VITH 4RKJB 3GCTG 1EOJA 2ZI2H 2A2QH 4Y6DB 1GHVH 1K1IA 4ZXYH 4D76A 2GGVB 1SBWA 2HNTF 3L33A 1Z6EL 1QY6A 1TE0A 4WMEA 2IJD1 1G9IE 1W0KD 2QXHA 1BMAA 3GDVA 5JPMH 2ZTXA 4YT7H 5EJ1A 2MGPA 4WMDA 3SZEA 1XVOA 5C5OA 4F4OC 2ZFSA 4ZKOU 4QT8C 1K2I1 2ZHDA 1FSBA 1ANCA 1EZQA 3ODFA 4B6EA 1TAWA 4DGJA 2UWLB 1G3DA 1L1GA 2G00L 1NU9A 1CGJE 2PGBB 3LGYA 3LH1A 2A45B 3PRBA 4CRBA 1W7XH 3MU8A 1DICA 5ABWA 2FLBL 1DANH 5FCKA 3VPKA 2VIOA 4I8LA 2YNAA 1AUJA 4VGCB 3VFEA 4TWWA 3NUMA 3MO3A 5JBCE 3RMMH 1Y3VA 3KQEA 1K22H 1YPEH 2W86A 1TNIA 2OTVA 1DIYA 2RCEA 1HNEE 2FX4A 2OC1A 4CHAC 4TY7A 5FX5A 3OLUA 1TGCA 1IQJL 1F2SE 1C5YB 1ZHMA 1OWDA 1PQ5A 1HJ8A 4P00A 1PPGE 7ESTE 2OINA 2OQ5A 5F8ZA 1SOZA 2GT7A 3RXMA 3IJEB 1AWHB 3BTGE 1O3IA 3PTBA 4NA9H 3TPIZ 3UTUH 2W7SA 4K8YA 3OLTA 2BX3A 3EAJA 4Q7XA 3HKJB 1CX2A 1MAXA 3MFJA 2Y81A 4JZDL 1Z8JB 3OFND 2FYRA 1ZPCA 1MD7A 2I6SA 5F8XA 5CMXH 1WQSA 5FBIA 2NU2E 4RI0A 1SGFA 4NGAH 3T62A 3TJNA 4E05H 2C90B 3S7HB 2B7DH 3SJKA 1O3JA 1UW7A 2I9AA 1A5HA 1TABE 4ZXYL 4UD9H 2P3FN 5T6FA 2P93L 4J1YA 2FESH 2AMQA 1TRNA 4M9FA 1NRRH 1GHAG 3TNTA 1ELCA 2F83A 2J95A 3NTBA 2ZCHP 1P9JA 1UVSH 3M36A 1CEJA 3VB5A 3BG4C 4YOGA 1AVXA 2CF8H 2WPHS 2ZDAH 1EUFA 5I46L 1SGYE 2ZF0H 5AF9H 2OP9A 1O5CB 3UOUA 2YOLA 4BTTB 2BLVA 1HT5A 2BLWA 2ODQA 2W5EA 4RS0A 1O5BB 3GY2A 2TGFA 2ZU1A 2W2PE 3O8DA 5LGOA 1LHCH 1LQEA 4B73A 2FEQH 3A85A 3NKKA 1GI0A 2ODPA 3ZZ9A 1P57B 1YPLH 1E38B 1WUNH 2QF3A 3W1EA 1OWHA 1TPSA 3PMHB 3SU5A 4AFSA 1JV2B 3OSYA 2VWMK 1G30B 1OXGA 4ACAA 3U28C 3EGFA 4YESB 2MHPA 3JZ1B 1O35A 5A0AE 2GD4A 1YBWA 1XXFA 4Y6DA 3UAIC 1AZZA 2JH6D 4OGYA 1CSOE 1QGFA 1XM1A 1DM4B 1P2OA 4FUCA 1AQ7A 2KR7A 4WF8A 3RXOA 5C67A 1S6FA 1EXFA 4WWYA 2Z3CA 1DX5M 2W6JD 2EI6A 4NFEA 1TPAE 1C5UA 4F48B 2Z6BD 2HPPH 2SGDE 1NPEB 5H4IB 2Y7XA 2ULLA 2SNVA 1FY1A 1BTPA 3UPEA 3RXVA 4Y76A 3B8JA 4E06H 4G1MB 2EA3A 2J2UA 1VKYA 3MNXA 1O2HA 2ZU5A 4M10A 1GBLA 1KXBA 3LU9B 1QJ6B 3OTPA 4RT0A 4AC9A 5I25A 1M9UA 2A4RA 2W6ID 1F7ZA 3T28A 2PHBA 1BIOA 2KM0A 1MD8A 1DFPA 2QAAA 2W3IA 3PRDA 1NT0A 1ETSH 3C27B 1ANEA 4ESTE 2XXLA 5DP7A 2Y5GA 3N7DA 1AO5A 1Q2WA 1EB2A 1Y5UT 3A89A 3DUXH 3PLBA 3ZZ3A 1NT1A 2FOMB 3U7UG 2BVSH 1TBRH 1O3CA 4FU9A 4BAOB 1EX3A 2Y82A 1BB0B 4CRAA 1C5ZB 1GG6C 1YLDA 1SFIA 6CHAC 3LN0A 1DS2E 1WHEA 3HGNA 4MG3A 3RXHA 1QQ4A 1THSH 2G51A 1ATBA 2ANYA 1QIXB 1TALA 4TSFD 2HOBA 4K1SA 1W14U 1W0YH 2Z9GA 2WHXA 3QK1A 1L4ZA 1V3XB 4UFDH 5I46H 3AVZA 1K1JA 3V13A 4ZMAH 1KYNA 1N6XA 3QWCH 2WPHE 3E0NB 4JZFL 1O0DH 1AE8H 1GI6A 2D1JB 2JIZD 2J92A 1UHBA 1BTZA 1DY8A 1NS3A 1KLIH 1SGQE 1OSSA 2TBSA 1MMJN 2OC8A 1UTKA 2XYAA 1O5DH 1C5QA 3ATWA 2ZTZA 1P3CA 1M1XB 1SG8B 2RA3A 1O2OA 1CGIE 4XOJA 1G3CA 3LJJA 3SUGA 4CBOA 3N7EA 3QMOA 3KQ5A 1GDQA 3PO1B 4IGDA 4J2YB 1GHWH 4I8HA 3AK5A 3EA9A 8ESTE 1DITH 1G2MB 1ARBA 1MKWH 1ANBA 1SI5H 2VWNL 1ZMLA 1LPGA 3BTME 2BYAX 1GWAA 3P5BL 2AERH 4GLYA 1HLTH 1ORFA 1KSNB 1YM0A 2BTCE 1EASA 1V2PT 1QR3E 3GCNA 3HO4A 2JKHA 1COWD 4INHA 3SU2A 1E36B 2WINI 2P93A 2DE8A 4AORA 4R8TB 4MQAA 1YPJH 5EU8A 1IQLA 3LC3A 3U9AH 1O2XA 2BM2A 2J94B 2NWNA 5JB9E 3QZRA 4Z0KB 3LGVA 5C0TA 5C17A 5L2ZH 1O2RA 4AOQA 1FY8E 1WV7H 1D6RA 3MH5A 3GCHB 3V12A 4A5TS 2K0QA 1TMUH 1JIMA 4JZFH 5ESTE 3KQDL 1BMFD 2Z7FE 1BCUH 3MTYA 4FUDA 3WWBA 1GBDA 5DK1A 5AHGH 1NRSH 2ANKH 3ITIA 1AE5A 2WYJA 1P3EA 4DY7B 2OK5A 1O38A 2ZNKH 1UTNA 5JBCS 1PPZA 4Y7BB 3KQCL 1BMNH 2JJ2D 2BQWA 1SHYA 2D8WA 2O8LA 2BMGA 3F9GA 4NSVA 5KECA 6CHAB 1Z8RA 1PQ8A 4YO9A 1QRWA 2W26A 2HVXA 1N8OB 3A82A 3ZYIB 2CJIA 4AYVB 3OU0A 2AGGX 4Z1MD 4ABAA 1QHRB 3PM3A 1FN6A 7LPRA 4DJZB 4IC5A 3VEQB 3TK5A 4ZAEB 5HIYA 1TLDA 1W0JD 1LDTT 2YGOA 1KTSB 1W11U 1UCYH 3UWJH 2W26B 1NESE 1TA2A 1NBME 3P95A 4FU7A 4O3UA 1J15A 1LMWB 1HAGE 1MOXC 1EGFA 1VITF 2VH6B 4NZLA 1NFXB 4X1QU 2VNTA 2B8OH 3M3SA 3ZZ6A 4AB8A 3GCWE 4Y7AB 2VGCB 2RG3A 3LC5A 3LAQA 1WYKA 1QFKL 2BOHB 3E0PB 2UWOB 4X8UL 1AMHA 1JRTA 2FTMA 4IN2A 1MZAA 1YLCA 3GY6A 5KGOA 1NFYB 1K37A 4Q7YA 2J38B 2BHGA 4BAQB 1GI3A 3M3VA 1PQAA 4LXBH 3N99A 2KCOA 1HGTH 4WXVA 1KIGH 1HXFH 2VIVA 4XBDA 1HB0B 3TH3L 1Y3UA 2FXRA 1OP0A 4A1VA 4HFPB 2Z9JA 1SR5C 4WMFA 4BTIB 3IITA 1TPOA 3N8YB 3KF2A 3GY5A 3ZZ5A 1TX7A 1TBQH 4Q80A 4ISHL 5EGMA 1T7CA 4LK4A 1LPKB 1C5SA 1QB6A 4ISNA 3EYDA 1HAZB 4RRWA 1W0ZU 2FI4E 3EA8A 3RXEA 4NZQA 4DW2U 4I8JA 3O8CA 3I78A 5L30H 3CENA
chains in the Genus database with same CATH topology
1W13U 1XKAC 3RXJA 1Y5AT 3NK8A 2A4OA 1NTPA 3IWMA 3S9AA 1F7MA 1GGDB 4FU8A 5GDSH 2VWOL 2WPMS 1ZRBA 4JMYA 1E37B 8GCHF 1P10A 2OLGA 2FTLE 4CUDA 2AGEX 1QB1A 1C4V2 2G8TA 4E7NA 1CQQA 1W8BH 4I8KA 5HYOA 1GVZA 1A4WH 1QBOA 3P8NA 1SGTA 1FAXL 1LHEH 2F9PA 2ALPA 2BOKA 3RXBA 2XBWL 1UTJA 1GDNA 3LOXA 1AUTC 1RD3B 4NIXA 1JIRA 1TFXA 1GJ5H 4MMXB 2G81E 2A2XH 4CH8B 1G1TA 4X1RU 1ZTLA 1F5LA 2SGAA 4B2CA 1IJQA 1G1RA 2BD7A 2IPHA 2SGFE 3S6XA 1FNIA 2Z9IA 5FPYA 1C4U2 1YO8A 1PPCE 2WPKS 3DA9B 5AVDA 4K8BA 1GBMA 1DUAA 1ELDE 2GCTB 1IQLL 2PR3B 3LKWA 5IYTA 3LGWA 1O5FH 1C2GA 1SGEE 3PWBA 5ESBA 1OP2A 1SL3A 4Y0YE 2STBE 1WOFA 5BRRE 1E0FD 2VVUA 5E8EH 1CA0B 7KMEH 2BD9A 3RXQA 1KLTA 1UMAH 2OBOA 4BTUA 1Z71A 2O9QA 2P8OC 2J34A 2OC0A 2ZC9H 2OQUA 4NIYA 4ZXXH 5DP9A 1C1MA 1GJ4H 5C1YA 2FLRL 2FOEA 1TQ7B 1TX8A 5COXA 1GJ7B 3ZZ7A 2ASUB 2A5AA 1ZAQA 2C8YB 1A0LA 1SGNE 1A1RA 3MWIU 2NU1E 1VJ9U 2EC9H 1NN6A 3T5FH 1YPMH 3SORA 1GVLA 2PUQL 4D0FA 1ZYOA 3CS0A 4ISLA 4OS6A 4RSPA 1P9SA 4A7IB 1YPHE 1TA6A 4ISIH 5EXMA 1GMCG 1PFXL 3FZDA 4Z0KA 1T31A 1H9IE 3A88A 5A0CA 3MU5A 4GAWA 4MPWA 4YT6H 1TMBH 3SOVA 2VH0B 2UUFB 3RC4A 3FP7E 1BZXE 2QC2A 4Q2KA 4WJG2 3LC3B 2A7CA 3F9EA 4A1XA 3POYA 3F6UH 4MNVA 1O3KA 5A8ZA 1CU1A 2WPLS 1SQTA 4H42U 4JCNA 5A2MH 2GD4B 2FP7B 2CXVA 1XXDA 3AW1A 2WYGA 1NY22 2DE9A 4K69A 2Y5HA 1P2IA 3A7VA 2ZP0H 2D2DA 2FOGA 1ZJKA 3SV6A 4FM5A 1GCTC 3FP8E 1UO6A 3GOVB 3CENL 1UCYE 4ABFA 4A7IA 1EPHA 1GBCA 2CV3A 4DG4A 1ADXA 2ZKSA 1TRMA 4H4FA 3KQEL 1K1PA 2ZHWH 1B9WA 4THNH 1TGNA 1C1VH 3DT0H 2ZGJA 3ZVCA 3I77A 2A0QB 3RXTA 2VIQA 1IOEA 1NRNH 1O2PA 3MU1A 1O5AB 3H7TA 1V2VT 3QX5H 4DCDA 1TPGA 1LVMA 3E1XB 4MPVA 3EGKH 2AMPA 5GCHG 1TONA 1EOLA 3Q3YA 4A94C 3LGIA 1GPZA 1HBTH 1O3PB 1Z1JA 4K60A 2H9TH 3HGPA 1L1JA 1WCZA 1S82A