4BXWA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
322
structure length
286
Chain Sequence
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
molecule keywords FACTOR XA
total genus 69
structure length 286
sequence length 322
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxwA02
4NA9L 2FX4A 2A4GA 4THNH 1MU8B 1SGQE 3TK5A 2WPMS 3OTJE 4AYYB 1S85A 2UWPA 1TOZA 1O30A 1O0DH 5GDSH 5COXA 2PSYA 2Z6BD 1O31A 4D9RA 2K2SB 3STIA 1HNEE 4Q7XA 1AVGH 2AFQB 4NZQA 3OLUA 3LC3A 4IBLH 3Q7DA 3U7UG 2BOKL 1HAXB 1A46H 2BLQA 4X6MA 3ZVFA 1YM0A 3A7WA 5JVYA 1O3MA 3KL6A 2Y5HL 1LHDH 2PTCE 3MNCA 1HDTH 4MQAA 5JBAS 1EMOA 1JV2B 1B0FA 1UHBA 1PPBH 1GJCB 3QWCH 2PWXA 1ZYOA 1CU1A 1XX9A 2VWNL 3N8YB 1F7EA 1TX6A 2ANMH 1CEJA 1JRSA 3A80A 1GPZA 4IC5A 1MCTA 1UCYE 3BN9A 5F8XA 3TJOA 4RRXA 5JBTA 1D9IA 2FLGA 2ZQ2A 2F9NA 1YPLH 2HALA 1GHBG 1S0QA 2OC7A 2PR3B 1ZTLA 3QCWA 1E0FD 4I31A 4TWWA 4MMYB 4WH8A 1NRRH 3ELAL 3C9AC 2HNTE 2R0LA 1FSBA 1BMLA 3ENSB 1ELBA 2BDCA 2BVSH 1F0SB 1IGXA 1O3AA 1UTJA 2ZF0H 2TGFA 2ZTXA 1IAUA 1LPZA 2GT8A 1O3KA 1VJ9U 2W3IA 1GBJA 1PQ8A 3JZ1B 1HUTH 2IPHA 2F3CE 4Q2KA 1BCUH 1BOQA 2G55A 1IOEL 3MNXA 2CMYA 1C2FA 4BXSA 1TGSZ 2ZU4A 2B8OH 3HGPA 3PLKA 4YOJA 1ANDA 4Z0KB 1IQFL 2Z9KA 1Y3UA 1O32A 1GHYH 3A7ZA 4ISHH 2P95A 3TLOA 1RD3B 4CH8B 1D3DB 1BMNH 1TNLA 1O3HA 1O2WA 2BOKA 1NY22 4M7GA 2GP9B 3SGBE 2KB9A 3DA9B 5KIRA 3RP2A 4ZXXL 2SGDE 5IKRA 3GDUA 3QZQA 2AH4X 1FAXA 1D6WA 1E35B 1C1PA 5JVZA 3P6ZB 2VJ1A 1GWAA 2WPIS 1SBWA 4CUEA 4K60A 1CQEA 1TMTH 2BOHB 4AFUA 1LHCH 8KME2 3EE0B 1QRXA 2VGCC 1TQ7B 2ULLA 4DVAU 1O5BB 3NXPA 4ISHL 5EQQA 1F5LA 4CHAC 1LHFH 2K1QA 3ZZ7A 2FOCA 1SQOA 2FLRH 1GBCA 1UTOA 1A61H 1BUIA 4U01A 5IKTA 1IOEA 4YO9A 4O03A 4JZFL 1Y3VA 1C4Y2 1QBOA 3MOCA 1T4VH 5GPIB 5JBBE 1C5LH 2ZEBA 3PWBA 4UFEH 1EPIA 1NO9H 1KLJL 3BTKE 1ANEA 5I46H 1S0RA 4CH2B 3B8JA 1PPEE 7GCHG 1DVAL 4X8SH 2GV7A 2A0QB 2XCFA 3D62A 1C5QA 1XXDA 2ZKSA 1UO6A 1MKWH 1RFNA 2ZGCA 1IQFA 1GG6B 4R8TB 4UFFH 3MQEA 1YCPH 1FY4A 1KLOA 2IN2A 3MH5A 4M10A 3ZYJB 3OY6U 1A2CH 2VB0A 4ISNA 2Z9IA 2FMJA 2OUAA 2TGAA 1A3EH 3E0NB 4I8KA 4UFDH 3T62A 3T5FH 1CA8B 2OBQA 1GI4A 1V2MT 3LPRA 4ISIL 1TWXB 3M5NA 2PKAA 1W7XL 2ZFFH 5FPTA 1IP0A 1O3DA 5TCAA 1OWDA 4Q7ZA 1DUAA 4D0FA 1F0SA 3A83A 4X1NU 3M5OA 1FAKH 2H5CA 3NCLA 3H5CB 2G5NA 2TGTA 2ODYB 5LPRA 1LVOA 3ZVAA 1WQSA 2BQWA 4JYVL 1OWIA 4JZDL 1MMJN 3KQCA 3QGNB 1C4V2 4Z6AH 4XBCA 1S6HA 3BIUH 1W0ZU 5IDKA 1ARBA 4ZKNU 1P05A 1HB0B 4DG4A 3ZVEA 1DWCH 1QRWA 1BRUP 1SR5C 1UZPA 3BTFE 1DVAH 2FI3E 3L33A 4BANB 1Q31A 3AASA 2ALVA 4IMQA 6LPRA 2UWLB 3NJPC 5LPEA 2BDIA 4WH6A 3FANA 3RXDA 1Q4GA 2V0BA 5L2YL 3DFLA 1O2QA 5J4QA 3QTVH 1RTKA 1V2NT 3RXUA 5C20A 2SGFE 5CHAC 1J17T 1SFQB 1MD7A 1SPJA 2RNLA 2HRVA 3Q3YA 4ZH8A 3SQHE 1GJAB 3V13A 3F68H 1SGIB 3AAVA 1Z8IB 4YT7H 3PMBB 2QYIA 1AE5A 1GJ4H 1QQ4A 4PROA 1ZPZA 2C8WB 1KXEA 4JYUH 3ZVBA 2WPKE 2G52A 1TRMA 1FFMA 1F7ZA 1BT7A 5L2ZL 4NG9L 1WU1A 1K1JA 1SHHB 1AFEH 3AVZA 5HM9A 1AKSA 2O8WA 1HXFH 2SGEE 4CRCA 1WHEA 1NU7B 5A0BA 2NU2E 4JZFH 2BMGA 1UVUH 2ZU2A 1WCZA 3MI4A 4INKA 3LC5B 2GZ9A 2VWLA 1VR1H 2XC5A 1BHXB 5J4SA 2A7CA 1K1LA 2P59A 4MDSA 1GL1A 3GCTG 1SQAA 1T32A 2BVRH 2A5KA 5F03A 3JZ2B 1RTFB 2CXVA 1YCPK 3QH0A 3QMOA 1B9WA 3QGJA 1V2VT 1ZGIA 2ZFRH 1N1LA 1BQYA 1YUFA 2R3UA 1C5SA 2O9QA 1O38A 2XBWL 1GDNA 1XUIA 3MH4A 5ESBA 5CISA 2J94B 2Y38A 4FUCA 1O2HA 1W10U 1K1IA 2JETC 3GICB 3P8FA 1TRYA 3F9HA 2FZZA 2BD3A 1Z71A 3NTBA 1GBLA 3ENSA 2ZGHA 5C5OA 2BY7X 3BG8A 2Z9LA 1NFWA 3KQEA 4U2WA 1C9PA 4U32A 4A1TA 1W7GH 5GIBA 1VZQH 1HFDA 1HPGA 1WTGH 3SJ9A 2QGRA 4FM5A 2FI5E 8GCHF 4ZHLU 4X2VA 3E91A 3TZIA 1N6XA 2ZDKA 4CBOA 3R3GB 1BTHH 3BT2A 4NSYA 2A4QA 2ZPRA 3LGTA 4JZEL 1Z1JA 4DT7B 1IQMA 1LKBA 4D7GA 3LJOA 1KSNB 2VWLL 2VGCB 1JMOH 3RXBA 2BZ6L 4BNRA 3SNAA 5AF9H 4Y76B 1Z1IA 3M3VA 4GUXA 3TK9A 1FY1A 3EA9A 1HAFA 1DIYA 1MTVA 1PQ5A 4J2YB 1TRNA 2BD2A 1O2YA 4WXVA 2WV4A 3P92A 3NK8A 1GJ5H 4X1SU 3A8BA 3UR6A 2G5VA 3TJUA 3FZZA 2OLGA 2FYRA 3F6UL 5L30H 3ZV9A 2UWPB 1NESE 1W2KH 3UREA 4XBDA 2TGPZ 2ZCHP 1D3TB 1EJNA 2CJIA 1EUFA 3DFJA 5L2YH 4GPGA 1ELTA 1JBUH 4MPWA 2ZQ1A 1L0ZA 3TGJE 4BOHA 3LAQA 2FZZL 3BG4C 4IMZA 1EZQB 1MOXC 1OWKA 4ZUHA 5AFZH 2PV9B 2XBYA 1O2KA 1CA0B 1BTZA 1UZKA 1EJMA 1TE0A 1YYY1 3RMMH 3RXRA 4D76A 1LO6A 1O2PA 1GI9B 1APQA 2ODPA 1NFYB 3DD2H 1UTQA 3TU7H 1V2ST 3RXQA 2BB4A 5EPNA 4FXGH 4ZXYL 4TPYA 4UONA 1HJAC 4LZ1H 3TPIZ 5K7RA 3ZYIB 1APOA 2EI8A 2TBSA 4HI3A 3RXEA 2Y5GL 1SI5H 3TK5B 5FX6A 4CR5A 1CE5A 1T4UH 1ZSJA 1KDQA 2H9TH 3E3TA 1LTOA 3PYHA 3FFGL 3PTNA 1ESBA 2WPLS 3RXFA 3L3TA 2PSXA 4Z0LA 1THPB 1WYKA 4K69A 2D2DA 4IN1A 2VWOL 1UVOA 1K22H 5LPFA 4OS5A 1LPGB 3PLPA 1ZHPA 3ZVCA 1VITH 2XC4A 2XTTB 1GHBF 3MU0A 4BTUA 1C2LA 1C5WB 1HJ9A 1P0SH 2FTLE 3A7VA 1C2IA 4LK4A 1SGEE 2BDBA 2W2PE 4BAKB 1C5RA 2BVXH 2J38B 2VIQA 1O2LA 1KXAA 1TPAE 2BLWA 1ABIH 1NT1A 1A5IA 1SHYA 2PUQL 4NA7A 1HGTH 2ILNA 1AE8H 1O3LA 3S0NA 4YT6L 1GBTA 4H6SB 1V6DA 4YOIA 4KTSA 1O5FH 2P3FN 2O8UA 1L1NA 2XW9A 4DGJA 1H9HE 2FEQH 1IQEA 3ZZ8A 5L6NH 2XBVA 1NM6A 2P3FL 1O5EH 2O8TA 4E06H 2AMQA 1BTYA 1O3CA 6GCHF 1Z6EL 4DY7B 2QXHA 3S7HB 3SBKA 1CCFA 1C5NH 4Y0ZE 3HS5A 2BOHA 3BTWE 1G1QA 1IQIL 3Q3KB 5SGAE 1EP5A 3TGFA 1EX3A 1DDXA 1AHTH 4BTTA 2VVUL 1FPCH 3ATIA 1FAKL 4DCDA 5EQSA 4ZKRU 1CX2A 1E36B 1SG8B 3LGYA 2EI6A 1KYNA 2FP7B 4ZHAA 3QK1A 4IGDA 5HYOA 5EOKA 5CKNA 4DIIH 1RJXB 1JBUL 1WHFA 1N1IA 2GZ7A 3V7TA 2B5TB 4YTAA 1HT5A 4TWYA 3RXLA 3VB5A 1DX5M 3NTGA 5FPSA 2F83A 1SGYE 1TA6A 2RDLA 2F9OA 2G8TA 1FY5A 3KCGL 1EKBB 1LVMA 2P16L 3SU2A 1QFKL 2AGGX 1EOJA 3S9AA 1DQBA 4E05H 1KTSB 2GD4A 2FX6A 4ZROA 3LC3B 3V3MA 1DFPA 3BTGE 2AMDA 2GMTB 4RRWA 2ZGBH 3SGAE 1P09A 2ZIQH 1BTWA 1RFNB 1HREA 1KLIL 3VB3A 1W13U 1HCGB 4WVPE 1O36A 2IOTA 1A4WH 1P2QA 1YPGH 3SUGA 1UK4A 1NROH 2WPJS 1T31A 4RRZA 4UEHH 3GOVB 3RXCA 3SNCA 2ZCKP 1C2HA 4NA8A 3MU5A 2Z9GA 1QA7A 2GCTB 1J9CL 4BTUB 1GCTB 4MPUA 4ZKOU 1MKXK 4FUHA 4HFPB 1RGQA 2YNAA 3AW0A 2VWNA 2BDHA 4TY6A 1LVYA 3NT1A 1YLCA 2BO2A 5DG6A 4D7FA 3ZZDA 3LGVA 3BTEE 4AYVB 2ZFPH 2SGQE 3AAUA 4VGCB 4TPIZ 3U8TH 3LH3A 1ATAA 1N7DA 1ATDA 1QJ7B 1NFXA 3GISX 2D8WA 3LIWB 1GMCG 1QFKH 1O2GH 4ZH8B 1C5MF 4B71A 1EOLA 4OGYA 3TGKE 2IJOB 2FOEA 1MZDA 1CVUA 5EPYA 4O02B 2FYQA 2F9VA 1LQEA 3PMAB 1W0YH 2QF3A 1YKTA 3PM3A 1JRTA 5BPEA 1EZSC 1NT0A 1JL9A 3M37L 1EPGA 4ISIH 1K1OA 1SLXB 1VCWA 1IQKL 1GI1A 3N8VA 4FU9A 1HAPH 4BTIB 4Y79A 1PPFE 1AN1E 2PUQH 1TIOA 3Q76A 5JB8E 3VFEA 3SUDA 3H7OA 4RKJB 1CQQA 1QB9A 1C5UA 1MD8A 1KLIH 1CVWH 1DUEA 1VITF 3RLYH 4ABJA 3EYDA 2ZFSA 2P3TA 1YGCH 2BD4A 2P28B 2XWAA 3IITB 2CHAB 3E1XB 1ADXA 1ELEE 4FUJA 2ASUB 1GBBA 1RIWB 1ZGVA 1DITH 1G37A 4CRDA 2JH5D 5I25A 2WFTA 4G1MB 2GMTC 2WYJA 3I77A 1O2XA 1T8MA 2VVCK 3ATKA 1DWDH 4IW4E 3RM2H 1TGNA 7ESTE 1CVWL 1UK2A 4BDWA 5B6OA 3VPKA 1WU1B 2QIQA 1QA0A 1IJQA 4QT8C 1GI8B 2R2WU 4CR9A 1HXEH 3HGNA 1AIXH 3ZV8A 2C93B 2J4IA 1UHBB 3A82A 3K65B 5HXFA 2P8OB 2WPHE 2BY6X 2SNVA 1DX5I 3PTBA 1EJAA 3KNXA 3T25A 2A31A 1LDTT 2W2NE 3K9XB 3U98H 4AORA 1G3CA 3V0XA 1AVWA 1K2I1 5AVDA 1O3NA 4AB8A 2BDAA 4SGAE 2BQ7B 1SOTA 1LMJA 1FIZA 5EW1H 1G2MA 4MMXB 4BXWA 1BMMH 1O3BA 2JETB 4X8UH 2ZA5A 4BAQB 5C3NA 1X7AL 3K9XA 3OU0A 4Y7BA 3E90B 1NZIA 4X1PU 1J8AA 1Y3XA 3N8ZA 1IQNA 4FUEA 1ELAA 2Y82B 3M5LA 1H1BA 1FNIA 1QIXB 2PHBB 3A87A 5C1YA 1WBGB 1YPJH 2PHBA 2ZDAH 1TONA 1H9LB 3HS6A 1A3PA 2WUCA 1O5CB 4NWLA 4IS5A 1GBHA 3KRKA 5L30L 1PPCE 1URKA 1F92A 2M74A 2DUCA 1G2MB 1MQ6A 4NWKA 4O3TA 4Y7AA 1TOCB 4D8NA 1GBKA 1AB9C 2ZGJA 1F2SE 1P8VC 1GBIA 3POYA 4NFFA 3TIUA 2W26B 4K1TA 5GWZA 1FN8A 2ZHDA 1PRHA 1V2UT 2A5IA 3KHVA 4X8TH 1QR3E 1TBRH 1WAYB 1RRKA 3KQBA 5E0HA 1G1TA 2BXUH 1DWEH 1V2KT 1JWTA 4KGAA 3KCGH 4RRYA 2XBXA 2OC1A 3P8OA 1GBAA 1XUFA 2Y81A 4CBNA 1AKSB 4O1ZA 4MVNA 5LH8A 3F6UH 1L3YA 4BDXA 3D65E 1M1XB 4KTCA 4CSYA 3KIDU 1DDJA 3R05A 5A8XA 1A5HA 1GI5A 1AFQC 1SC8U 4NSVA 2FOMB 1F5KU 3F1SB 3MWIU 1TBQH 2J38A 1GHAG 1GJBB 1TGCA 1MQ6L 2YGOA 2NU3E 3Q00A 1G1SA 3KQDL 2P16A 5A8YA 5E0GA 5F6MA 1ZMLA 1SVPA 1BA8B 1JXPA 1IHSH 1XM1A 2WINI 1MH0A 2CGAA 3LTFB 1W11U 1OYTH 1MAXA 3KL6B 1XKBC 3A7XA 3ATWA 1NFWB 4I7YH 1G2LB 4XBMA 1KIGL 1NRPH 1GK5A 1CHGA 1QY6A 1HAZB 3TITA 1F5RA 4CUFA 3RXJA 1AFQB 2J94A 6GCHG 1CBWC 1HJ8A 3FP7E 1W14U 1S5SA 3HKJB 2FOAA 1I0UA 1V2WT 1XUJA 2VVCA 3CFWA 1FDPA 4Y6DA 1ZSLA 1DLKB 4X8UL 1Y3YA 1AO5A 2HPQH 3BEIB 3MO6A 4HZHA 1O5DL 3CENL 3KQBL 2W3KB 1GHXH 5IYTA 2DE8A 3RMNH 1FQ3A 1HAGE 5T3HA 2BY5X 1NTPA 1GHVH 2UUJB 5HM2A 1TLDA 1Z6JH 1C2MA 3M3TA 1V3XA 2PKSB 1TALA 5FAHA 2GD4B 2VVVA 1XVMA 4R0IA 8LPRA 3VXFH 3DEMA 2XWBI 2Z3DA 1KXBA 1GCDA 1PPZA 4XSKU 1CGHA 2BX4A 4A5TS 2ZDLA 3KN2A 1TGBA 3SU3A 3A88A 5A2MH 1ELCA 2ZGXH 1OX1A 1M9UA 1O34A 1IQHL 1XUGA 3MH7A 2VINA 3BIVH 3HKIB 2WPHS 1ARCA 1G30B 1MU6B 3CENA 4KKDA 3GCOA 1NFYA 2W7SA 1ZZZA 1DY9A 2C8ZB 2STAE 3RXMA 1G1RA 5FDQA 1Z8JB 1PPHE 4JZEH 1EGFA 4NGAH 1OOKB 4KELA 1MZAA 4WMDA 1NFUB 1CBWB 3LGUA 4E1GA 2J4IB 3ODFA 3U9AH 4NFEA 2HNTF 1UTLM 4B76A 2FXRA 1O2SA 1TPSA 4NIYA 3A85A 5ETXA 1JIMA 3UNRA 1TQ0B 3P17H 1OWHA 2H6MA 1DXPA 1AI8H 3RC6A 2VVVL 1EB2A 4ABDA 3SHCH 1G36A 3MNSA 1SGFG 3N7OA 2QF0A 3KK6A 1SMFE 2Y80B 1O2NA 2A32A 3M36L 1LQDB 2G4TA 2UUFB 3TK6A 1Y3WA 1TX8A 2R2MB 4B2CA 2ANYA 5EU8A 1QNJA 1TGTA 1SLVB 1YLDA 3ITIA 1KXCA 1ZMNA 2ZHEH 1Z8RA 2FD6A 1E37B 2P94A 3IJEB 1C1UH 1IGZA 1FY3A 3SOSA 4GAWA 1OS8A 2PKSC 2W2ME 1YP9A 1ELGA 2Y80A 1ZJDA 1OB1C 5CKQA 5EGMB 1ESTA 4HGCA 2W26A 1W3CA 1T8LA 1EZUC 2OC0A 1BDAA 2Q1JB 1EMNA 4B1TA 1C1MA 2FIRH 3MU1A 5JBBS 9ESTA 3LC5A 5JBCS 2PGBB 3V64C 2ZO3H 5HMAA 2WPLE 1EXFA 3LJJA 3MHWU 4NCYA 3UIRA 1QL9A 1X7AC 1EQHA 1V2PT 1QBVH 3GY8A 1SQTA 3HK3B 1P2KA 3EQ0H 4ABIA 5C1UA 4E7NA 1C2KA 3RU4E 3EA7A 3RXTA 2GZ8A 2VIPA 5DJ7A 1C5MD 1HAYB 2VH0A 4B73A 2BD9A 2HNTC 1V2RT 1AWHB 4FUDA 1HJ7A 3QDZB 1UK3A 1ZR0A 1EBVA 2NU0E 4JMYA 1LVBA 3QUMP 2PFEA 1YCPM 2CN0H 3CA7A 1UTPA 2ZNKH 2BQ7A 3RLWH 4A1XA 4K8BA 3T26A 3O8CA 3TNSA 1HV7A 3RMOH 3URCA 4PH9A 2QXIA 2UWLA 1O2TA 3MTYA 2VWMK 2ANWA 1LHGH 1ZHMA 4AFQA 3A7TA 4Y8XA 3D23A 3GY5A 1P02A 1IQEL 4O3UA 2Y7ZB 2XBVL 1TBZH 4GHTA 5DK1A 3SV8A 5A0CA 1HBTH 3ZZCA 1Y5BT 3Q3XA 4FUFA 3PV4A 1PYTD 5DKMA 4I8LA 1B7XB 1ID5H 5FCKA 4X8VL 2QXGA 4XDEA 4I8JA 5DP9A 2FOGA 1D3PB 1IVOC 1MTSA 2P3UA 1O2MA 1CT2E 3RU4T 5LGOA 2FLBH 1W7XH 2C4FH 4ABBA 3CP7A 4VGCC 4ISOA 1G3EA 3ATMA 2AYLA 1NRSH 4AGJA 4RN6A 4WJG2 2WPME 3GCTF 1IQLL 2EI6B 3SJIA 4CRFA 3TNTA 3U8OH 7GCHF 2Q6GA 1L4ZA 4BAMB 2HWLB 1BRCE 1YPKH 1F0RB 1INCA 3RXSA 2OCVB 1BTXA 1G3BA 1O35A 2KL7A 2XXLA 2NU1E 2J2UA 5CHAB 3QN7A 3S7KB 2FO9A 1C1NA 1J15A 1DS2E 2J95A 2H9EL 3RM0H 1MUEB 2W86A 2CF9H 2NU4E 1GCTC 1MTNB 4BAHB 3SU0A 2WPIE 4K3JA 1ZTKA 2MHPA 2V35A 1QJ6B 2Z7FE 1O39A 1EP6A 4AN7A 1ZMJA 1H9IE 1NFXB 3SOVA 1EB1H 1GMDF 2HVXA 3RXKA 3SJ8A 3CS7A 5JB9E 1FJSA 1T8NA 2ZU1A 1GI6A 2XC5L 1GI3A 5GCHF 1SGCA 1TMUH 5EXNA 1SL3A 1VGCC 4AGKA 4X2YA 4ABHA 2XC0L 3S9BA 1IQJA 6CHAB 5CKMA 1ETTH 4JK5A 1GI7B 4Y76A 1O2UA 1WSSH 2WYGB 2ZDVH 2FOHA 1Q2WA 4C16A 1PGEA 3GCNA 2C8YB 3E0PB 1VCQA 2GDDA 2ZHFH 3HK6B 1P11E 1PXXA 3VGCC 5E8DA 1Y5AT 3ZZBA 2FS8A 5FX5A 1SGPE 2TGDA 1DT2A 4XL1A 2R0KA 1CGIE 1DE7H 5ESTE 2ZP0H 1QJ1B 4J1YA 2HOBA 5F19A 1UVTH 2DE9A 3MNBA 7KMEH 2ZCLP 5JBCE 2WUBA 1A7SA 4H4FA 4F49A 4BTIA 4X2XA 1NN6A 2ZFTA 3A89A 4AG1A 2ZG0H 4YM9A 3HPTB 1C1WH 1P01A 1PTHA 3W95A 4D90A 3SORA 1AVXA 4ZHAB 4X1RU 3D49H 1NRQH 5PTPA 1EAIC 2ZC9H 3NPSA 2QCYA 3M36A 3RC5A 1VGCB 1MQ5L 5EW2H 4I33A 1ANBA 1C5OH 3FBYA 1SGRE 4GHQA 1CT0E 1F0UA 4MG3A 2XC0A 2I9BA 3U1IB 4DURA 3BEUA 1QURH 5EGMA 5DP8A 4XE4A 1S6FA 3C27B 3VB4A 2FODA 2AIPA 1ETRH 1P10A 4ESTE 1L2EA 1ZOMA 1Z6EA 3DT0H 2GCHF 3ATLA 3LTGD 4I32A 3A8DA 2W3IB 4A7IA 4Q7YA 1P57B 3N8WB 1EZQA 2AGEX 1PYTC 4AB9A 1P9JA 1OWJA 1BJUA 2GCTC 3GYMA 1FIWA 1P2MA 1YF4A 3OYPA 1EPJA 1T7CA 3ASIA 1GBFA 1NPMA 2XBYL 1HX2A 4I8GA 1Y8TA 1P9SA 4FUBA 2A1DB 3C1KA 1OPHB 1THSH 2P8OC 4JZIA 1AUTC 1U8CB 2WPKS 2FDAA 2W7UA 5DP4A 2GTBA 2BOXA 1P2OA 2A2QH 2BDYA 9LPRA 1P3CA 1CA0C 3IITA 4HTCH 1IQGA 3BEFB 5HGGA 3GCHC 1HJAB 3UWJH 3BG4B 2VNTA 1G3DA 1YPHC 1C2JA 1E38B 4K1EA 1FMGA 2VIOA 2BD5A 1GHZA 1HIAA 4Y7AB 1GBDA 1P03A 4XFQA 1AZZA 4X1QU 2CHAC 2XCNA 4O97A 1THRH 3ZZ4A 2BHGA 1MKWK 4X8VH 2D1JA 4Y71B 4RUTA 2ZECA 2A7HA 1O5DH 4TY7A 4IC6A 1V2LT 3SU1A 3K6ZA 1QB6A 4GVUA 3N8XA 3GY3A 3NUMA 2ZU3A 2P95L 1PQ7A 2Z3EA 5DPAA 1HAIH 2FWWA 2OP9A 2R3YA 2P3UB 3IWMA 3PMHB 1FI8A 1N8OB 2XRCA 3MO9A 3VB6A 1G2LA 1HLTH 1O2ZA 2QAAA 2EEKA 1C5XB 3UNQA 4OS6A 2OTVA 1S81A 3LKWA 1A1RA 1BJVA 3ZVGA 1GDQA 2SGPE 4RSPA 5T6FA 1SGDE 4ABGA 1ELDE 5FBIA 2C3SA 1DANH 4MNVA 3GY4A 2YNBA 2BLOA 1C2EA 4JK6A 1U67A 4ZXXH 3QLPH 2W3KA 1YO8A 2ESTE 4Y0YE 1H8DH 1QGFA 2JKHL 1P2JA 4YLQH 3SNDA 3LU9B 1NRNH 1T8OA 2KAIA 4CRBA 2JH0D 3I29A 2V3OH 1TB6H 3MDLA 3V65B 3HO3A 2PTNA 4MTBA 1PQAA 3RR3A 3GDSA 1U6QA 2GVFA 2FOBA 4A1VA 1F0RA 3BSQA 1O3FA 1P3EA 2NWNA 4H42U 4MNYA 3T28A 5K0HA 4TYDA 1GJDB 2Y5HA 3SW2B 1EQGA 1O3EA 3HATH 3AW1A 2ZDMA 1BRAA 3M7QA 2BXTH 1HZ8A 4XBBA 1CSOE 3A84A 3TH4H 1CO7E 4WXIA 2EA3A 1O2RA 1O37A 1A3BH 2O8MA 2SFAA 3E6PH 3U69H 5JBAE 1PPGE 4CRGA 3SO3A 6ESTA 2G00L 2Z3CA 1FN6A 4AX9H 1GJ8B 4MPXA 5H4IB 1XMNB 2PR3A 2BY8X 3RU4D 3S69A 2I9AA 3M7UA 1K1PA 2PW8H 2C8XB 2CF8H 4BTTB 1C5TA 1FY8E 3TGIE 1IQHA 1C9TA 1XVOA 4E7RG 1GVLA 4O9VA 3FP6E 8GCHG 4D9QA 2Z9JA 1LHEH 3TVJB 2TRMA 2I6SA 2J2UB 1TNGA 4U30A 4Y11E 1O3OA 1C5YB 1P2NA 2BDGA 2BD7A 1ZHRA 2P93A 1O5GH 3A8AA 3MYWA 2B7DH 1O2OA 1MTUA 1V2TT 2JKHA 4OS1A 1UZJA 1V2QT 1ZTJA 2C90B 1IOXA 2ODQA 3MH6A 4WY3A 2FLRL 3SOQA 4D0EA 1ZSKA 4UDWH 1P06A 2SNWA 1ZAQA 3MO3A 1DLEA 1GMHF 3LIWA 1AZ8A 6COXA 2Y5FL 4YESB 3K2UA 3BPSE 1UMAH 3RXHA 4NIXA 1A0LA 1KXDA 2CV3A 2CJIB 1K21H 3GY6A 4Z6AL 4FUGA 1GG6C 1TPOA 1H8IH 4JCNA 2UWOB 2A5AA 1TAWA 1O3JA 1UZQA 3P70B 1ATEA 3B23B 3RC4A 4I8HA 2P3FH 2B0FA 5C5NA 1F7MA 1AY6H 1GDUA 1BBRK 2BMGB 3M5MA 4CREA 1G9IE 1ESAA 3M3SA 2ZI2H 4YLUA 5AHGH 2OD3B 2ZHWH 3UFAA 1IQNL 2BM2A 1LMWB 2VIDA 3W94A 1UTNA 1BTPA 1D3QB 2QXJA 1DXWA 2ZTZA 3UWIA 1GGDB 3P8NA 1RIWC 5JW1A 1XDTR 2GGVB 1COUA 1W8BH 3BTME 1GHAF 1XKAC 1QCPA 4FVBA 5GJ4B 1VCPA 4LOYH 4DW2U 5L2ZH 2RG3A 3O8BA 3SI3H 5DP6A 3NWUA 2FPZA 3RXOA 2GT7A 2YGPA 2KV4A 1HAEA 5I46L 1YUKB 2OC8A 3E8LA 4CRAA 1EQ9A 4FUIA 3RXAA 1Z7KA 4LZ4B 4X0WU 1K1MA 2Y82A 4KP0A 3HPTA 5EXLA 1HRFA 5JYIA 5FCRA 1MTNC 1EAWA 1OSSA 3MFJA 3UY9A 3LT3A 1KLTA 3KF2A 1F0TA 3NZIA 1ZRKA 1ZPBA 1FZZA 3PWCA 1ACBE 3G01A 3OSYA 2FOFA 1C4U2 1JIRA 3LGIA 2B9LA 3BTTE 3UOPA 3U73A 2XBXL 2GV6A 2H5DA 3O8RA 3FVFB 2V6NA 1FE2A 3KQDA 1YBWA 1ETSH 1C1RA 1GJ7B 3KQCL 3F9FA 2NPRA 2Q6FA 1FV9A 2G51A 3T27A 4AQTA 1LPZB 1L1GA 1O2VA 1KIGH 3GDVA 3ZZ9A 4MNXA 1P2IA 1TLEA 1AB9B 1DPOA 1UVPA 2AEIH 2ZWLH 3M7TA 5CMXH 1ABJH 1L4DA 2J34A 3EGFA 2VJ3A 2PLXA 2OQUA 4XLWA 2PKAB 2Q6DA 3KGPA 1PFXL 3BTHE 1QRZA 2VH6A 2RHPA 3MU4A 4AFSA 4YZUA 4LORA 4H6TA 1NU9A 1TMBH 4FVDA 2OQ5A 1HT8A 1C5PA 2VIVA 1C1SA 1IHTH 1AWFH 4KTUA 1L5GB 1UTMA 2A2XH 1XKAL 2OYEP 4DOQA 3A81A 1JOUB 1HCGA 4WMEA 1GMCF 1MBMA 5EQRA 4CHAB 4Q80A 1XXFA 5FBEA 1WTHD 3OY5U 2QY0B 3U1JB 3F9GA 5A09A 3UNSA 3SNEA 5TCCA 1B0EA 3TH3H 1ZLRA 1BBRH 2O8LA 3BV9B 3BTDE 3MU8A 2BTCE 1EATA 1RS0A 3ELAH 1LPKA 3NKKA 4X8TL 1KY9A 2THFB 4YT7L 1BZXE 1SOZA 2XYAA 1KLJH 1XUHA 1EZXC 1P0SL 2EI7A 2ZPSA 2BZ6H 3SJKA 2SGAA 4COXA 1BRBE 1P04A 2F91A 2Y81B 3GY2A 1C5ZB 3SU5A 1QBNA 4NA9H 1W8BL 1DOJA 2BOUA 3FAOA 3P8GA 5JPMH 5F8ZA 5GCHG 3GCXE 1J14A 1MTWA 1TPPA 3GCHB 4Y7BB 3SV9A 1CT4E 3RXGA 5DGJA 2BQWB 2XNIA 3ODDA 2WFXB 4M11A 2Q1JA 2QN5T 5E0JA 3I78A 1WV7H 3DUXH 1FAXL 2EI7B 1SSXA 5C2ZA 1XFEA 2P26A 2PUXB 2K2TA 3WY8A 1YUGA 1HAVB 2WPJE 2Y5GA 5DP7A 5C1XA 2BQ6A 1Y59T 2G00A 1BITA 4OTYA 1S83A 1ZRBA 4CUDA 1EPTA 1QL8A 3EDXB 2ZU5A 2Y7ZA 1LQDA 3TK6B 1CCVA 1QHRB 1TA2A 3U8RH 2BYAX 1O33A 2VWOA 3GYLB 1BBRE 4ISLA 2J34B 1DSTA 3TH2H 1BB0B 4ZMAH 3KQEL 5BRRE 3TJVA 2OYUP 2P93L 3Q3KA 2OINA 1SGFA 1Z8GA 2MGRA 5JB8S 1C1TA 3B9FH 1O3GA 1TFXA 4RS0A 4DJZB 2VH6B 2P3TB 4RKOB 1GJ6A 1O5AB 1QQUA 2FS9A 1OP2A 2Y7XB 3Q77A 4X8SL 3SI4H 1AU8A 5GXPA 2P94L 2HGTH 4UFGH 1MAYA 4TGFA 2ZZUH 3A7YA 1IQML 1SZBA 1FPHH 3K6YA 1C1VH 1GGDC 2G4UA 3E16B 2WG3C 2J95B 1TYNA 1WOFA 2F9PA 4AOQA 2ALPA 4ABAA 1GHWH 2H2ZA 4B75A 5E2OA 1XKBA 1OP0A 4NIWA 1YGCL 3HO5A 2GCHG 2LNCA 4GCHG 3LN1A 1EAUA 1AUJA 1C1QA 1HAHH 1O2IA 1LKAA 1AMHA 4B74A 2TPIZ 1MKXH 3T2NA 1GI2A 2ZFQH 4LXBH 3PO1C 4A92A 1YC0A 1V2JT 3FCSB 2WG4B 1BF9A 3RXIA 5TJXA 4ZXYH 1CHOF 3ZZAA 1NFUA 5FHTA 2J9NA 2J92A 1ELFA 1HAVA 1UVSH 1ORFA 3TH3L 2PGQB 2RA3A 3SW2A 3SV2H 4OS7A 2AS9A 3PB1E 3UTUH 2F9BL 1BMAA 2AERH 2ZDNA 4MPVA 1A5GH 2RCEA 1UTKA 4JYVH 5E8EH 1E34B 2JH6D 4AFZA 3HO4A 3EA8A 1D4PB 2GDEH 1KXFA 4DIHH 2EI8B 2TIOA 3IG6B 1Q3XA 3EGKH 4X6PA 1EPTC 3QX5H 2F9BH 2LPRA 2FTMA 5EODA 2GKVE 2V3HH 3VXEH 3UR9A 2AMPA 1N6YA 3SQEE 4JYTA 1OP8A 3GCWE 2WYJB 1LPGA 2BD8A 2YOLA 5FXLA 3SV7A 5DO4H 1UJ1A 2VH0B 1V3XB 1W12U 4GCHF 2XC4L 1KDQB 2Y7XA 1UCYK 1J9CH 3LDXH 1O3PB 3QO6A 4SGBE 4JZ1A 3LH1A 1H4WA 4YT6H 2M5TA 2F9UA 1LCYA 1SGNE 1GMDG 4UE7H 4INLA 1K36A 1A0JA 1AUTL 4MMZB 1AQ7A 1OYQA 3URDA 3LONA 1G32B 1DM4B 4ABEA 2BLVA 5DP5A 2D26C 1HIAB 4K8YA 3PROA 4K2YA 1GVKB 3EAJA 3ZZ6A 4UD9H 1PFXC 3KEEA 5F8TA 5F1AA 2XBWA 1DSUA 5T6GA 1DICA 5G4BA 1BTUA 1ZJKA 1C5VA 1TPGA 3TJNA 2BZAA 1LPKB 2FESH 4B2AA 3SU6A 2A45B 3T29A 4AZ2B 3M37A 3BF6H 1Y5UT 1IQKA 1GBEA 2H9HA 3CS7L 3UUZA 3VB7A 2AGIX 3A86A 3VGCB 3SZNA 3VEQB 4B2BA 1RXPA 5K0HB 4A6LA 1HRTH 2WV5A 1NQLB 3RDZA 4BAOB 1GJ9B 3TBDA 5KN5C 4Y6DB 3V12A 3BT1A 1IQIA 2MGPA 1UCYH 2Y6TA 2AIQA 2B7DL 2ZTYA 1SFIA 2FM2A 3N8WA 3ESTA 4Y79B 4X6NA 1D6RA 4ZKSU 4YZUB 6CHAC 4A7IB 3SU4A 4NGAL 1FJSL 1NPEB 3F9EA 2BQ6B 3GISB 1J16A 3ZZ3A 1KSNA 1QL7A 2A4RA 1SLWB 2H1UA 1K28D 4ZAEB 4NG9H 3SNBA 1GI0A 4JYUL 3UOUA 1DY8A 4X2WA 3RXPA 4ASHA 3SJOA 1AGJA 3O8DA 2DDUA 3PLBA 4OS2A 3SUEA 1GVZA 3LOXA 4K5ZA 4OTJA 1TABE 4XOJA 3ZYDA 1P9UA 1AD8H 4ZAEA 2VU8E 4K1SA 1GMHG 2D1JB 4Y10E 3FZDA 2G81E 2A7JA 1FF7A 2I6QA 1NZQH 4LMFA 2OBOA 5T6DA 5A0AE 5FPYA 3S9CA 2OXSA 2Z94A 5E2PA 1EPTB 2FLBL 5IKVA 1QTFA 3A8CA 4Y8YA 4GLYA 3SUFA 2A4OA 3ZVDA 4ABFA 1CHOG 1MQ5A 3SV6A 1IQLA 3UPEA 2UWOA 4ZHMU 2FI4E 2STBE 1C2GA 8ESTE 2ADXA 2ZHQH 1EAXA 3FP8E 1YPHE 1S84A 3ZZ5A 1TNHA 1ATBA 4F4OC 3PGHA 4FU8A 1O3IA 4YOGA 3UQVA 3RUOA 1TNKA 3LN0A 4Y8ZA 1ANCA 2W2QE 2Y5FA 5ABWA 2ZPQA 2RA0L 1A0HB 2W5EA 1FONA 2HPPH 1ZPCA 4NZLA 5JB9S 5IKQA 1BHXF 1TNIA 5A8ZA 3QZRA 4MNWA 3SGQE 3RXVA 1S82A 1YPMH 1FXYA 1K37A 1WUNH 1K1NA 3PO1B 2WYGA 3BTQE 1FUJA 2BX3A 3SOBB 3H7TA 3P95A 1SGTA 1N8OC 2ANKH 2W2OE 2GX4A 2EC9H 4OGXA 1C1OA 1TX7A 1MCVA 5EXMA 3FFGA 3ZYGA 2H9EH 4JZDH 3LGWA 4FU7A 1EAIA 3L6PA 1OKXA 1OXGA 1IQGL 5DP3A 1IQJL 3N8YA 1NS3A 1Z6CA 2AYWA 1NC6A 5CE1A 3DHKH 2QV1A 1CGJE 3SN8A 2VWMA 3PMJA 1HAOH 1P12E 2RA0A 2HLCA 4AG2A 1YPEH 4WMFA 1B5GH 1C2DA 4IN2A 1SLUB 3QTOH 1XUKA 1HYLA 4INHA 3ZYEA 5JDUB 3RMLH 1KTTB 1SB1H 2R9PA 5AFYH 5C67A 4NIVA 1V2OT 3GY7A 3R0FA 5EG4A 4Y71A 1ELVA 1VITG 2VIWA 1TOMH 4WF8A 1TNJA 2UUYA 1DWBH 1PJPA 1K9OE 1BIOA 1GBMA 1RTLA 3OX7U 4OS4A 4MLFB 2BY9X 1OWEA 3SHAH 7LPRA 3P5BL 4Z0KA 4X6OA 1WQVH 3M35A 1O2JA 4WWYA 1EASA 1FLEE 3UQOA 1QB1A 2UUKB 1VJAU 1MBQA 3HS7A 1L1JA 3M61U 2QC2A 3CS0A 2QA9E 3STJA 1EPHA 3OLTA 3MMGA 1GL0E 2VVUA 4GSOA 2KAIB
chains in the Genus database with same CATH superfamily
4NA9L 2FX4A 2A4GA 4THNH 1MU8B 1SGQE 3TK5A 2WPMS 3OTJE 4AYYB 1S85A 2UWPA 2QF4A 1TOZA 1O30A 1O0DH 5GDSH 5COXA 2PSYA 2Z6BD 1O31A 4D9RA 4TT3D 2K2SB 3STIA 1HNEE 4Q7XA 1AVGH 2AFQB 4NZQA 3OLUA 3LC3A 4IBLH 3Q7DA 3U7UG 2BOKL 1HAXB 1A46H 2BLQA 4X6MA 3ZVFA 1YM0A 3A7WA 5JVYA 1O3MA 3KL6A 2Y5HL 1LHDH 1KKEA 2PTCE 1HDTH 3MNCA 4MQAA 5JBAS 1EMOA 1JV2B 1B0FA 1UHBA 1PPBH 1GJCB 3QWCH 2PWXA 1ZYOA 1CU1A 1XX9A 2VWNL 3N8YB 1F7EA 1TX6A 2ANMH 1CEJA 1JRSA 2PP6A 1GPZA 3A80A 1MCTA 1UCYE 3BN9A 2AHME 5F8XA 3TJOA 4RRXA 5JBTA 1D9IA 2FLGA 2ZQ2A 2F9NA 1YPLH 2HALA 3UB0A 1GHBG 1S0QA 2OC7A 2PR3B 1ZTLA 3QCWA 1E0FD 4I31A 4TWWA 4MMYB 4WH8A 1NRRH 3ELAL 3C9AC 2HNTE 2R0LA 1FSBA 1BMLA 3ENSB 1ELBA 2BDCA 2BVSH 1F0SB 1IGXA 1O3AA 1UTJA 2ZF0H 2TGFA 2ZTXA 1IAUA 1LPZA 3CNRA 2GT8A 1O3KA 1VJ9U 2W3IA 1GBJA 3KQ5A 1PQ8A 3JZ1B 1HUTH 2IPHA 2F3CE 4Q2KA 1BCUH 1BOQA 2G55A 1IOEL 3MNXA 2CMYA 1C2FA 4BXSA 1TGSZ 2ZU4A 2B8OH 3FO8D 3HGPA 3PLKA 1ANDA 3PV5A 4YOJA 4Z0KB 1IQFL 2Z9KA 1Y3UA 1O32A 1GHYH 3A7ZA 4ISHH 2P95A 3TLOA 1RD3B 4CH8B 1D3DB 1BMNH 1TNLA 1O3HA 1O2WA 2BOKA 1NY22 4M7GA 2GP9B 3SGBE 2KB9A 3DA9B 5KIRA 3RP2A 4ZXXL 2SGDE 5IKRA 2V3MA 3GDUA 3QZQA 2AH4X 1FAXA 4P00A 1D6WA 1E35B 1C1PA 5JVZA 3P6ZB 2VJ1A 1GWAA 2WPIS 1SBWA 4CUEA 4K60A 1CQEA 1TMTH 2BOHB 4AFUA 1LHCH 8KME2 3EE0B 1QRXA 2VGCC 1TQ7B 2ULLA 2OK5A 4DVAU 1O5BB 3NXPA 4ISHL 5EQQA 1F5LA 4CHAC 1LHFH 2K1QA 3ZZ7A 2FOCA 1SQOA 2FLRH 1GBCA 1UTOA 1A61H 1BUIA 4U01A 5IKTA 1IOEA 2QF5A 4YO9A 4O03A 4JZFL 1Y3VA 1C4Y2 1QBOA 3MOCA 1T4VH 4B6FA 5KECA 3WWBA 5GPIB 5JBBE 1C5LH 2ZEBA 3PWBA 4UFEH 1EPIA 1NO9H 1KLJL 3BTKE 1ANEA 5I46H 4YXWD 1S0RA 4CH2B 3B8JA 1PPEE 7GCHG 1DVAL 4X8SH 2GV7A 2A0QB 2XCFA 3D62A 1C5QA 1XXDA 2ZKSA 1UO6A 1MKWH 1RFNA 2ZGCA 1IQFA 1GG6B 4R8TB 4UFFH 3MQEA 1YCPH 1FY4A 1KLOA 2IN2A 3MH5A 4ACAA 4M10A 3ZYJB 3FN8A 3OY6U 1A2CH 2VB0A 4ISNA 2Z9IA 2FMJA 2OUAA 2TGAA 1A3EH 3E0NB 4I8KA 4UFDH 3T62A 3T5FH 1CA8B 2OBQA 1GI4A 1V2MT 3LPRA 4ISIL 1TWXB 3M5NA 2PKAA 1W7XL 2ZFFH 5FPTA 1IP0A 1O3DA 5TCAA 2HORA 1OWDA 4Q7ZA 1DUAA 4D0FA 1F0SA 3A83A 4X1NU 3M5OA 1FAKH 2H5CA 3NCLA 3H5CB 2G5NA 2TGTA 2ODYB 5LPRA 2EY4C 1LVOA 3ZVAA 1WQSA 2BQWA 4JYVL 1OWIA 4JZDL 1MMJN 3KQCA 3QGNB 1C4V2 4Z6AH 4XBCA 1S6HA 3BIUH 1W0ZU 2XOKD 5IDKA 1ARBA 3OEHD 4ZKNU 1P05A 1HB0B 4DG4A 3ZVEA 1DWCH 1QRWA 4AC9A 1BRUP 1SR5C 1UZPA 3BTFE 1DVAH 2FI3E 3L33A 4BANB 1Q31A 3AASA 2ALVA 4IMQA 6LPRA 2UWLB 3NJPC 5LPEA 2BDIA 4WH6A 3FANA 3RXDA 1Q4GA 2V0BA 5L2YL 3DFLA 1O2QA 5J4QA 3QTVH 1RTKA 1V2NT 3RXUA 5C20A 2SGFE 5CHAC 1J17T 1SFQB 1MD7A 1SPJA 2RNLA 2HRVA 3Q3YA 4ZH8A 3SQHE 1GJAB 3V13A 1V1IA 3F68H 1SGIB 3AAVA 1Z8IB 2HLDD 4YT7H 3PMBB 2QYIA 1AE5A 1GJ4H 1QQ4A 4PROA 1K0HA 1ZPZA 2C8WB 1KXEA 4JYUH 3ZVBA 2WPKE 2G52A 1TRMA 1FFMA 1F7ZA 1BT7A 5L2ZL 4NG9L 1WU1A 1K1JA 1SHHB 1AFEH 3AVZA 3KYFA 1AKSA 5HM9A 2O8WA 1HXFH 2SGEE 4CRCA 1WHEA 1NU7B 5A0BA 2NU2E 4JZFH 2BMGA 1UVUH 2ZU2A 1WCZA 3MI4A 4INKA 3LC5B 2GZ9A 2VWLA 1VR1H 2XC5A 1BHXB 5DN6D 5J4SA 2A7CA 1K1LA 2P59A 4MDSA 1GL1A 3GCTG 1SQAA 2KX4A 1T32A 2BVRH 2A5KA 5F03A 3JZ2B 1RTFB 2CXVA 1YCPK 3QH0A 3QMOA 1B9WA 3QGJA 1V2VT 1ZGIA 2ZFRH 1N1LA 1BQYA 1YUFA 2R3UA 1C5SA 2O9QA 1O38A 2XBWL 1GDNA 1XUIA 3MH4A 5ESBA 5CISA 2J94B 2Y38A 4FUCA 1O2HA 1W10U 1K1IA 2JETC 3GICB 3P8FA 1TRYA 3F9HA 2FZZA 2BD3A 1Z71A 3NTBA 1GBLA 3ENSA 2ZGHA 5C5OA 2BY7X 3BG8A 2Z9LA 1NFWA 3KQEA 4U2WA 1C9PA 2M2AA 4U32A 5DSFA 4A1TA 1W7GH 4ASUD 5GIBA 1VZQH 1HFDA 1HPGA 1WTGH 3SJ9A 2QGRA 4FM5A 1NBME 2FI5E 8GCHF 4ZHLU 4X2VA 3E91A 3TZIA 1N6XA 2ZDKA 4CBOA 3R3GB 4FOUC 1BTHH 3BT2A 4NSYA 2A4QA 2ZPRA 3LGTA 4JZEL 1Z1JA 4DT7B 4I86A 1IQMA 1LKBA 4D7GA 3LJOA 1KSNB 4HG6A 2VWLL 2VGCB 1JMOH 3RXBA 2BZ6L 4BNRA 3SNAA 5AF9H 4M9FA 4Y76B 1Z1IA 3M3VA 4GUXA 3TK9A 1FY1A 3EA9A 1HAFA 1DIYA 1MTVA 1PQ5A 4J2YB 1TRNA 2BD2A 1O2YA 4WXVA 2WV4A 3P92A 3NK8A 1GJ5H 4X1SU 3A8BA 3UR6A 2G5VA 3TJUA 3FZZA 2OLGA 2FYRA 3F6UL 5L30H 3ZV9A 2UWPB 1NESE 1W2KH 3UREA 4XBDA 2TGPZ 2ZCHP 1D3TB 1EJNA 2CJIA 1EUFA 3DFJA 5L2YH 4GPGA 1ELTA 1JBUH 4MPWA 2ZQ1A 1L0ZA 3TGJE 4BOHA 5F53A 3LAQA 2FZZL 3BG4C 4IMZA 1EZQB 1MOXC 1OWKA 4ZUHA 5AFZH 2PV9B 2XBYA 3PRDA 1O2KA 1CA0B 3DSPA 3FOAA 1BTZA 1UZKA 1EJMA 1TE0A 1YYY1 3RMMH 3RXRA 4D76A 1LO6A 1O2PA 1GI9B 1APQA 2ODPA 1NFYB 3DD2H 1UTQA 3TU7H 1V2ST 3RXQA 2BB4A 5EPNA 4FXGH 4ZXYL 4TPYA 4UONA 1HJAC 4XD7D 4LZ1H 3TPIZ 5K7RA 3ZYIB 1APOA 2EI8A 2YGQA 2TBSA 4HI3A 3RXEA 2Y5GL 1SI5H 3TK5B 5FX6A 4CR5A 1CE5A 1T4UH 1ZSJA 1KDQA 2H9TH 3E3TA 1LTOA 3PYHA 3FFGL 3PTNA 1ESBA 2WPLS 3RXFA 3L3TA 2PSXA 4Z0LA 1THPB 1WYKA 4K69A 2D2DA 4IN1A 2VWOL 1UVOA 1K22H 5LPFA 4OS5A 1LPGB 3PLPA 1ZHPA 3ZVCA 1VITH 2XC4A 2XTTB 3SZEA 1GHBF 3MU0A 4BTUA 1C2LA 1C5WB 1HJ9A 1P0SH 2FTLE 3A7VA 1C2IA 4LK4A 1SGEE 2BDBA 2W2PE 4BAKB 1C5RA 2BVXH 2J38B 2HOXA 2VIQA 1O2LA 1KXAA 1TPAE 2BLWA 1ABIH 1NT1A 1A5IA 1SHYA 2PUQL 4NA7A 1HGTH 2ILNA 1AE8H 1O3LA 3S0NA 4YT6L 1GBTA 4H6SB 1V6DA 4YOIA 4KTSA 1O5FH 2P3FN 2O8UA 1L1NA 2XW9A 4DGJA 1H9HE 2FEQH 1IQEA 3ZZ8A 5L6NH 2XBVA 1NM6A 2P3FL 1O5EH 2O8TA 4E06H 2AMQA 1BTYA 1O3CA 6GCHF 1Z6EL 4DY7B 2QXHA 3S7HB 3SBKA 1CCFA 3F2HA 1C5NH 4Y0ZE 5FL7D 3HS5A 2BOHA 3BTWE 1G1QA 3N7DA 1IQIL 3Q3KB 5SGAE 1EP5A 3TGFA 1EX3A 1DDXA 1AHTH 4BTTA 2VVUL 1FPCH 3ATIA 1FAKL 4DCDA 5EQSA 4ZKRU 1CX2A 1E36B 1SG8B 3LGYA 2EI6A 1KYNA 2FP7B 4ZHAA 3QK1A 4IGDA 5HYOA 1WXRA 3MQKC 5EOKA 5CKNA 4DIIH 1RJXB 1JBUL 1WHFA 1N1IA 2GZ7A 3V7TA 2B5TB 4YTAA 1HT5A 4TWYA 3RXLA 3VB5A 1DX5M 3NTGA 5FPSA 2F83A 1SGYE 1TA6A 2RDLA 2F9OA 2G8TA 1FY5A 1OHHD 3KCGL 1EKBB 1LVMA 2P16L 3SU2A 1QFKL 2AGGX 1EOJA 3S9AA 1DQBA 4E05H 1KTSB 2GD4A 2FX6A 4ZROA 3LC3B 3V3MA 1DFPA 3BTGE 2AMDA 2GMTB 4RRWA 2K8IA 2ZGBH 3SGAE 1P09A 2ZIQH 1BTWA 1RFNB 1HREA 1KLIL 3VB3A 1W13U 1HCGB 4WVPE 1O36A 2IOTA 1A4WH 1P2QA 1YPGH 3SUGA 1UK4A 1NROH 2WPJS 2YMSB 1T31A 5CDFE 4RRZA 4UEHH 3GOVB 3RXCA 3SNCA 2ZCKP 1C2HA 4NA8A 3MU5A 2Z9GA 1QA7A 2GCTB 1J9CL 1E1RD 4BTUB 1GCTB 4MPUA 4ZKOU 1MKXK 4FUHA 4HFPB 1RGQA 2YNAA 3AW0A 2VWNA 2BDHA 4TY6A 1LVYA 3NT1A 1YLCA 1VKYA 2BO2A 5DG6A 1YY3A 3ZZDA 4D7FA 3LGVA 3BTEE 4AYVB 2ZFPH 2SGQE 3AAUA 4VGCB 4TPIZ 3U8TH 3LH3A 1ATAA 1N7DA 1ATDA 1QJ7B 1NFXA 3GISX 2D8WA 3LIWB 1GMCG 1QFKH 3OEED 1O2GH 4ZH8B 1C5MF 4B71A 1EOLA 4OGYA 3TGKE 2IJOB 2FOEA 1MZDA 1CVUA 5EPYA 4O02B 2FYQA 2F9VA 1LQEA 3PMAB 1W0YH 2QF3A 1YKTA 3PM3A 1JRTA 5BPEA 1EZSC 1NT0A 1JL9A 3M37L 1EPGA 4ISIH 1K1OA 1SLXB 1VCWA 1IQKL 1GI1A 3N8VA 4FU9A 1COWD 1HAPH 4BTIB 4Y79A 1PPFE 1AN1E 2PUQH 1TIOA 3Q76A 5JB8E 3VFEA 3SUDA 3H7OA 4RKJB 1CQQA 1QB9A 1C5UA 1MD8A 1KLIH 1CVWH 1DUEA 1VITF 4Q63A 3RLYH 4ABJA 3EYDA 2ZFSA 2P3TA 1YGCH 2BD4A 5KEDA 2P28B 2XWAA 3IITB 2CHAB 3E1XB 3F2GA 1ADXA 1ELEE 4FUJA 2ASUB 1GBBA 1RIWB 1ZGVA 1DITH 1G37A 3DSOA 4CRDA 2JH5D 5I25A 2WFTA 4G1MB 2GMTC 2WYJA 3I77A 1O2XA 1T8MA 2VVCK 3ATKA 1DWDH 4IW4E 3RM2H 1TGNA 3U28C 7ESTE 1CVWL 2KNIA 1UK2A 4BDWA 5B6OA 3VPKA 1WU1B 2QIQA 1QA0A 1IJQA 4QT8C 1GI8B 2R2WU 4CR9A 1HXEH 3HGNA 1AIXH 2J98A 1YWUA 3ZV8A 2C93B 2J4IA 1UHBB 3A82A 3K65B 5HXFA 2P8OB 2WPHE 2BY6X 2SNVA 1DX5I 3PTBA 1EJAA 3KNXA 3T25A 2A31A 1LDTT 2W2NE 3K9XB 3U98H 4AORA 1G3CA 3V0XA 1AVWA 1K2I1 5AVDA 1O3NA 4AB8A 2BDAA 4SGAE 2BQ7B 1SOTA 1LMJA 1FIZA 5EW1H 1G2MA 4MMXB 4BXWA 1BMMH 1O3BA 2JETB 4X8UH 2ZA5A 4BAQB 5C3NA 1X7AL 3K9XA 3OU0A 4Y7BA 3E90B 1NZIA 4X1PU 1J8AA 1Y3XA 3N8ZA 1IQNA 2VBCA 1ELAA 4FUEA 2Y82B 3M5LA 1H1BA 1FNIA 1QIXB 2PHBB 3A87A 5C1YA 1WBGB 1YPJH 2PHBA 2ZDAH 1TONA 1H9LB 3HS6A 1A3PA 2WUCA 1O5CB 4NWLA 2J5UA 4IS5A 1GBHA 3KRKA 5L30L 1PPCE 3FKSD 1URKA 1F92A 2M74A 2DUCA 1G2MB 1MQ6A 4NWKA 4O3TA 4Y7AA 1TOCB 4D8NA 1GBKA 1E1QD 1AB9C 2ZGJA 1F2SE 1P8VC 1GBIA 3POYA 4NFFA 4XRNA 3TIUA 2W26B 4K1TA 5GWZA 3PRBA 1FN8A 2ZHDA 1PRHA 1V2UT 2A5IA 3KHVA 4X8TH 1QR3E 1TBRH 1WAYB 1RRKA 3KQBA 5E0HA 1G1TA 2BXUH 1DWEH 1V2KT 1JWTA 4KGAA 3KCGH 4RRYA 2XBXA 4Z1MD 2OC1A 1FX0B 3P8OA 1GBAA 1XUFA 2Y81A 4CBNA 1AKSB 4O1ZA 4MVNA 5LH8A 3F6UH 1L3YA 4BDXA 3D65E 1M1XB 4KTCA 4CSYA 3KIDU 1DDJA 3R05A 5A8XA 1A5HA 1GI5A 1AFQC 1SC8U 4NSVA 2FOMB 1F5KU 3F1SB 3MWIU 5EJ1A 1TBQH 2J38A 1GHAG 1GJBB 1TGCA 1MQ6L 2YGOA 2NU3E 3Q00A 2JDID 1G1SA 3KQDL 2P16A 5A8YA 5E0GA 5F6MA 1ZMLA 1SVPA 1BA8B 1JXPA 1IHSH 1XM1A 2WINI 1MH0A 2CGAA 2KM0A 3LTFB 1W11U 1OYTH 1MAXA 3KL6B 1XKBC 3A7XA 3ATWA 1NFWB 2JJ1D 4I7YH 1G2LB 2WZQA 4XBMA 1KIGL 1NRPH 1GK5A 1CHGA 1QY6A 1HAZB 3TITA 1F5RA 4CUFA 3RXJA 1AFQB 2J94A 6GCHG 1CBWC 1HJ8A 3FP7E 1W14U 1S5SA 3HKJB 2FOAA 1I0UA 1V2WT 1XUJA 2VVCA 3CFWA 1FDPA 4Y6DA 1ZSLA 1DLKB 2HVYB 4X8UL 1Y3YA 1AO5A 2HPQH 3BEIB 3MO6A 4HZHA 1O5DL 3CENL 5IK2D 2BSFA 2W3KB 3KQBL 1GHXH 5IYTA 2DE8A 5EIYA 3RMNH 1FQ3A 1HAGE 5T3HA 2BY5X 1NTPA 1GHVH 2UUJB 5HM2A 1TLDA 1Z6JH 1C2MA 3M3TA 1V3XA 2PKSB 1TALA 5FAHA 2GD4B 2VVVA 1XVMA 3OFND 4R0IA 8LPRA 3VXFH 3DEMA 2XWBI 2Z3DA 1KXBA 1GCDA 1PPZA 5C17A 4XSKU 2BT7A 1CGHA 2BX4A 4A5TS 2ZDLA 3KN2A 1TGBA 3SU3A 3A88A 5A2MH 1ELCA 2ZGXH 1OX1A 1M9UA 1O34A 2F43B 1IQHL 1XUGA 3MH7A 2VINA 3BIVH 3HKIB 2WPHS 1ARCA 5C0TA 1G30B 1QIUA 1MU6B 3CENA 4KKDA 3GCOA 1NFYA 2W7SA 1ZZZA 1DY9A 2C8ZB 2STAE 3RXMA 1G1RA 5FDQA 1Z8JB 1PPHE 4JZEH 1EGFA 4NGAH 1OOKB 4KELA 1MZAA 4WMDA 1NFUB 1CBWB 3LGUA 4E1GA 2J4IB 3ODFA 3U9AH 4NFEA 2HNTF 1UTLM 4B76A 2FXRA 1O2SA 1TPSA 4NIYA 3A85A 2V7QD 5ETXA 1JIMA 3UNRA 1TQ0B 3P17H 1OWHA 2H6MA 1DXPA 1AI8H 3RC6A 2VVVL 1EB2A 4ABDA 3SHCH 1G36A 3MNSA 1SGFG 3N7OA 2QF0A 3KK6A 1SMFE 2Y80B 1O2NA 2A32A 1UW7A 3M36L 1LQDB 2G4TA 2UUFB 3TK6A 1Y3WA 1TX8A 2R2MB 4B2CA 2ANYA 5EU8A 1QNJA 1TGTA 1SLVB 1YLDA 3ITIA 1KXCA 1ZMNA 2ZHEH 1Z8RA 2FD6A 1E37B 2P94A 3IJEB 1C1UH 1IGZA 1FY3A 3SOSA 4GAWA 1OS8A 2PKSC 2W2ME 1YP9A 1ELGA 2Y80A 1ZJDA 1OB1C 5CKQA 5EGMB 1ESTA 4HGCA 2W26A 1W3CA 3PV2A 1T8LA 1EZUC 2OC0A 1BDAA 2Q1JB 1EMNA 4B1TA 1C1MA 2FIRH 3MU1A 5GNDA 5JBBS 9ESTA 3LC5A 5JBCS 2PGBB 3V64C 2ZO3H 5HMAA 2WPLE 1EXFA 3LJJA 3MHWU 1H8ED 4NCYA 3UIRA 1QL9A 1X7AC 1EQHA 1V2PT 1QBVH 3GY8A 1SQTA 3HK3B 1P2KA 3EQ0H 4ABIA 5C1UA 4E7NA 1C2KA 3RU4E 5EJLA 3EA7A 3RXTA 2GZ8A 2VIPA 5DJ7A 1C5MD 1HAYB 2VH0A 4B73A 2BD9A 2HNTC 1V2RT 1AWHB 4FUDA 1HJ7A 3QDZB 1UK3A 1ZR0A 1EBVA 2NU0E 4JMYA 1LVBA 3QUMP 2PFEA 1YCPM 2CN0H 3CA7A 1UTPA 2ZNKH 2BQ7A 3RLWH 4A1XA 4K8BA 3T26A 3O8CA 3TNSA 1HV7A 2WZPP 3RMOH 4PH9A 2QXIA 3URCA 2UWLA 1O2TA 3MTYA 2VWMK 2ANWA 1LHGH 1ZHMA 4AFQA 3A7TA 4Y8XA 3D23A 3GY5A 1P02A 2W6ID 1IQEL 4O3UA 2Y7ZB 2XBVL 1TBZH 4GHTA 5DK1A 3SV8A 5A0CA 1HBTH 3ZZCA 1Y5BT 3Q3XA 4FUFA 3PV4A 1PYTD 5DKMA 4I8LA 1B7XB 1ID5H 4F55A 5FCKA 4X8VL 2QXGA 4XDEA 4I8JA 5DP9A 3WWFA 2K0QA 2FOGA 1D3PB 1IVOC 1MTSA 2P3UA 1O2MA 1CT2E 3RU4T 5LGOA 2FLBH 1W7XH 2C4FH 2KCOA 4ABBA 3CP7A 4VGCC 3F0OA 4ISOA 1G3EA 3ATMA 2AYLA 1NRSH 4AGJA 4RN6A 4WJG2 2WPME 3GCTF 1IQLL 2EI6B 2WHXA 3SJIA 3TNTA 3U8OH 4CRFA 2Q6GA 7GCHF 1L4ZA 4BAMB 2HWLB 1BRCE 1YPKH 1F0RB 1INCA 2KCAA 3RXSA 2OCVB 1BTXA 1G3BA 1O35A 2KL7A 2XXLA 2NU1E 1H8HD 2J2UA 5CHAB 3QN7A 3S7KB 2FO9A 1C1NA 1J15A 1DS2E 2J95A 2H9EL 3RM0H 1MUEB 2W86A 2BT8A 2CF9H 2NU4E 1GCTC 1MTNB 4BAHB 3SU0A 2WPIE 4K3JA 1ZTKA 2MHPA 2V35A 1QJ6B 2Z7FE 1O39A 1EP6A 4AN7A 1ZMJA 1H9IE 1SQRA 1NFXB 3SOVA 1EB1H 1GMDF 2KCYA 2HVXA 3RXKA 3SJ8A 3CS7A 5JB9E 1FJSA 1T8NA 2ZU1A 5EJZA 1GI6A 2XC5L 1GI3A 5GCHF 1SGCA 1TMUH 5EXNA 1SL3A 1VGCC 4AGKA 4X2YA 3DCLA 4ABHA 2XC0L 3S9BA 1IQJA 6CHAB 5CKMA 1ETTH 4JK5A 1GI7B 2KFWA 4Y76A 1O2UA 1WSSH 2WYGB 2ZDVH 2FOHA 1Q2WA 4C16A 1PGEA 3GCNA 2C8YB 3E0PB 1VCQA 2GDDA 2ZHFH 3HK6B 1P11E 1PXXA 3VGCC 5E8DA 1Y5AT 3ZZBA 2FS8A 5FX5A 1SGPE 2TGDA 1DT2A 4XL1A 2R0KA 1CGIE 4DT4A 3S6XA 1DE7H 2F4LA 2ZP0H 5ESTE 1QJ1B 4J1YA 2HOBA 5F19A 1UVTH 2DE9A 3MNBA 7KMEH 2ZCLP 5JBCE 2WUBA 1A7SA 4H4FA 2RFKC 4F49A 4BTIA 4X2XA 1NN6A 2ZFTA 3A89A 4AG1A 2ZG0H 4YM9A 3HPTB 1C1WH 2L74A 1P01A 1PTHA 3W95A 4D90A 3SORA 1AVXA 4ZHAB 2W6JD 4X1RU 3D49H 1NRQH 5PTPA 1EAIC 2ZC9H 3NPSA 2QCYA 3M36A 3RC5A 1VGCB 1MQ5L 5EW2H 4I33A 1ANBA 1C5OH 3FBYA 1SGRE 4GHQA 1CT0E 1F0UA 4MG3A 2XC0A 2I9BA 3U1IB 4DURA 3BEUA 1QURH 5EGMA 5DP8A 4XE4A 1S6FA 3C27B 3VB4A 2FODA 2AIPA 1ETRH 1P10A 4ESTE 1L2EA 1ZOMA 1Z6EA 3DT0H 2GCHF 3ATLA 3LTGD 4I32A 3A8DA 2W3IB 4A7IA 4Q7YA 1P57B 3N8WB 1EZQA 2AGEX 1PYTC 2J98B 4AB9A 1P9JA 1OWJA 1BJUA 2GCTC 3GYMA 1FIWA 1P2MA 1YF4A 3OYPA 1S6LA 1EPJA 1T7CA 3ASIA 1GBFA 1NPMA 2XBYL 1HX2A 4I8GA 1Y8TA 1P9SA 4FUBA 2A1DB 4RI0A 3C1KA 1OPHB 1THSH 2P8OC 4JZIA 1AUTC 1U8CB 2WPKS 2KZ4A 2FDAA 2W7UA 5DP4A 2GTBA 2BOXA 1P2OA 2A2QH 2BDYA 9LPRA 1P3CA 1CA0C 3IITA 4HTCH 1IQGA 3BEFB 5HGGA 4B6EA 3GCHC 1HJAB 3UWJH 3BG4B 2VNTA 1G3DA 1YPHC 1C2JA 1E38B 4K1EA 1FMGA 2VIOA 2BD5A 1GHZA 1HIAA 4Y7AB 1GBDA 1P03A 4XFQA 1AZZA 4X1QU 2CHAC 2XCNA 4O97A 1THRH 3ZZ4A 4OM9A 2BHGA 1MKWK 4X8VH 2D1JA 4Y71B 4RUTA 2ZECA 2A7HA 1O5DH 4TY7A 4IC6A 1V2LT 3SU1A 3K6ZA 1QB6A 4GVUA 3N8XA 1BMFD 3GY3A 3NUMA 2ZU3A 2P95L 1PQ7A 2Z3EA 5DPAA 1HAIH 2FWWA 2OP9A 2R3YA 2P3UB 3IWMA 3PMHB 1FI8A 1N8OB 2XRCA 3MO9A 3VB6A 1G2LA 1HLTH 1O2ZA 2QAAA 2EEKA 1C5XB 3UNQA 4OS6A 2OTVA 1S81A 3LKWA 1A1RA 1BJVA 3OAAD 1GDQA 3ZVGA 2SGPE 4RSPA 5T6FA 1SGDE 4ABGA 1ELDE 5FBIA 2C3SA 1DANH 4MNVA 3W1EA 3GY4A 2YNBA 2BLOA 1C2EA 4JK6A 1U67A 4ZXXH 3QLPH 2W3KA 1YO8A 2ESTE 4Y0YE 1H8DH 1QGFA 2JKHL 1P2JA 4YLQH 3SNDA 3LU9B 1NRNH 1T8OA 2KAIA 1W0KD 4CRBA 2IJD1 2JH0D 3I29A 2V3OH 1TB6H 4ACBA 5HKKD 3MDLA 3V65B 3HO3A 2PTNA 4MTBA 1PQAA 3RR3A 3GDSA 1U6QA 2GVFA 2FOBA 4A1VA 1F0RA 3BSQA 1O3FA 1P3EA 2NWNA 4H42U 4MNYA 3T28A 5K0HA 4TSFD 4TYDA 1GJDB 2Y5HA 2WSSD 3SW2B 1EQGA 1O3EA 3HATH 3AW1A 2H9EC 2ZDMA 1BRAA 3M7QA 2BXTH 1HZ8A 3ZIAD 4XBBA 1CSOE 3A84A 3GS9A 3TH4H 1CO7E 4WXIA 2EA3A 1O2RA 1O37A 1A3BH 2O8MA 2SFAA 3E6PH 4FETA 3N99A 5JBAE 1PPGE 3DSGA 3SO3A 3U69H 1WDIA 4CRGA 1LMMA 6ESTA 2G00L 2Z3CA 1FN6A 4AX9H 1GJ8B 4MPXA 5H4IB 1XMNB 2PR3A 2BY8X 3RU4D 3S69A 2I9AA 3M7UA 1K1PA 2PW8H 2C8XB 2CF8H 4BTTB 1C5TA 1FY8E 3TGIE 1IQHA 1C9TA 1XVOA 3EE7A 4E7RG 1GVLA 4O9VA 3FP6E 8GCHG 4D9QA 2Z9JA 1LHEH 3TVJB 2TRMA 2I6SA 2J2UB 1TNGA 4U30A 4Y11E 1O3OA 4A94C 1C5YB 1P2NA 2BDGA 2BD7A 1ZHRA 2P93A 1O5GH 3A8AA 3MYWA 2B7DH 1O2OA 1MTUA 1V2TT 2JKHA 4OS1A 1UZJA 1V2QT 1ZTJA 2C90B 1IOXA 2ODQA 3MH6A 5HIYA 4WY3A 2FLRL 3SOQA 4D0EA 1ZSKA 4UDWH 1P06A 2SNWA 1ZAQA 3MO3A 1DLEA 1GMHF 3LIWA 2CK3D 1AZ8A 6COXA 2Y5FL 4YESB 3K2UA 3BPSE 1UMAH 3RXHA 4NIXA 1A0LA 1KXDA 3UAIC 1LK9A 2CV3A 2CJIB 1K21H 3GY6A 4Z6AL 4FUGA 1GG6C 1TPOA 1H8IH 4JCNA 2UWOB 2A5AA 1TAWA 1O3JA 1UZQA 3P70B 1ATEA 3B23B 3RC4A 4I8HA 2P3FH 2B0FA 5C5NA 1F7MA 1AY6H 1GDUA 1BBRK 2BMGB 3M5MA 4CREA 1G9IE 1ESAA 3M3SA 2ZI2H 4YLUA 5AHGH 2OD3B 2ZHWH 3UFAA 1IQNL 2BM2A 1LMWB 2VIDA 2GJGA 3W94A 1UTNA 1BTPA 1D3QB 2QXJA 1DXWA 2ZTZA 3UWIA 1GGDB 3P8NA 5CHBA 1RIWC 5JW1A 1XDTR 2GGVB 1COUA 1W8BH 3BTME 1GHAF 1XKAC 1QCPA 4FVBA 5GJ4B 1VCPA 4LOYH 2QE7D 4DW2U 5L2ZH 1W0JD 2RG3A 2YMSD 3O8BA 3SI3H 5DP6A 3NWUA 2FPZA 3RXOA 2GT7A 2YGPA 2KV4A 1HAEA 5I46L 1YUKB 2OC8A 3E8LA 4CRAA 1EQ9A 4FUIA 3RXAA 1Z7KA 4LZ4B 4X0WU 1K1MA 2Y82A 4KP0A 3HPTA 5EXLA 1HRFA 5JYIA 5FCRA 1MTNC 1EAWA 1OSSA 3MFJA 3UY9A 3LT3A 1KLTA 2KCPA 3KF2A 1F0TA 3NZIA 1ZRKA 1ZPBA 1FZZA 3PWCA 1ACBE 3G01A 3OSYA 2FOFA 1C4U2 1JIRA 3LGIA 2B9LA 3BTTE 3UOPA 3U73A 2XBXL 2GV6A 1EFRD 2H5DA 3O8RA 3FVFB 2V6NA 1FE2A 3KQDA 1YBWA 1ETSH 1C1RA 1GJ7B 3KQCL 3F9FA 4P02A 2NPRA 2Q6FA 1FV9A 2G51A 3T27A 5C94A 4AQTA 1LPZB 1L1GA 1O2VA 1KIGH 3GDVA 3ZZ9A 2EQNA 4MNXA 1P2IA 1TLEA 1AB9B 1DPOA 1UVPA 2AEIH 2ZWLH 3M7TA 5CMXH 1ABJH 1L4DA 2J34A 3EGFA 2VJ3A 2PLXA 2OQUA 4XLWA 2PKAB 2Q6DA 3KGPA 1PFXL 3BTHE 1QRZA 2VH6A 2RHPA 3MU4A 4AFSA 2KR7A 4LORA 4YZUA 4H6TA 1NU9A 1TMBH 4FVDA 2OQ5A 1HT8A 1C5PA 2VIVA 1C1SA 1IHTH 1AWFH 4KTUA 1L5GB 1UTMA 2A2XH 2WV9A 1XKAL 2OYEP 3F0PA 4DOQA 3A81A 1JOUB 1HCGA 4WMEA 3WW7A 1GMCF 1MBMA 5EQRA 4CHAB 4Q80A 1XXFA 5FBEA 1WTHD 3OY5U 2QY0B 3U1JB 3F9GA 5A09A 3UNSA 3SNEA 5TCCA 1B0EA 3TH3H 1ZLRA 1BBRH 2O8LA 3BV9B 3BTDE 3MU8A 2BTCE 1EATA 1RS0A 3ELAH 1LPKA 3NKKA 4X8TL 1KY9A 2THFB 4YT7L 1BZXE 1SOZA 2XYAA 1KLJH 1XUHA 1EZXC 1P0SL 2EI7A 2ZPSA 2BZ6H 3SJKA 3F2FA 2SGAA 4COXA 1BRBE 1P04A 2F91A 2Y81B 3GY2A 1C5ZB 3SU5A 1QBNA 4NA9H 1W8BL 1DOJA 2BOUA 3FAOA 3P8GA 5JPMH 5F8ZA 5GCHG 3GCXE 3SYJA 1J14A 1MTWA 1TPPA 3GCHB 4Y7BB 3SV9A 1CT4E 3RXGA 5DGJA 2BQWB 2XNIA 3ODDA 2WFXB 4M11A 2Q1JA 2QN5T 5E0JA 3I78A 1WV7H 3DUXH 1FAXL 2EI7B 1SSXA 5C2ZA 2IPQX 1XFEA 4IC5A 2P26A 2PUXB 2K2TA 3WY8A 1YUGA 1HAVB 2WPJE 2Y5GA 5DP7A 5C1XA 2BQ6A 1Y59T 2G00A 1BITA 4OTYA 1S83A 1ZRBA 4CUDA 2XNDD 3AK5A 1EPTA 1QL8A 3EDXB 2ZU5A 2Y7ZA 1LQDA 3TK6B 1CCVA 1QHRB 1TA2A 3U8RH 2BYAX 1O33A 2VWOA 3GYLB 1BBRE 4ISLA 2J34B 1DSTA 3TH2H 1BB0B 4ZMAH 3KQEL 5BRRE 3TJVA 2OYUP 1V1HA 2P93L 3Q3KA 2OINA 1SGFA 1Z8GA 2MGRA 5JB8S 1C1TA 3B9FH 1O3GA 1TFXA 4RS0A 4DJZB 2VH6B 2P3TB 4RKOB 1GJ6A 1O5AB 1QQUA 2FS9A 1OP2A 2Y7XB 3Q77A 4X8SL 3SI4H 1AU8A 5GXPA 2P94L 2HGTH 5T1VA 4UFGH 1MAYA 4TGFA 2ZZUH 3A7YA 1IQML 1SZBA 1FPHH 3K6YA 1C1VH 1GGDC 5KGOA 2G4UA 3E16B 2WG3C 2J95B 1TYNA 1WOFA 2F9PA 4AOQA 2ALPA 4ABAA 1GHWH 2H2ZA 4B75A 5E2OA 1XKBA 1OP0A 4NIWA 1YGCL 3HO5A 2GCHG 4GU4A 2LNCA 4GCHG 3LN1A 1EAUA 1AUJA 1C1QA 1HAHH 1O2IA 1LKAA 1AMHA 4B74A 2TPIZ 1MKXH 3T2NA 1GI2A 2ZFQH 4LXBH 3PO1C 4A92A 1YC0A 1V2JT 3FCSB 2WG4B 1BF9A 3RXIA 4ZCNA 2WPDD 5TJXA 4ZXYH 1CHOF 3ZZAA 1NFUA 5FHTA 2J9NA 2J92A 1ELFA 1HAVA 1UVSH 1ORFA 3TH3L 2PGQB 2RA3A 3SW2A 3SV2H 4OS7A 2AS9A 3PB1E 3UTUH 2F9BL 1BMAA 2AERH 1E79D 2ZDNA 3KYGA 4MPVA 1A5GH 2RCEA 1UTKA 4JYVH 5E8EH 1E34B 2JH6D 4AFZA 3HO4A 3EA8A 2JJLA 1D4PB 2GDEH 1KXFA 4DIHH 2EI8B 2TIOA 3IG6B 1Q3XA 3EGKH 4X6PA 1EPTC 3QX5H 2F9BH 2LPRA 2FTMA 5EODA 2GKVE 2V3HH 3VXEH 3UR9A 2AMPA 1N6YA 3SQEE 4JYTA 1OP8A 3GCWE 2WYJB 1LPGA 2BD8A 2YOLA 5FXLA 3SV7A 5DO4H 1UJ1A 2VH0B 1V3XB 1W12U 4GCHF 2XC4L 1KDQB 2Y7XA 1UCYK 1J9CH 1QZ8A 3LDXH 1O3PB 3QO6A 4SGBE 4JZ1A 3LH1A 1H4WA 2JJ2D 4YT6H 2M5TA 2F9UA 1LCYA 1SGNE 1GMDG 4UE7H 4INLA 1K36A 2LELA 1A0JA 1AUTL 4MMZB 1AQ7A 1OYQA 3URDA 3LONA 1G32B 1DM4B 4ABEA 2BLVA 5DP5A 2L6OA 2D26C 1HIAB 4K8YA 3PROA 4K2YA 1GVKB 3EAJA 3ZZ6A 4UD9H 1PFXC 3KEEA 5F8TA 5F1AA 2XBWA 3OE7D 1DSUA 5T6GA 1DICA 5G4BA 1BTUA 1ZJKA 1C5VA 1TPGA 3TJNA 2BZAA 1LPKB 2FESH 4B2AA 3SU6A 2A45B 3T29A 4AZ2B 3M37A 3BF6H 1Y5UT 1IQKA 1GBEA 2H9HA 3CS7L 3UUZA 3VB7A 2AGIX 3A86A 3VGCB 3SZNA 3VEQB 4B2BA 1RXPA 5K0HB 4A6LA 1HRTH 2WV5A 1NQLB 3RDZA 4BAOB 1GJ9B 3TBDA 5KN5C 4Y6DB 3V12A 3BT1A 1IQIA 2MGPA 1UCYH 2Y6TA 2AIQA 2B7DL 2ZTYA 1SFIA 2FM2A 3N8WA 3ESTA 4Y79B 4X6NA 1D6RA 4ZKSU 4YZUB 6CHAC 4A7IB 3SU4A 4NGAL 1FJSL 1NPEB 3F9EA 2BQ6B 3GISB 1J16A 3ZZ3A 1KSNA 1QL7A 2A4RA 1SLWB 4RT1A 2H1UA 1K28D 4ZAEB 4NG9H 3SNBA 1GI0A 4JYUL 3UOUA 1DY8A 4X2WA 3RXPA 4ASHA 3SJOA 1AGJA 3O8DA 2DDUA 3PLBA 4OS2A 3SUEA 1GVZA 3LOXA 4K5ZA 4OTJA 1TABE 4XOJA 3ZYDA 1P9UA 2J97A 1AD8H 4ZAEA 2VU8E 4K1SA 2VRSA 1GMHG 2D1JB 4Y10E 1NBMD 3FZDA 2JIZD 3NRLA 2G81E 2A7JA 1FF7A 2I6QA 1NZQH 4LMFA 2OBOA 5T6DA 5A0AE 5FPYA 3S9CA 2OXSA 2Z94A 5E2PA 1EPTB 2FLBL 5IKVA 1QTFA 3A8CA 4Y8YA 4GLYA 3SUFA 2A4OA 3ZVDA 4ABFA 1CHOG 1MQ5A 3VG8A 3SV6A 1IQLA 3UPEA 2UWOA 4ZHMU 2FI4E 2STBE 1C2GA 8ESTE 2ADXA 2ZHQH 3F3BA 1EAXA 3FP8E 1YPHE 1S84A 3ZZ5A 1TNHA 1ATBA 4F4OC 3PGHA 4FU8A 1O3IA 5B6LA 4YOGA 3UQVA 3RUOA 1MABB 1TNKA 3LN0A 3OTPA 4Y8ZA 1ANCA 2W2QE 2Y5FA 2RDEA 5ABWA 2ZPQA 2RA0L 1A0HB 2W5EA 1FONA 2HPPH 1ZPCA 4NZLA 5JB9S 5IKQA 1BHXF 1TNIA 5A8ZA 3QZRA 4MNWA 3SGQE 3RXVA 1S82A 1YPMH 1FXYA 1K37A 1WUNH 4F48B 1K1NA 3PO1B 2WYGA 3BTQE 1SKYE 1FUJA 2BX3A 3SOBB 3H7TA 3P95A 1SGTA 1N8OC 2ANKH 2W2OE 2GX4A 2EC9H 4OGXA 1C1OA 1TX7A 1MCVA 5EXMA 3FFGA 4RT0A 3ZYGA 2H9EH 4JZDH 3LGWA 4FU7A 1EAIA 3L6PA 1OKXA 1OXGA 2LP6A 1IQGL 5DP3A 1IQJL 3N8YA 1NS3A 1Z6CA 5HIZA 2AYWA 1NC6A 5CE1A 4GU3A 3DHKH 2QV1A 3H09A 1CGJE 3SN8A 2VWMA 3PMJA 1HAOH 1P12E 2RA0A 2HLCA 4AG2A 1YPEH 4WMFA 1B5GH 1C2DA 4IN2A 1SLUB 3QTOH 1XUKA 1HYLA 4INHA 3ZYEA 5JDUB 1KMHB 3RMLH 1KTTB 1SB1H 2R9PA 5AFYH 5C67A 4NIVA 1V2OT 3GY7A 3R0FA 5EG4A 4Y71A 1ELVA 1VITG 2VIWA 1TOMH 4WF8A 1TNJA 2UUYA 1DWBH 1PJPA 1K9OE 1BIOA 1GBMA 1RTLA 3OX7U 4OS4A 3N7EA 4MLFB 2BY9X 1OWEA 3SHAH 7LPRA 3P5BL 4Z0KA 4X6OA 2YMSC 1WQVH 3M35A 1O2JA 4WWYA 1EASA 1YLNA 1FLEE 3UQOA 1QB1A 2UUKB 4Q4LA 1VJAU 1MBQA 3HS7A 1L1JA 5C0UA 3M61U 2QC2A 3CS0A 2QA9E 3STJA 1EPHA 3OLTA 3MMGA 1GL0E 2VVUA 4GSOA 2KAIB
chains in the Genus database with same CATH topology
4NA9L 2FX4A 2A4GA 4THNH 1MU8B 1SGQE 3TK5A 2WPMS 3OTJE 4AYYB 1S85A 2UWPA 1TOZA 1O30A 1O0DH 5GDSH 5COXA 2PSYA 2Z6BD 1O31A 4D9RA 2K2SB 3STIA 1HNEE 4Q7XA 1AVGH 2AFQB 4NZQA 3OLUA 3LC3A 4IBLH 3Q7DA 3U7UG 2BOKL 1HAXB 1A46H 2BLQA 4X6MA 3ZVFA 1YM0A 3A7WA 5JVYA 1O3MA 3KL6A 2Y5HL 1LHDH 2PTCE 3MNCA 1HDTH 4MQAA 5JBAS 1EMOA 1JV2B 1B0FA 1UHBA 1PPBH 1GJCB 3QWCH 2PWXA 1ZYOA 1CU1A 1XX9A 2VWNL 3N8YB 1F7EA 1TX6A 2ANMH 1CEJA 1JRSA 3A80A 1GPZA 4IC5A 1MCTA 1UCYE 3BN9A 5F8XA 3TJOA 4RRXA 5JBTA 1D9IA 2FLGA 2ZQ2A 2F9NA 1YPLH 2HALA 1GHBG 1S0QA 2OC7A 2PR3B 1ZTLA 3QCWA 1E0FD 4I31A 4TWWA 4MMYB 4WH8A 1NRRH 3ELAL 3C9AC 2HNTE 2R0LA 1FSBA 1BMLA 3ENSB 1ELBA 2BDCA 2BVSH 1F0SB 1IGXA 1O3AA 1UTJA 2ZF0H 2TGFA 2ZTXA 1IAUA 1LPZA 2GT8A 1O3KA 1VJ9U 2W3IA 1GBJA 1PQ8A 3JZ1B 1HUTH 2IPHA 2F3CE 4Q2KA 1BCUH 1BOQA 2G55A 1IOEL 3MNXA 2CMYA 1C2FA 4BXSA 1TGSZ 2ZU4A 2B8OH 3HGPA 3PLKA 4YOJA 1ANDA 4Z0KB 1IQFL 2Z9KA 1Y3UA 1O32A 1GHYH 3A7ZA 4ISHH 2P95A 3TLOA 1RD3B 4CH8B 1D3DB 1BMNH 1TNLA 1O3HA 1O2WA 2BOKA 1NY22 4M7GA 2GP9B 3SGBE 2KB9A 3DA9B 5KIRA 3RP2A 4ZXXL 2SGDE 5IKRA 3GDUA 3QZQA 2AH4X 1FAXA 1D6WA 1E35B 1C1PA 5JVZA 3P6ZB 2VJ1A 1GWAA 2WPIS 1SBWA 4CUEA 4K60A 1CQEA 1TMTH 2BOHB 4AFUA 1LHCH 8KME2 3EE0B 1QRXA 2VGCC 1TQ7B 2ULLA 4DVAU 1O5BB 3NXPA 4ISHL 5EQQA 1F5LA 4CHAC 1LHFH 2K1QA 3ZZ7A 2FOCA 1SQOA 2FLRH 1GBCA 1UTOA 1A61H 1BUIA 4U01A 5IKTA 1IOEA 4YO9A 4O03A 4JZFL 1Y3VA 1C4Y2 1QBOA 3MOCA 1T4VH 5GPIB 5JBBE 1C5LH 2ZEBA 3PWBA 4UFEH 1EPIA 1NO9H 1KLJL 3BTKE 1ANEA 5I46H 1S0RA 4CH2B 3B8JA 1PPEE 7GCHG 1DVAL 4X8SH 2GV7A 2A0QB 2XCFA 3D62A 1C5QA 1XXDA 2ZKSA 1UO6A 1MKWH 1RFNA 2ZGCA 1IQFA 1GG6B 4R8TB 4UFFH 3MQEA 1YCPH 1FY4A 1KLOA 2IN2A 3MH5A 4M10A 3ZYJB 3OY6U 1A2CH 2VB0A 4ISNA 2Z9IA 2FMJA 2OUAA 2TGAA