4BXWA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
322
structure length
286
Chain Sequence
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTHFITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords FACTOR XA
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
total genus 69
structure length 286
sequence length 322
chains with identical sequence B
other databases KnotProt 2.0: S -31
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxwA02
1AFEH 1BBRE 2XWAA 1AI8H 1FY4A 1GCTC 1HJAB 1MUEB 2P3FN 1ESTA 2FODA 2VVVA 3UWIA 1VITF 3AW1A 1NRQH 1GI8B 1ORFA 4GHTA 1ANDA 1LKBA 4HFPB 1K1JA 2ALPA 2NU0E 4ABJA 3M61U 1IQLL 1TGSZ 3ZVBA 3E0PB 4LOYH 3GCHC 1SB1H 3VB7A 5HXFA 1A1RA 1SGQE 3GYMA 3LGIA 3KCGH 4ZKRU 4XLWA 3VB3A 1UCYH 1TLDA 2BZ6H 1ATBA 1EQHA 1CE5A 3I29A 2KV4A 3TH3L 1TX8A 5CHAB 1O2YA 1GMCF 4WF8A 4LZ1H 1FY3A 2FOCA 1D3DB 3CS0A 2FIRH 2ZP0H 4ISIH 1GI0A 2GX4A 1NRPH 3BG4C 4CRBA 4B74A 3URDA 1HYLA 1IQJA 2JETC 2Y5FA 2ZTYA 4Y8ZA 3S9AA 4AZ2B 3VB5A 3RMNH 4CRAA 2VVCA 3FP7E 1E0FD 4BAMB 2VIDA 4YOIA 3A87A 1K1PA 1FAKH 1EPJA 2VJ3A 2KB9A 1P3CA 1CEJA 2GMTB 1KXDA 1UTPA 3PWCA 4XDEA 2CF9H 3PYHA 3RXFA 4YZUB 3ZZ4A 5K7RA 2RNLA 1NRSH 3TGFA 3S9BA 1EZQB 1TALA 1WCZA 3RLWH 5CE1A 2JH6D 5EQQA 3T29A 3D65E 2P16A 3BT2A 1C1PA 1IQMA 3MNXA 2W26A 3ZZ9A 1SFIA 4O9VA 3MU1A 3LN0A 1XUFA 4AYVB 1Z7KA 1BTWA 3WY8A 2CJIB 1WQSA 4ABGA 1NU9A 1Y59T 2F9BL 3RR3A 4CRGA 1HAZB 6COXA 2FOMB 2K2TA 2Y7XB 1YUGA 2FOEA 1PQ8A 3GY3A 4YOGA 3HK6B 5C20A 1GI9B 1C5NH 1HRTH 3R05A 4YT6H 4X8TL 1TNIA 1TA6A 3ZV9A 4AFSA 1K1MA 3RXQA 1GJ8B 4ABBA 3LGWA 1YCPM 4NSVA 4ZHLU 4ISOA 3SU6A 2PUQL 1P0SH 1GG6B 1QTFA 2H9TH 4LXBH 1V3XA 1O5FH 4WY3A 4A5TS 1BT7A 1HCGB 1P06A 2A4OA 1W12U 2WG4B 1GVLA 1LDTT 1LVBA 3F9HA 1HXFH 2BY8X 8GCHG 1UTNA 4IBLH 1C2DA 1W14U 1IGXA 3M7QA 4UD9H 1YPEH 2BOXA 2OC7A 5DP9A 1G37A 3L3TA 1OPHB 1XM1A 3LJOA 1ELAA 5FPYA 2A7JA 1QL9A 3L6PA 3KQCL 2AIPA 3PWBA 1F0TA 2BDYA 3HPTA 2PHBB 3E16B 4OGXA 2BDHA 1LVOA 3EA7A 3RC6A 3K65B 1P03A 1BRBE 4XFQA 5CISA 2A2QH 2SNWA 1G1RA 1GBBA 3ZVEA 4ZHAB 4YTAA 4NG9L 5HMAA 1DVAL 5EXMA 3RUOA 5C3NA 2R3YA 3MQEA 1O3AA 1G1SA 2ZU5A 1EPIA 2FMJA 2ZCKP 1FPCH 2YNBA 1JWTA 1NY22 1J9CL 1C1MA 1UZKA 1O3MA 1Y3VA 2Y81A 5FX6A 1YM0A 3OTJE 1ID5H 3LOXA 3QK1A 1EQGA 1EKBB 2AIQA 8LPRA 2BVSH 1GI2A 1MU6B 3QDZB 1FFMA 2BY7X 2P95L 4I8JA 1IQHA 3T5FH 1Y3XA 2P8OC 4JMYA 1C2IA 2BHGA 4Q2KA 2BX4A 1SGIB 2VIQA 2K2SB 2VIOA 1S0RA 2GVFA 3CENL 1EP5A 3RXMA 5C1YA 2QIQA 1ADXA 3ZV8A 2PW8H 1GBCA 3P17H 2BMGA 2AH4X 4MMZB 1LQDB 2FOFA 2NU3E 2Y82A 1Z71A 3EGFA 1E34B 1CGJE 1ZSJA 5E8DA 3LAQA 1F0UA 5EW2H 1C2EA 4B71A 4ZH8A 2FLRH 4CBNA 1AKSA 1TOCB 1XUIA 5LPRA 2I6SA 3A83A 2P3UB 1ATDA 1YF4A 4KKDA 5JB8E 4X8UL 1L1GA 4YM9A 1UTKA 3U7UG 4NZQA 3GY4A 2Z9JA 1CBWC 1P2QA 1TONA 1C5LH 2G55A 2ZI2H 3N8WA 2BQWB 1D6RA 2GCHF 1SGTA 2VWLA 4Y79A 1GDNA 1BMLA 1Y3UA 1T8LA 3RU4E 1TB6H 3ZZDA 1OP8A 1GBDA 4FUIA 4I32A 1CU1A 3E8LA 2P93L 3ATIA 4CUEA 2M5TA 1Y5BT 2D2DA 4NA9L 1EAUA 4ABIA 2A4RA 1O39A 4BTUB 1DQBA 4D7GA 2KAIB 3QO6A 1TMUH 1X7AL 4LORA 3GCTG 5ESTE 2EI7B 2VH0B 3SJOA 4K1TA 5A0AE 1NO9H 1SGDE 1UTJA 2ZNKH 3E3TA 1CT2E 3RXGA 3V0XA 1FJSL 4WXVA 3TK6B 1G3BA 3SNAA 2W3KB 3KNXA 4Y76A 3NXPA 2F83A 1DPOA 1ELCA 2R0LA 4G1MB 1SI5H 2BOHB 2J4IA 1FONA 4IS5A 1K2I1 4AB9A 2EI6B 2UWLB 1Q2WA 1YO8A 2XBVL 3OX7U 5HYOA 1FY8E 3MU5A 2O8WA 4AN7A 3SU3A 2FM2A 3F9FA 1OWJA 2OTVA 3SW2A 1DX5M 1L1NA 2WPLS 1S83A 3CS7L 4D9QA 3BEIB 1LVMA 3EE0B 1ABJH 2D1JA 1NESE 2QXIA 2FD6A 1PPCE 2A1DB 3ZZ8A 2ZHQH 4VGCB 3H7OA 2A5IA 2VIPA 4LMFA 3KCGL 5FDQA 2FTMA 3ODDA 2BZ6L 2FZZL 1BQYA 1YPJH 2BQ6B 2ZPQA 4UFFH 1Y5AT 1JOUB 2O8TA 3SQHE 1NRRH 1EZXC 1ZMJA 4O3TA 4IC6A 3C27B 4TPIZ 1GI3A 1Z8RA 2ESTE 3QUMP 4Z0KA 4TGFA 1EPTB 4AX9H 4O3UA 4RN6A 5JBBS 1TBZH 2YGPA 1F7MA 3M3SA 1K1OA 1A5IA 1C2MA 4AG1A 5EXNA 3GCNA 4X6OA 1MCTA 2Q6DA 2ZGHA 2XC4A 2BLQA 4ZUHA 1ACBE 2VWMK 1BZXE 2CGAA 4ABDA 1VGCC 1KIGH 1AUJA 1ARCA 3LPRA 1ETSH 1GJ5H 1O3JA 3TH3H 1NFXA 2Z6BD 1RTLA 1HJ7A 1W13U 1QRXA 1CHGA 2FX6A 1T8MA 1DT2A 2FI5E 1GBKA 1UVPA 1GBLA 2BD7A 1ATEA 3TVJB 1QURH 3HS6A 4INKA 1ZRKA 2BDCA 4YT6L 1GHAF 1ZR0A 7GCHF 3F1SB 1CHOG 3A8AA 3ENSB 1Y8TA 3QLPH 1DWBH 1XUJA 1OX1A 1P0SL 3MFJA 4CHAB 2EC9H 1KYNA 5T3HA 3MOCA 1GDUA 1FAXA 2ZQ2A 4B2AA 1V2WT 3K2UA 7KMEH 1MOXC 5HM9A 3M5MA 1TLEA 2O8LA 1K1NA 2B0FA 4H6TA 3R3GB 4NSYA 2ZEBA 3RXLA 2ZFPH 3MU0A 4SGAE 2W86A 2YGOA 4AGJA 2ULLA 1BRCE 4TWWA 1TNJA 5T6FA 3BTWE 1SG8B 1IQIL 4CRCA 2W26B 4NZLA 3M36A 1V2ST 3S9CA 3UIRA 1DWEH 3MO6A 5GCHF 2FOHA 2OINA 1O2QA 5E8EH 5CMXH 3EDXB 3NTGA 1X7AC 2KL7A 1HAHH 2BLVA 1HXEH 2OBOA 2GMTC 1ELFA 1TYNA 1V2JT 2ZU2A 4D90A 3H7TA 2FXRA 1XDTR 1UVUH 3V13A 3PTBA 3S7KB 1W7XH 2ZFRH 5JDUB 1YGCH 1A2CH 5EODA 5DP4A 3A7XA 2IOTA 1O5DL 5F03A 3TBDA 1W8BH 2Z9KA 4FVBA 3SNDA 1V3XB 4DG4A 1H9HE 2ZFTA 4NIXA 2VWNL 1KSNA 4YLQH 3SHCH 1HB0B 5DP3A 2A7CA 2I9BA 2O8MA 4D0EA 3CFWA 3FANA 3ZYDA 1P05A 4CUDA 1SQAA 4OS6A 3C9AC 1GBEA 2ZDAH 3GICB 4E7NA 2BDAA 1DS2E 2QXJA 3RXJA 4YO9A 2CN0H 1E35B 4UFGH 3ZVAA 2GD4A 2BX3A 1VCPA 1BTYA 1DFPA 2BTCE 2QN5T 1HGTH 1OWDA 1HLTH 1SHHB 4TWYA 1C5MF 1VJAU 1C5PA 1NM6A 4BAOB 3HPTB 1YUFA 2XBXL 1O2GH 1QL8A 2BYAX 2FLRL 2OP9A 2AYLA 2GDDA 1D3PB 1J17T 1YLDA 2ZPRA 1TE0A 2ZG0H 2PR3A 3BG8A 3QN7A 2ADXA 1YBWA 2A0QB 3LH1A 4UFDH 2BOKL 5IKTA 2XBYL 2FS8A 4D76A 5JVZA 2VVUA 3PO1B 3UNRA 1HT8A 2BD4A 1O3NA 1V2QT 2Y6TA 4CR9A 1EJAA 1KDQA 4FU8A 1FY5A 3QZRA 3ZVGA 2NPRA 1G36A 2Y81B 1SGFG 1K21H 4UE7H 1QB9A 1YPKH 4OS1A 4CREA 1IQFA 2R2MB 2G52A 1N1LA 1QB6A 2RA0A 1ZHRA 4IW4E 1CVUA 1IQEL 1P9UA 1Y5UT 2D26C 5KIRA 4NG9H 3SJKA 1DVAH 5L30H 3QCWA 4M10A 2PLXA 1P12E 2AYWA 3PMBB 2M74A 3VXFH 4OS5A 2BMGB 1NU7B 1XUKA 1B9WA 2XCFA 5JB8S 3UQOA 2HWLB 4ABEA 1O31A 2QF0A 2A32A 3LN1A 5HM2A 1ELEE 2VVVL 4ZH8B 1BF9A 1AWFH 1AKSB 3LIWA 5DJ7A 4TY6A 4JK6A 3BV9B 1HAOH 1TMTH 1A5GH 1GPZA 1H9IE 2A7HA 1B0EA 1FI8A 1OS8A 4XSKU 3RXIA 3STIA 3NWUA 3MH4A 3N8WB 5AF9H 2Y5HA 1C2GA 3N8ZA 2J9NA 1O2UA 2XBWA 1MZDA 3ZYGA 2W2ME 1WQVH 3LC3B 2Z7FE 2IN2A 3BTTE 2IPHA 4Y79B 2H2ZA 1G2MA 1UK2A 2RHPA 5T6DA 1UCYK 5A8XA 1O2TA 2Z3DA 3LU9B 5L2YH 1VCQA 4X8UH 1OYTH 1L5GB 1IVOC 4WVPE 2Y5FL 1IQJL 1C1SA 1IJQA 1A46H 1HIAA 2P26A 4ISHL 2ZCHP 3EGKH 3M5OA 4OTYA 3DT0H 2J38A 4FUHA 3FBYA 4JZ1A 5EOKA 3SU0A 1AVGH 2H6MA 4ZXYH 5J4QA 1O2NA 2D8WA 2OC1A 2FLBH 1S6FA 3TJVA 5AFYH 2P16L 2O9QA 4I8LA 3ZYIB 3KEEA 1IQML 4Y76B 2PKAA 3U8OH 1UZQA 4CSYA 5JW1A 1K1LA 1SGNE 4A7IA 2OQ5A 3KL6A 4NA9H 3RXOA 3LTFB 1MH0A 4WJG2 2J4IB 2BD5A 1SBWA 1PPZA 2VWOA 1AUTL 2VNTA 1NFYB 1CCFA 2ZO3H 4GLYA 4H42U 1QY6A 1C5QA 2C4FH 1PPHE 4RRYA 3NTBA 3SW2B 3U8TH 1KIGL 2QC2A 3NUMA 4CR5A 4PROA 5EXLA 1G3EA 1C5TA 2D1JB 2STAE 2ZFFH 1KXFA 3EA9A 1XUGA 1MTNC 2OLGA 1JL9A 1QL7A 1XXFA 3TH2H 2WPIS 1TNKA 4F49A 4MMXB 2WUBA 2ZHFH 5DKMA 4ISLA 3PLPA 5JBBE 1EGFA 1D4PB 3F9EA 1FPHH 2GT7A 2K1QA 4JZEH 1NRNH 2V3HH 1ELVA 3Q3YA 4MTBA 4Z0KB 1EB2A 4UDWH 4ZHMU 1EB1H 1BOQA 2ZDVH 5DP5A 2C8ZB 3T26A 1HT5A 2R3UA 1D9IA 2CMYA 5JVYA 1MKXH 3RXKA 3QMOA 1SLXB 1FMGA 4VGCC 3K9XA 3ZZ5A 1MTUA 1T32A 1GJCB 3SGQE 1GMDF 1OP2A 1KLOA 3D23A 3KHVA 1CA0B 3ELAL 5EG4A 1BA8B 1Q3XA 3BEUA 1TBRH 3SNEA 1BJUA 1ESAA 1S85A 2OBQA 4BAQB 1XKBC 1K36A 3ITIA 1PPEE 4B2CA 1NFXB 4NA8A 1JBUL 2R2WU 1CQEA 1EPTC 4NWLA 4Y6DA 1FN6A 5C1XA 1Y3YA 2UWPA 4DJZB 3VXEH 4AQTA 1FSBA 1L2EA 1PYTD 1IQKA 3ATWA 3CP7A 1FY1A 5FPTA 3QZQA 1ELBA 1TGCA 1W7XL 4XBMA 1THRH 1YGCL 1GBIA 5GDSH 1WHEA 2LPRA 3OSYA 4K69A 5ABWA 1GBHA 1O3FA 1IQHL 5F19A 1FXYA 3ZVCA 5C1UA 2SGFE 4F4OC 1W8BL 1G1QA 1F7EA 1AO5A 4D0FA 1GBTA 2G81E 1ZOMA 3BTKE 4AORA 5FCKA 1UCYE 1C9PA 2TPIZ 3MU4A 2VIWA 4BXWA 3FFGA 3URCA 4A6LA 1DSUA 1XVMA 3VGCC 4FM5A 3KN2A 2GZ8A 4E7RG 4BNRA 1KY9A 3RMLH 1P2OA 3SOQA 4AFZA 1BDAA 2OD3B 1MAYA 3RU4T 5C67A 4XL1A 1EMOA 1AWHB 3PMHB 2NU2E 2AGIX 2P94A 3SJ8A 4MPUA 4X2YA 8ESTE 1G3DA 1HAGE 3RXCA 1O3KA 3SUFA 4CHAC 2TGDA 4ZAEA 3V65B 1NQLB 1ZMLA 1P04A 2GT8A 2FP7B 3N8VA 1TGBA 2WUCA 1HAIH 1TNGA 2HVXA 3OLUA 4J2YB 1KXAA 3HO4A 2GZ9A 1TBQH 1SFQB 5LGOA 1NN6A 2ZQ1A 1SLVB 2FYQA 5CKMA 4BTTA 2WPHE 1FDPA 1MU8B 1C4U2 2B8OH 1XVOA 3KQBA 4CH2B 1XFEA 1IOEA 1Z1IA 4H6SB 3UNQA 1P8VC 4Y71B 1TGNA 1A7SA 3M7UA 1UZJA 1EAWA 2WYJA 3UQVA 1WU1A 1AUTC 3QTOH 1KSNB 2OQUA 2BD8A 3P70B 3VPKA 1UTQA 4B2BA 1UHBA 1UJ1A 4YT7H 2ODQA 3GY6A 3SU5A 4AOQA 1GL1A 1UK4A 5DP8A 2TRMA 1EXFA 1G9IE 3SUDA 3MTYA 1O30A 2SGDE 4CRFA 1CGHA 3M37L 2C93B 2GD4B 1NZIA 1OWEA 5AHGH 1AB9C 1O5DH 5L30L 1O2WA 1ZSLA 4YOJA 1HAPH 1LQEA 1O5CB 1C2HA 4X8VH 1RD3B 2ZDMA 1M9UA 1A0HB 1MQ6A 2WG3C 4XBDA 1LMWB 1DITH 3NJPC 1LO6A 1RIWB 1HFDA 3B23B 2SGEE 1PPGE 2FESH 2V0BA 4CBOA 4MNXA 1HAFA 2TGFA 4YESB 1XKAL 1YPHC 1O3BA 3GYLB 2PR3B 1L3YA 1P02A 5E0GA 4OS2A 1VJ9U 2Y7ZA 4MPXA 3EA8A 3NZIA 1OSSA 1H4WA 1OWKA 1J14A 1KDQB 4FVDA 5LH8A 2VVCK 2W3IB 3SNBA 3P95A 1MTSA 4O02B 4IC5A 4B1TA 3A82A 2W2QE 1O3IA 3RM2H 4Y8XA 1ZJKA 1EAIC 3ZYEA 1WUNH 5L2YL 2QV1A 1EMNA 2BQ7A 4BOHA 3A8BA 1OKXA 4MPWA 2WPJS 1FV9A 4AG2A 3PO1C 1B7XB 2XCNA 1SGEE 4X1RU 3TJUA 1G32B 1O3EA 4Y0ZE 2MHPA 1V2NT 1HUTH 1V2RT 1MMJN 1SLUB 2FX4A 2PGQB 2XC4L 2BVRH 4ZXYL 2HALA 2G4TA 3LIWB 2ALVA 1ATAA 2FLBL 3UREA 1C2FA 2EI8A 4I33A 1O2RA 1QJ6B 1JV2B 1QQUA 3A88A 1DXPA 1IAUA 2MGRA 2B9LA 3FCSB 1ZTKA 3GY2A 2XYAA 2FDAA 1ANCA 1HJ9A 3RXTA 1P3EA 2J2UA 1GBMA 6LPRA 3S69A 4O97A 3M3VA 3VB6A 1AZ8A 1BRAA 3FAOA 3GISX 3GISB 6CHAB 1PTHA 3P8NA 1GHVH 1LHEH 2Z3EA 1WTHD 3CA7A 2ZU3A 5G4BA 1AFQC 2FO9A 2H1UA 3AVZA 1NC6A 1DUAA 3KQCA 1YYY1 4RKOB 1BB0B 4AFUA 3Q3KA 1PXXA 2CHAB 1HIAB 1HPGA 1BMNH 1BTZA 1LVYA 2J38B 4QT8C 1S0QA 2BVXH 2AERH 1FAXL 1XMNB 2RG3A 1LPZA 3KGPA 4J1YA 1IQNA 3M5LA 5EQRA 3MH5A 2BLOA 4JZEL 3DUXH 1GGDC 1TRMA 3R0FA 1N6YA 3SV6A 2RDLA 1C1WH 2PKAB 4ESTE 3M36L 1SOZA 4ISHH 3KL6B 4A7IB 1LHFH 5KN5C 1LHGH 1ZLRA 5F8XA 2AGEX 3S0NA 3PM3A 6GCHF 1SHYA 3RLYH 1GCTB 3EAJA 2F9PA 1UVSH 1RFNA 2Z3CA 1AE5A 1VITG 2BO2A 1FLEE 2OUAA 1CA8B 1ZHPA 2WPIE 1ARBA 1GHBF 1GJ9B 1GMHF 1SGPE 1U67A 3CENA 1IP0A 3IITA 1Z6JH 3RC4A 1AN1E 2Y38A 1J15A 3U1IB 5AVDA 5ETXA 1AIXH 1F0RB 3TK9A 2DE9A 4RRWA 3SQEE 1O37A 1OXGA 3UPEA 1DY9A 1F5RA 1GMCG 1FQ3A 1AD8H 2ZWLH 1BHXB 3BG4B 1G2LA 5BPEA 2JETB 1TPGA 1MKWH 1XKAC 5TCAA 5F8TA 4UFEH 2UWOA 1PFXL 5A2MH 1GHZA 2FI4E 1BITA 2H9HA 4BTIA 4ISNA 3K9XB 1GI1A 2ZGJA 1VR1H 1Z8GA 5C5OA 1TA2A 4U2WA 2PTNA 2A2XH 4BXSA 1HJAC 2OC0A 3UUZA 1EX3A 1QFKH 4A1TA 1FF7A 4BANB 2LNCA 1Q4GA 1P2IA 4GUXA 2STBE 4RSPA 1F0SA 1JRSA 3RDZA 4Y6DB 2QXGA 3MNSA 1O2OA 4I8HA 2TBSA 3SV8A 3U1JB 2UWPB 5FPSA 1O3DA 4X8SH 3SORA 2OYUP 2VVUL 1YUKB 1U6QA 5DK1A 4FUBA 2SFAA 2VIVA 2PV9B 1QA7A 1T8NA 1P01A 3D62A 1ZPCA 3ELAH 5CHAC 1LPKA 5PTPA 1N6XA 1LHDH 1IQFL 2V35A 1TOMH 3GDSA 2BDGA 4DIIH 1JBUH 5I46H 2CJIA 3BIUH 2ZDNA 3SOBB 1Z6EA 3RU4D 3A7YA 2JKHA 1BTPA 1QQ4A 3ATMA 4YT7L 2V3OH 1YPHE 5L2ZH 1TQ0B 4PH9A 1SGFA 2PWXA 5EPNA 2BY6X 3TH4H 1BIOA 2GCTB 1TMBH 2PUXB 3MDLA 1HNEE 1AZZA 2UUFB 2ZGCA 3GCOA 1LCYA 2GV6A 1GI7B 4AYYB 4ZAEB 3K6ZA 3A81A 4X8VL 1BHXF 1KLJH 3GOVB 2WPHS 4OS7A 4BAKB 4O1ZA 2TGPZ 2OXSA 4XE4A 4OS4A 2XBWL 1GVZA 4K8BA 3T62A 2G8TA 4X2VA 3TZIA 4NFFA 5FAHA 1T31A 2AGGX 5DGJA 1BTXA 3W94A 2A31A 2HNTF 2WINI 1QNJA 1GBJA 3HS5A 4BTTB 1QBVH 2VINA 4NGAH 5CKQA 2FYRA 3NKKA 1EATA 5EQSA 5IKVA 3O8BA 1GG6C 2RA3A 1DX5I 2ANWA 2AMDA 1PPFE 5GWZA 2WYJB 3U8RH 4BDWA 4Q7YA 3LGUA 8GCHF 2C3SA 3E1XB 1UHBB 3ZZ7A 3DA9B 4K3JA 1SVPA 1T8OA 2ZDKA 4RKJB 3NK8A 1IQGL 1MD8A 5DG6A 4X0WU 4JYUH 1GJAB 4ZHAA 4MVNA 2XC5A 2ANMH 1OWIA 3E0NB 4HGCA 1J8AA 1PRHA 2TGAA 3SUGA 2ZFSA 1SGYE 1FUJA 2GZ7A 1O5BB 3BSQA 1L0ZA 2G00A 2Z9GA 3UTUH 4K2YA 1TABE 1HRFA 5LPEA 1K28D 3DFLA 3Q00A 5K0HA 1C5UA 1HREA 1MBMA 3P5BL 1DANH 3ATKA 2XNIA 1O2ZA 3RXBA 2A5AA 2ILNA 2YNAA 3SU2A 3QH0A 4MLFB 1O33A 3KQEA 1SQOA 2GKVE 3LGTA 4TY7A 3IG6B 1PFXC 3LGYA 2PGBB 3F9GA 2F9OA 1CBWB 3A8DA 1S5SA 2Z94A 4MNVA 2Y7ZB 3SU4A 1MTVA 2VU8E 1AQ7A 2GCHG 2ZFQH 1ZYOA 1DWCH 4ZROA 3FVFB 3LT3A 2Y82B 2WPJE 1GI4A 1RIWC 1D6WA 5E0JA 1UTMA 1E37B 1H8DH 1C5OH 2FOBA 3ZVDA 4B75A 2QF3A 3E90B 1TPOA 4WMDA 1CT0E 3M7TA 4XOJA 1KXBA 1GI6A 1ZTJA 1LPGA 2BQ7B 2ZCLP 1SSXA 1F2SE 4IN2A 1UK3A 1FNIA 1QB1A 2BXUH 1CQQA 1EJMA 4K1EA 3KRKA 2BY5X 1TFXA 3GY7A 1TNLA 1ZPBA 4INLA 1ZJDA 2FS9A 1MKXK 2F9NA 3A7WA 3M5NA 4KP0A 4NFEA 1G3CA 2ZKSA 4XBBA 2NU1E 1TOZA 3MH7A 4R0IA 4X6NA 4JYVH 3A7VA 2EI8B 1YP9A 4IN1A 1JIMA 1TRNA 3LGVA 1KLTA 4UEHH 1A0LA 1V2KT 1YCPK 1ZGIA 2VWNA 3SBKA 1K22H 1V2PT 5GJ4B 3B8JA 4BTUA 3HGNA 1NFWA 2G5VA 2A45B 3QX5H 2J2UB 1BJVA 3U9AH 3LONA 1A3EH 6ESTA 1TRYA 3TGIE 4FUCA 1IQKL 3K6YA 1O36A 1EPGA 4Y0YE 2ZC9H 1C1OA 1L4DA 3P92A 1SGRE 3BTQE 4BAHB 2FOGA 2W7SA 5EU8A 3KIDU 1HBTH 3RXEA 2THFB 2ZU1A 2C8YB 3L33A 1K1IA 4X1QU 3Q3KB 1SLWB 1UO6A 2NWNA 3KQDA 4INHA 1O3HA 1UTOA 2HRVA 3ESTA 1CT4E 1WYKA 3GCTF 3E6PH 4Y7BA 1BBRH 6CHAC 1LPZB 3RXHA 3SUEA 3RMMH 2H5CA 1RXPA 2SGAA 4Y11E 3A89A 1BMMH 1RTKA 4Y7AA 1EAXA 1KXEA 4A1XA 2WPKE 1O34A 2BDBA 2XBYA 2R0KA 1ESBA 1RGQA 2PTCE 3A8CA 2B5TB 1O5EH 3FP6E 1GWAA 2P94L 1LKAA 1AY6H 2CHAC 5JB9E 3W95A 1HV7A 1EPHA 1H8IH 1SZBA 3SOVA 4OTJA 4GPGA 1RFNB 1UMAH 3NPSA 4B76A 3O8CA 1KLIL 1WBGB 2YOLA 4JZIA 1NPMA 2WFXB 2H9EH 1O3PB 1OB1C 1QFKL 4RS0A 3DD2H 2Y5GA 1EPTA 1O2SA 3UOPA 3IITB 4O03A 2F9UA 1W11U 1ZZZA 4CH8B 3KQBL 1QHRB 4FUGA 1N8OB 1O2XA 4X8SL 5C5NA 3GDVA 4GCHF 4RRZA 1IHSH 1DIYA 1C2KA 1AU8A 1GK5A 3RXVA 5E2PA 1GJBB 1SGCA 1N1IA 1GHAG 1IHTH 1G2LB 1B5GH 7GCHG 1YCPH 3BTDE 1MD7A 1T4VH 3MO9A 4Z0LA 1BMAA 1EASA 1I0UA 2UWOB 3PTNA 4DOQA 5I46L 2ZGXH 4BDXA 3HK3B 4OGYA 1Q31A 1WAYB 4BTIB 3HKJB 4ABFA 2P3TA 3TU7H 2VH6A 3HS7A 4JZFH 1P2KA 1XX9A 1MQ6L 1W3CA 4X2XA 3ENSA 3QTVH 3RP2A 5L2ZL 3MO3A 1GJDB 3VEQB 1GHYH 1KTSB 3G01A 1AHTH 4AFQA 3LTGD 2A4GA 3GY5A 4K5ZA 1TIOA 4AGKA 5JYIA 1QJ1B 5GCHG 3AAVA 1F0SB 4K60A 3UR6A 1A0JA 5BRRE 7LPRA 2HNTC 4D9RA 4MG3A 1APOA 1EQ9A 1S82A 3SJIA 1P09A 1KLJL 1EZUC 4WWYA 2ASUB 4JCNA 1C1RA 4RUTA 1Z6CA 2R9PA 3HO3A 4K8YA 4X2WA 3ATLA 1ABIH 1MQ5A 3D49H 3TIUA 1LPKB 1CHOF 1NROH 3PB1E 1SL3A 3BPSE 2UUJB 1YC0A 5B6OA 4NGAL 3BTME 3LC5A 2P3FL 2OYEP 3OY5U 1F7ZA 2XC0A 4NIWA 1K37A 3T25A 3TPIZ 1QRWA 4FU9A 2Z9LA 1ETTH 3A7TA 1HAYB 3UWJH 4X6MA 2BY9X 3LDXH 1EBVA 3ZYJB 4DW2U 3I78A 2ODYB 2VWLL 3AW0A 4JYUL 1DICA 2Y80A 2J94A 4DGJA 1MZAA 2I6QA 4JYTA 1CVWH 3UY9A 1O3CA 3E91A 4FXGH 1SQTA 4ASHA 1O3OA 1TWXB 1COUA 1WHFA 4M7GA 1ELTA 3SHAH 1L1JA 5FCRA 1IGZA 3C1KA 2OC8A 1A61H 1THSH 2ZA5A 3MH6A 5F8ZA 1VZQH 2QAAA 1AMHA 3PLKA 2PFEA 5E2OA 1BRUP 2ZTXA 3SN8A 1IOXA 2W5EA 1IQLA 2OCVB 1YLCA 5FHTA 2GCTC 1DY8A 5JBCS 3FP8E 3LJJA 1ZAQA 3TGKE 1P9JA 1E36B 5JPMH 3LKWA 4THNH 1W0YH 1C5VA 3TK5A 1YKTA 1UVOA 2EEKA 2BD2A 1KTTB 2XRCA 2GTBA 2QXHA 2JH0D 3BN9A 3Q77A 1CCVA 1EAIA 1TQ7B 1L4ZA 1NFUA 1QA0A 1A3PA 3BTHE 3T27A 1IQNL 3RXSA 1GBFA 1C1VH 1GHXH 2CXVA 1EUFA 1SMFE 4U30A 1LTOA 2ZHWH 1TNHA 4U01A 1A5HA 5E0HA 5K0HB 3KK6A 1SC8U 3OLTA 5J4SA 2CF8H 2J95A 1QGFA 3KF2A 1PQ7A 1UZPA 3N8YA 3MYWA 2HPQH 1A3BH 4NA7A 1G1TA 2BLWA 3T2NA 5T6GA 5A09A 2HGTH 3PV4A 4DY7B 4X6PA 4JYVL 2Q1JA 1TGTA 5DO4H 3MNBA 3STJA 5FXLA 4ZXXH 1ZMNA 3IJEB 2VWMA 2ZHDA 4DIHH 3ZZCA 1EOJA 2SGPE 2P28B 2Q6GA 3ZZBA 2W2PE 1F92A 1ZPZA 1O2LA 1CSOE 3EQ0H 1HAXB 5IDKA 2WPMS 4HI3A 2G4UA 4TYDA 2W2OE 4X1NU 1LPGB 1G30B 3ASIA 1TPPA 1F5LA 1ELGA 2A5KA 3P8OA 1MKWK 3POYA 3Q7DA 5COXA 1C5WB 3LC3A 4D7FA 1OP0A 2J34A 1C5SA 1CO7E 3OU0A 3GY8A 1G2MB 2BD3A 2P59A 3V12A 4E06H 1C1TA 1GBAA 4GAWA 3SJ9A 4X1PU 4MNWA 4CUFA 1P10A 3HGPA 9ESTA 2IJOB 3BEFB 2DUCA 1TPSA 3N7OA 1O2KA 1K9OE 3JZ1B 2VGCB 5GPIB 2GV7A 2AS9A 3HKIB 4NIVA 3UFAA 2RCEA 1NFWB 4ZKOU 7ESTE 1JXPA 2Q6FA 2XW9A 4DT7B 1B0FA 5I25A 2PKSB 3SNCA 4WMEA 3M37A 2H9EL 1O38A 1PYTC 3MWIU 3ZZ6A 1C5YB 4H4FA 1EP6A 4JZDL 1JRTA 1MTNB 1P2MA 3JZ2B 3NT1A 3HATH 1RRKA 2FI3E 2W7UA 1H1BA 2WYGA 2VJ1A 3H5CB 1HAVA 3BTEE 1BUIA 4FUFA 1VCWA 4AB8A 1NFYA 2HLCA 2WPKS 1S81A 2FOAA 4WH6A 4DURA 1Z6EL 1HX2A 1ZHMA 1P11E 5EGMA 4KGAA 4E05H 4Y7BB 2P95A 2JKHL 5JB9S 3Q3XA 2V6NA 1THPB 4Q80A 3MMGA 4Y7AB 4Z6AH 3F6UH 5JBAE 4M11A 2HNTE 2QA9E 3BF6H 3TNSA 2W2NE 3GCHB 1TAWA 2ZU4A 1WV7H 3O8DA 1C5XB 3RXRA 1W2KH 1ETRH 4GCHG 3V64C 1GHWH 4KTUA 1GMDG 4JZFL 1UVTH 4YLUA 3UOUA 1APQA 3A84A 3UR9A 3M3TA 1TX6A 1V2VT 2TIOA 3SV2H 4D8NA 4ISIL 1FN8A 5IYTA 3SV7A 3P8FA 1V2OT 4UONA 1C4V2 1FE2A 3ZVFA 5SGAE 1O2JA 5F1AA 1GJ4H 2BDIA 1UTLM 2ZPSA 4ZKNU 5HGGA 5TJXA 1NPEB 4WXIA 1FAKL 1SOTA 2C8WB 3SV9A 2BM2A 2XWBI 1V2MT 2FTLE 1W10U 4SGBE 4MMYB 2FEQH 3A85A 1C4Y2 1KLIH 1QBOA 3MU8A 1LHCH 2PSXA 3VB4A 4Y8YA 4JK5A 2P93A 1M1XB 2I9AA 3M35A 2DE8A 4DVAU 5ESBA 2B7DH 4HZHA 8KME2 4NIYA 2XC5L 1FIZA 3A86A 4A1VA 4MNYA 2TGTA 1BCUH 4U32A 1P2JA 2BD9A 2G51A 4B73A 1DLKB 2F91A 5EPYA 4FUJA 5C2ZA 3RXDA 1YPMH 2G00L 1N8OC 4I8KA 5A8ZA 3BTGE 3VGCB 2P3TB 2VH6B 3OYPA 3Q76A 3RM0H 4YZUA 1O2PA 1EZQA 3MI4A 4KTCA 1CA0C 1FJSA 3I77A 1AE8H 2ZDLA 1CGIE 1ANBA 3TJOA 1EJNA 1CVWL 1C1UH 4TPYA 3SZNA 1ELDE 3RMOH 3N8XA 3ZZAA 2RA0L 3KQEL 3EYDA 1DSTA 1QRZA 1DXWA 4FU7A 1BTHH 1INCA 1C9TA 2XBVA 3V3MA 4FUDA 2Y7XA 4LK4A 1QJ7B 2BXTH 1GI5A 1DWDH 2QCYA 3FZZA 1DOJA 3CS7A 1XXDA 1C2JA 4NWKA 3S7HB 3DHKH 3GCXE 5FBEA 2ZIQH 3UNSA 3LC5B 1LMJA 5DPAA 4I8GA 4RRXA 1AGJA 4R8TB 1V6DA 3DEMA 1O5GH 2NU4E 1HCGA 1PJPA 3OY6U 1DUEA 5A0CA 3NCLA 4IGDA 1ZSKA 2ANYA 3RXUA 3V7TA 1WTGH 2FZZA 2Y5HL 1NTPA 2PSYA 1QBNA 1XUHA 2DDUA 1JIRA 1Y3WA 2BZAA 1QCPA 1NT1A 1O2HA 2Y80B 2J94B 1OWHA 1O35A 3U98H 4ZMAH 3ODFA 1AB9B 2ODPA 2P3FH 3FZDA 4Y71A 1EZSC 1E38B 2ZHEH 2F9VA 2O8UA 3IWMA 2F9BH 5FBIA 5H4IB 2ZZUH 5IKRA 1WU1B 4GSOA 2PHBA 3HO5A 1AVWA 3QGJA 2JH5D 2C8XB 5JBCE 3LH3A 1YPLH 4X8TH 1HDTH 2G5NA 1ANEA 1URKA 1NT0A 2P8OB 2QY0B 4Q7XA 5TCCA 1NS3A 2GP9B 1Z1JA 1AVXA 2PUQH 1FZZA 1VITH 4ZXXL 4I31A 2WV4A 4FUEA 1DDJA 4KELA 3TNTA 1OOKB 1DDXA 3P6ZB 3B9FH 3KQDL 3TK5B 4IMZA 2A4QA 3SU1A 1PQ5A 2VWOL 4IMQA 3MNCA 3BTFE 2F3CE 1V2UT 4WMFA 3SI4H 2WFTA 1Z8IB 1GVKB 1NFUB 1BBRK 1U8CB 4C16A 1V2TT 1GDQA 2MGPA 3P8GA 3U73A 4ABHA 1C1QA 2AEIH 5FX5A 5A8YA 9LPRA 4X1SU 4KTSA 1LQDA 3GDUA 4I7YH 1RS0A 1O3LA 1C5MD 4XBCA 2W3IA 3O8RA 3F68H 1O0DH 1PQAA 5CKNA 3SOSA 2J95B 2AMQA 3ZZ3A 1P57B 2ZF0H 1S6HA 3N8YB 3DFJA 2UUKB 1IQIA 1SPJA 2P3UA 1WSSH 3BT1A 1YPGH 2QGRA 3A7ZA 1BTUA 2Q1JB 4COXA 1J16A 3QWCH 2Y5GL 1F5KU 1PPBH 1HAEA 5JBTA 2BQWA 3AAUA 4MQAA 1W7GH 1J9CH 3PMAB 4MDSA 2H5DA 2WPME 5L6NH 2HOBA 2Z9IA 5LPFA 5DP6A 2EA3A 1HJ8A 3TJNA 1S84A 3T28A 2WV5A 1MTWA 4DCDA 5IKQA 1N7DA 1AFQB 2UUYA 2FPZA 2GDEH 4ABAA 1PGEA 5F6MA 4E1GA 4MPVA 1SR5C 4NCYA 2FWWA 1O2IA 2ZTZA 1GJ7B 2FLGA 1C5ZB 2KAIA 1DE7H 2BB4A 2J34B 1EOLA 3GCWE 2EI7A 3U69H 2VH0A 1WOFA 2QYIA 1T4UH 2XXLA 2ZECA 4Y10E 1JMOH 1O5AB 4HTCH 1T7CA 1MBQA 1GGDB 1O2VA 3PROA 1FIWA 3RC5A 4Z6AL 3TK6A 3F6UL 2W3KA 2AFQB 2SGQE 1GJ6A 4K1SA 2BOUA 1RJXB 2BOHA 1A4WH 6GCHG 3TLOA 2EI6A 2UWLA 1DM4B 2HPPH 3RXPA 2XBXA 1IQGA 3FFGL 3TGJE 1O32A 3RXAA 1DLEA 1P9SA 3PMJA 3SO3A 5EW1H 5DP7A 1O3GA 1GHBG 1P2NA 3AASA 3SI3H 3PLBA 1GMHG 1TPAE 1TX7A 1MQ5L 1ZGVA 3VFEA 1OYQA 2BOKA 4GVUA 1HZ8A 3QGNB 1D3TB 5GXPA 1RTFB 2VGCC 2WYGB 2VB0A 1C5RA 1HAVB 2WPLE 2XC0L 2XTTB 5GIBA 1Z8JB 1MCVA 1O2MA 2CV3A 1GCDA 1ZRBA 3MHWU 4Q7ZA 2AMPA 4WH8A 1CX2A 4ZKSU 3TITA 5JBAS 1QIXB 2BQ6A 1V2LT 2PKSC 1KXCA 3PGHA 3SGBE 5EGMB 2ZGBH 4A92A 1QR3E 1VGCB 4GHQA 1D3QB 1XKBA 1IQEA 1ZTLA 1C1NA 2J92A 3BIVH 2GGVB 2B7DL 3A80A 2SNVA 1H9LB 4JZDH 3SGAE 1GL0E 1C2LA 1W0ZU 2ANKH 5A0BA 2C90B 5AFZH 4LZ4B 1IOEL 4CRDA 1F0RA 1MAXA 1NZQH
chains in the Genus database with same CATH superfamily
4YXWD 1AFEH 1BBRE 2XWAA 1AI8H 1FY4A 1BMFD 1GCTC 1HJAB 1MUEB 2P3FN 1ESTA 2FODA 2VVVA 3UWIA 1VITF 3VG8A 3AW1A 1NRQH 1GI8B 1ORFA 4GHTA 1ANDA 1LKBA 4HFPB 1K1JA 2ALPA 2NU0E 4ABJA 3M61U 1IQLL 1TGSZ 3ZVBA 3E0PB 4LOYH 3GCHC 1SB1H 3VB7A 5HXFA 1A1RA 1SGQE 3GYMA 3LGIA 3KCGH 4ZKRU 1FX0B 4XLWA 3VB3A 1UCYH 1TLDA 2BZ6H 1ATBA 1EQHA 1CE5A 3I29A 2KV4A 3TH3L 1TX8A 5CHAB 1O2YA 1GMCF 4WF8A 4LZ1H 1FY3A 2FOCA 1D3DB 3CS0A 2FIRH 2ZP0H 4ISIH 1GI0A 2GX4A 1NRPH 3BG4C 4CRBA 4B74A 3URDA 1HYLA 1IQJA 2JETC 2Y5FA 2W6JD 2ZTYA 4Y8ZA 3S9AA 4AZ2B 3VB5A 3RMNH 4CRAA 2VVCA 3FP7E 1E0FD 4BAMB 2VIDA 4YOIA 2WZQA 3A87A 1K1PA 1FAKH 1EPJA 2VJ3A 2KB9A 1P3CA 1CEJA 2GMTB 1KXDA 1UTPA 3PWCA 4XDEA 2CF9H 3PYHA 3RXFA 4YZUB 3ZZ4A 5K7RA 2RNLA 1NRSH 3TGFA 3S9BA 1EZQB 1TALA 1WCZA 3RLWH 5CE1A 2JH6D 5FL7D 5EQQA 2KX4A 3T29A 3D65E 2P16A 3BT2A 1C1PA 1IQMA 3MNXA 2W26A 3ZZ9A 1SFIA 4O9VA 3MU1A 3LN0A 1XUFA 4AYVB 1Z7KA 1BTWA 3WY8A 2CJIB 1WQSA 4ABGA 1NU9A 1Y59T 2F9BL 3RR3A 4CRGA 1HAZB 6COXA 2FOMB 2K2TA 2Y7XB 1YUGA 2FOEA 1PQ8A 2V7QD 3GY3A 4YOGA 3HK6B 5C20A 1GI9B 1C5NH 1HRTH 3R05A 4YT6H 4X8TL 1TNIA 1TA6A 3ZV9A 4AFSA 1K1MA 3RXQA 1GJ8B 4ABBA 3LGWA 1YCPM 4NSVA 4ZHLU 4ISOA 3SU6A 2PUQL 2LP6A 1P0SH 1GG6B 1QTFA 2H9TH 4LXBH 1V3XA 1O5FH 4WY3A 4A5TS 1BT7A 1HCGB 1P06A 2A4OA 4XD7D 1W12U 2WG4B 1GVLA 1LDTT 1LVBA 3F9HA 1HXFH 2BY8X 8GCHG 1UTNA 4IBLH 1C2DA 1W14U 1IGXA 3M7QA 4UD9H 1YPEH 2BOXA 2OC7A 5DP9A 1G37A 3L3TA 1OPHB 1XM1A 3LJOA 1ELAA 5FPYA 2A7JA 1QL9A 3L6PA 3KQCL 2AIPA 3PWBA 1F0TA 2BDYA 1NBME 3HPTA 2PHBB 3E16B 4OGXA 2BDHA 1LVOA 3EA7A 3RC6A 3K65B 1P03A 1BRBE 4XFQA 5CISA 2A2QH 2SNWA 1G1RA 1GBBA 3ZVEA 4ZHAB 4ASUD 4YTAA 4NG9L 5HMAA 1DVAL 5EXMA 3RUOA 5C3NA 1LMMA 2LELA 2R3YA 3MQEA 1O3AA 1G1SA 2ZU5A 1EPIA 2FMJA 2ZCKP 1FPCH 2YNBA 1JWTA 1NY22 1J9CL 1C1MA 1UZKA 1O3MA 1Y3VA 2Y81A 5FX6A 1YM0A 3OTJE 1ID5H 3LOXA 3QK1A 1EQGA 1EKBB 2AIQA 8LPRA 2BVSH 1GI2A 1MU6B 3QDZB 1FFMA 2BY7X 2K0QA 2P95L 4I8JA 1IQHA 3T5FH 1Y3XA 2P8OC 4JMYA 1VKYA 1C2IA 2BHGA 4Q2KA 2BX4A 1SGIB 2VIQA 2K2SB 2VIOA 1S0RA 2GVFA 3CENL 1EP5A 3RXMA 5C1YA 2QIQA 1ADXA 3ZV8A 2PW8H 1GBCA 3P17H 2BMGA 2AH4X 3W1EA 4MMZB 1LQDB 2FOFA 2NU3E 2Y82A 1Z71A 3EGFA 1E34B 1CGJE 1ZSJA 5E8DA 3LAQA 1F0UA 5EW2H 1C2EA 4B71A 4ZH8A 2FLRH 4CBNA 1AKSA 1TOCB 1XUIA 5LPRA 2I6SA 3A83A 2P3UB 1ATDA 1YF4A 4KKDA 5JB8E 4X8UL 1L1GA 4YM9A 1UTKA 3U7UG 4NZQA 3GY4A 2F43B 2Z9JA 1CBWC 1P2QA 1TONA 1C5LH 2G55A 2ZI2H 3N8WA 2BQWB 3OFND 1D6RA 2GCHF 1SGTA 2VWLA 4TT3D 4Y79A 1GDNA 1BMLA 1Y3UA 1T8LA 3RU4E 1TB6H 3ZZDA 1OP8A 1GBDA 4FUIA 3PV2A 4I32A 4I86A 1CU1A 3E8LA 2P93L 3ATIA 4CUEA 2M5TA 1Y5BT 2D2DA 4NA9L 1EAUA 1SQRA 4ABIA 2A4RA 1O39A 4BTUB 1DQBA 4D7GA 2KAIB 3QO6A 1TMUH 1X7AL 4LORA 3GCTG 5ESTE 2EI7B 2VH0B 3SJOA 4K1TA 5A0AE 1NO9H 1SGDE 1UTJA 2ZNKH 3E3TA 1CT2E 3RXGA 3KYGA 3V0XA 1FJSL 4WXVA 3TK6B 1G3BA 3SNAA 2W3KB 3KNXA 4Y76A 3NXPA 2F83A 3F0OA 1DPOA 1ELCA 2R0LA 4G1MB 1SI5H 2BOHB 2J4IA 1FONA 4IS5A 1K2I1 4AB9A 2EI6B 2UWLB 1Q2WA 1YO8A 2XBVL 3OX7U 5HYOA 1FY8E 2WHXA 3MU5A 2O8WA 4AN7A 3SU3A 2FM2A 3F9FA 1OWJA 2OTVA 3SW2A 1DX5M 1L1NA 2WPLS 1S83A 3CS7L 4D9QA 3BEIB 1LVMA 3EE0B 1ABJH 2D1JA 1NESE 2QXIA 2FD6A 1PPCE 2A1DB 3ZZ8A 4B6FA 2ZHQH 4VGCB 3H7OA 2A5IA 2VIPA 4LMFA 3KYFA 3KCGL 5FDQA 2FTMA 3ODDA 2BZ6L 2FZZL 1BQYA 1YPJH 2BQ6B 2ZPQA 4UFFH 1Y5AT 3H09A 1JOUB 2O8TA 3SQHE 1NRRH 1EZXC 1ZMJA 4O3TA 4IC6A 3C27B 4TPIZ 1GI3A 1Z8RA 2ESTE 3QUMP 4Z0KA 4TGFA 1EPTB 4AX9H 4O3UA 4RN6A 5JBBS 1TBZH 2YGPA 1F7MA 3M3SA 1K1OA 1A5IA 1C2MA 4AG1A 5EXNA 3GCNA 4X6OA 1MCTA 2Q6DA 2ZGHA 2XC4A 2BLQA 4ZUHA 1ACBE 2QF4A 2VWMK 1BZXE 2CGAA 4ABDA 1VGCC 1KIGH 1AUJA 1ARCA 3LPRA 1ETSH 1GJ5H 1O3JA 3TH3H 1NFXA 2Z6BD 1RTLA 4OM9A 1HJ7A 1W13U 1QRXA 1CHGA 2FX6A 1T8MA 1DT2A 2FI5E 2QE7D 1GBKA 1UVPA 1GBLA 2BD7A 1ATEA 3TVJB 1QURH 3HS6A 4INKA 2KR7A 1ZRKA 2BDCA 4YT6L 1GHAF 1ZR0A 1H8ED 7GCHF 3F1SB 1CHOG 3A8AA 3ENSB 1Y8TA 3QLPH 1DWBH 1XUJA 2KCOA 1OX1A 1P0SL 3MFJA 4CHAB 2EC9H 1KYNA 5T3HA 3MOCA 1GDUA 1FAXA 2ZQ2A 5HKKD 4B2AA 1V2WT 3K2UA 7KMEH 1MOXC 5HM9A 3M5MA 1TLEA 2O8LA 1K1NA 2B0FA 4H6TA 2XOKD 3R3GB 2ZEBA 4NSYA 2ZFPH 3MU0A 4SGAE 2W86A 2YGOA 4AGJA 2ULLA 1BRCE 4TWWA 1TNJA 5T6FA 3BTWE 1SG8B 1IQIL 4CRCA 2W26B 4NZLA 3M36A 1V2ST 1W0JD 3S9CA 3UIRA 1DWEH 3RXLA 3MO6A 5GCHF 2FOHA 2OINA 1O2QA 5E8EH 5CMXH 3EDXB 3NTGA 1X7AC 2KL7A 3N7DA 1HAHH 2BLVA 1HXEH 2OBOA 2GMTC 1ELFA 1TYNA 1V2JT 2ZU2A 4D90A 3H7TA 2FXRA 1XDTR 1UVUH 3V13A 3PTBA 3S7KB 1W7XH 2ZFRH 5JDUB 1YGCH 1A2CH 5EODA 5DP4A 3A7XA 2IOTA 1O5DL 5F03A 3TBDA 1W8BH 2Z9KA 4FVBA 3SNDA 1V3XB 4DG4A 1H9HE 2ZFTA 4NIXA 2VWNL 1KSNA 4YLQH 3SHCH 1HB0B 2EY4C 2HOXA 5DP3A 2A7CA 2I9BA 2O8MA 4D0EA 3CFWA 3FANA 3ZIAD 3ZYDA 1P05A 4CUDA 1SQAA 4OS6A 3U28C 3C9AC 1K0HA 1GBEA 2ZDAH 2EQNA 3DSOA 3GICB 4E7NA 2BDAA 1DS2E 2QXJA 3RXJA 4YO9A 2CN0H 1E35B 4UFGH 3ZVAA 2GD4A 2BX3A 1VCPA 3EE7A 1YWUA 1BTYA 1DFPA 2BTCE 2QN5T 1HGTH 1OWDA 1HLTH 1SHHB 4TWYA 1C5MF 1VJAU 1C5PA 1NM6A 4BAOB 3HPTB 1YUFA 2XBXL 5DN6D 1O2GH 3FN8A 1QL8A 2BYAX 2FLRL 2OP9A 2AYLA 2GDDA 1D3PB 1J17T 1YLDA 2ZPRA 1TE0A 4Q63A 2ZG0H 2PR3A 3BG8A 3QN7A 2ADXA 1YBWA 2A0QB 3LH1A 4UFDH 2BOKL 5IKTA 2XBYL 2FS8A 5CHBA 4D76A 5JVZA 2VVUA 3PO1B 5GNDA 3UNRA 1HT8A 2BD4A 4RT0A 1O3NA 1V2QT 2Y6TA 4CR9A 1EJAA 1KDQA 4FU8A 1FY5A 3QZRA 3ZVGA 2NPRA 1G36A 2Y81B 1SGFG 1K21H 4UE7H 1QB9A 1YPKH 4OS1A 4CREA 1IQFA 2R2MB 2G52A 1N1LA 1QB6A 2RA0A 1ZHRA 4IW4E 1CVUA 1IQEL 1P9UA 1Y5UT 2D26C 5KIRA 4NG9H 3SJKA 1DVAH 5L30H 3QCWA 4M10A 2PLXA 1P12E 2AYWA 3PMBB 2M74A 3VXFH 4OS5A 2BMGB 1NU7B 1XUKA 1B9WA 5KECA 2XCFA 5JB8S 3UQOA 2HWLB 4ABEA 1O31A 2QF0A 2A32A 3LN1A 5HM2A 1ELEE 2VVVL 4ZH8B 1BF9A 1AWFH 1AKSB 3LIWA 5DJ7A 4TY6A 4JK6A 3BV9B 1HAOH 1TMTH 1A5GH 1GPZA 1H9IE 2A7HA 1B0EA 1FI8A 1OS8A 4XSKU 3RXIA 3STIA 3PV5A 3NWUA 3MH4A 3N8WB 5AF9H 2Y5HA 1C2GA 3N8ZA 2J9NA 1O2UA 2XBWA 1MZDA 3ZYGA 2W2ME 1WQVH 3LC3B 2Z7FE 2IN2A 3BTTE 2IPHA 4Y79B 2H2ZA 1G2MA 3FO8D 1UK2A 2RHPA 5C94A 5T6DA 1UCYK 5A8XA 1O2TA 2Z3DA 3LU9B 5L2YH 1VCQA 4X8UH 1OYTH 1L5GB 1IVOC 4WVPE 2Y5FL 1IQJL 1C1SA 1IJQA 1A46H 1HIAA 2P26A 4ISHL 2ZCHP 3EGKH 3M5OA 4OTYA 3DT0H 2J38A 4FUHA 3FBYA 4JZ1A 5EOKA 3SU0A 1AVGH 2H6MA 4ZXYH 5J4QA 1O2NA 2D8WA 2OC1A 2FLBH 1S6FA 2J98A 3TJVA 5AFYH 2P16L 2O9QA 4I8LA 3ZYIB 3KEEA 1IQML 4Y76B 2PKAA 3U8OH 1UZQA 4CSYA 5JW1A 1K1LA 1SGNE 4A7IA 2OQ5A 3KL6A 4NA9H 3RXOA 3LTFB 1MH0A 4WJG2 2J4IB 2BD5A 1SBWA 1PPZA 2VWOA 1AUTL 2VNTA 1NFYB 1CCFA 2ZO3H 4GLYA 4H42U 1QY6A 1C5QA 2C4FH 1PPHE 4RRYA 3NTBA 3F2GA 3SW2B 3U8TH 1KIGL 2QC2A 3NUMA 4CR5A 4PROA 1E1QD 5EXLA 1G3EA 1C5TA 2D1JB 2STAE 2ZFFH 1KXFA 3EA9A 1XUGA 1MTNC 2OLGA 1JL9A 1QL7A 1XXFA 3TH2H 2WPIS 1TNKA 4F49A 4MMXB 2WUBA 2ZHFH 5DKMA 4ISLA 3PLPA 5JBBE 1EGFA 2V3MA 1D4PB 3F9EA 1FPHH 2GT7A 2K1QA 4JZEH 1NRNH 2V3HH 1ELVA 3Q3YA 4MTBA 4Z0KB 1EB2A 4UDWH 4ZHMU 1EB1H 1BOQA 2ZDVH 5DP5A 2C8ZB 3T26A 1HT5A 2R3UA 1D9IA 2CMYA 5JVYA 1MKXH 3RXKA 3QMOA 1SLXB 1FMGA 4VGCC 3K9XA 3ZZ5A 1E79D 1MTUA 1T32A 1GJCB 3SGQE 1GMDF 1OP2A 1KLOA 3D23A 3KHVA 1CA0B 3ELAL 5EG4A 1BA8B 1Q3XA 3BEUA 1TBRH 3SNEA 1BJUA 1ESAA 1S85A 2OBQA 4BAQB 1XKBC 1K36A 3ITIA 1PPEE 4B2CA 1NFXB 4NA8A 1JBUL 2R2WU 1CQEA 1EPTC 4NWLA 4Y6DA 4ACBA 1FN6A 5C1XA 1Y3YA 2UWPA 4DJZB 3VXEH 4AQTA 1FSBA 5HIZA 1L2EA 1PYTD 1IQKA 3ATWA 3CP7A 1FY1A 5FPTA 2RFKC 3QZQA 1ELBA 1TGCA 1W7XL 4XBMA 1THRH 1YGCL 1GBIA 5GDSH 1WHEA 2LPRA 3OSYA 4K69A 5ABWA 1GBHA 2KZ4A 1O3FA 1IQHL 5F19A 1FXYA 3ZVCA 5C1UA 2SGFE 4F4OC 1W8BL 1G1QA 1F7EA 1AO5A 4D0FA 1GBTA 2G81E 1ZOMA 3BTKE 4AORA 5FCKA 1UCYE 1C9PA 2TPIZ 3MU4A 2VIWA 4BXWA 3FFGA 3URCA 4A6LA 1DSUA 5EIYA 1XVMA 4FOUC 3VGCC 4FM5A 3KN2A 2GZ8A 4E7RG 4BNRA 1KY9A 3RMLH 1P2OA 3SOQA 4AFZA 1BDAA 2OD3B 3OTPA 1MAYA 3RU4T 5C67A 4XL1A 1EMOA 1AWHB 3PMHB 2NU2E 2AGIX 2P94A 3SJ8A 4MPUA 4X2YA 8ESTE 1G3DA 1HAGE 3RXCA 1O3KA 3SUFA 4CHAC 2TGDA 4ZAEA 3V65B 1NQLB 1ZMLA 1P04A 2GT8A 2FP7B 3N8VA 1TGBA 2WUCA 1HAIH 1TNGA 2HVXA 3OLUA 4J2YB 1KXAA 3HO4A 2GZ9A 1TBQH 1SFQB 2IPQX 5LGOA 1NN6A 2ZQ1A 2CK3D 1SLVB 2FYQA 3NRLA 5CKMA 4BTTA 2WPHE 1FDPA 1MU8B 1C4U2 2B8OH 1XVOA 3KQBA 4CH2B 1XFEA 1IOEA 1Z1IA 4H6SB 3UNQA 1P8VC 4Y71B 2WSSD 1TGNA 1A7SA 4DT4A 3M7UA 1UZJA 1EAWA 2WYJA 3UQVA 1WU1A 1AUTC 3QTOH 1KSNB 2OQUA 2BD8A 3P70B 3VPKA 1UTQA 4B2BA 1UHBA 1UJ1A 4YT7H 2ODQA 3GY6A 3SU5A 4AOQA 1GL1A 1UK4A 5DP8A 2TRMA 1EXFA 1G9IE 3SUDA 3MTYA 1O30A 4AC9A 2SGDE 4CRFA 1CGHA 3M37L 2C93B 5B6LA 2GD4B 1NZIA 1OWEA 5AHGH 3MQKC 1AB9C 1O5DH 5L30L 1O2WA 1ZSLA 4YOJA 1HAPH 1LQEA 1O5CB 1C2HA 4X8VH 1RD3B 2ZDMA 1M9UA 1A0HB 1MQ6A 2WG3C 4XBDA 1LMWB 1DITH 3NJPC 1LO6A 1RIWB 1HFDA 3B23B 3DSPA 2SGEE 1PPGE 5EJLA 2FESH 2V0BA 4CBOA 4MNXA 1HAFA 2TGFA 4YESB 1XKAL 1YPHC 1O3BA 3GYLB 2PR3B 1L3YA 1P02A 5E0GA 4OS2A 1VJ9U 2Y7ZA 4MPXA 3EA8A 3NZIA 1OSSA 1H4WA 1OWKA 1J14A 1KDQB 4FVDA 5LH8A 5C0TA 2VVCK 2W3IB 3SNBA 3P95A 1MTSA 4O02B 4IC5A 4B1TA 3A82A 2W2QE 1O3IA 3RM2H 4Y8XA 1ZJKA 1EAIC 3ZYEA 1WUNH 5L2YL 2QV1A 1EMNA 5EJ1A 2BQ7A 3DCLA 3A8BA 4BOHA 1OKXA 4MPWA 2WPJS 3FOAA 2KCYA 2L6OA 1FV9A 4AG2A 3PO1C 1W0KD 1B7XB 2XCNA 1SGEE 4X1RU 2HLDD 3TJUA 1G32B 1O3EA 4Y0ZE 2MHPA 1V2NT 1HUTH 1V2RT 3OEHD 1MMJN 1SLUB 2FX4A 2PGQB 2XC4L 2BVRH 4ZXYL 2HALA 2G4TA 3LIWB 2ALVA 1ATAA 2FLBL 3UREA 1C2FA 2EI8A 4I33A 1O2RA 1QJ6B 1JV2B 1QQUA 3A88A 1DXPA 1IAUA 3KQ5A 2MGRA 2B9LA 3FCSB 1ZTKA 3GY2A 2XYAA 2FDAA 1ANCA 1HJ9A 3RXTA 1P3EA 2J2UA 1GBMA 6LPRA 3S69A 4O97A 3M3VA 3VB6A 1AZ8A 1BRAA 3FAOA 3GISX 3GISB 6CHAB 1PTHA 3P8NA 1GHVH 1LHEH 2Z3EA 1WTHD 3CA7A 2ZU3A 5G4BA 1AFQC 2FO9A 2H1UA 3AVZA 1NC6A 1DUAA 3KQCA 1YYY1 4RKOB 1BB0B 4AFUA 3Q3KA 1PXXA 2CHAB 1HIAB 1HPGA 1BMNH 1BTZA 1LVYA 2J38B 2YMSD 4QT8C 1S0QA 2BVXH 2AERH 1FAXL 1XMNB 2RG3A 1LPZA 3KGPA 4J1YA 1IQNA 3M5LA 5EQRA 3MH5A 2BLOA 4JZEL 3DUXH 1GGDC 1TRMA 3R0FA 2J98B 1N6YA 3SV6A 2RDLA 1C1WH 2PKAB 4ESTE 3M36L 1SOZA 4ISHH 3KL6B 4A7IB 1LHFH 5KN5C 1LHGH 1ZLRA 5F8XA 2AGEX 4Z1MD 1S6LA 3PM3A 3S0NA 6GCHF 1SHYA 3RLYH 1GCTB 3EAJA 2F9PA 1UVSH 1RFNA 2Z3CA 1AE5A 1VITG 2BO2A 1FLEE 2OUAA 1CA8B 1ZHPA 2PP6A 2WPIE 1ARBA 1GHBF 1GJ9B 1GMHF 1SGPE 1U67A 3CENA 1IP0A 3IITA 1Z6JH 3RC4A 1AN1E 2Y38A 1J15A 3U1IB 5AVDA 1NBMD 2L74A 5ETXA 1AIXH 1YLNA 1F0RB 3TK9A 2DE9A 4RRWA 3SQEE 1O37A 1OXGA 3AK5A 3UPEA 1COWD 1DY9A 4HG6A 1F5RA 1GMCG 1FQ3A 1AD8H 2ZWLH 1BHXB 3BG4B 1G2LA 5BPEA 2JETB 1TPGA 1MKWH 1XKAC 5TCAA 5F8TA 4UFEH 2UWOA 1PFXL 5A2MH 1GHZA 2FI4E 1BITA 4GU4A 2H9HA 2JJLA 4BTIA 4ISNA 3K9XB 3SZEA 1GI1A 2ZGJA 1VR1H 1Z8GA 5C5OA 1TA2A 4U2WA 3N99A 2PTNA 2A2XH 4BXSA 1HJAC 2OC0A 3UUZA 5DSFA 1EX3A 1QFKH 4A1TA 1FF7A 4BANB 2LNCA 1Q4GA 1P2IA 4GUXA 2STBE 3PRDA 4RSPA 1F0SA 1JRSA 4A94C 3UAIC 3RDZA 4Y6DB 2QXGA 3MNSA 1O2OA 4I8HA 2TBSA 3SV8A 3U1JB 2UWPB 5FPSA 1O3DA 4X8SH 3SORA 2OYUP 2VVUL 1YUKB 1U6QA 5DK1A 4FUBA 2SFAA 2VIVA 2PV9B 1QA7A 1T8NA 1P01A 3D62A 1ZPCA 3ELAH 5CHAC 1LPKA 5PTPA 1N6XA 1LHDH 1IQFL 2V35A 1TOMH 3GDSA 2BDGA 4DIIH 1JBUH 5I46H 2CJIA 3BIUH 2ZDNA 2JIZD 3SOBB 1Z6EA 3RU4D 3A7YA 2JKHA 1BTPA 1QQ4A 3ATMA 4YT7L 3F3BA 2V3OH 1YPHE 5L2ZH 1TQ0B 4PH9A 1SGFA 2PWXA 5EPNA 2BY6X 3TH4H 1BIOA 3CNRA 2GCTB 1TMBH 2PUXB 3MDLA 1HNEE 1AZZA 2UUFB 2ZGCA 2GJGA 2KM0A 3GCOA 1LCYA 2GV6A 1GI7B 4AYYB 4ZAEB 1QIUA 3K6ZA 3A81A 4X8VL 1BHXF 1KLJH 3GOVB 2WPHS 4OS7A 4BAKB 4O1ZA 2TGPZ 2OXSA 4XE4A 4OS4A 2XBWL 1GVZA 4K8BA 3T62A 2G8TA 4X2VA 3TZIA 4NFFA 5FAHA 1T31A 2AGGX 5DGJA 1BTXA 3W94A 2A31A 2HNTF 2WINI 1QNJA 1GBJA 4ACAA 3HS5A 4BTTB 3FKSD 1QBVH 2VINA 4NGAH 5CKQA 2FYRA 3NKKA 1EATA 5EQSA 5IKVA 3O8BA 1GG6C 2RA3A 1DX5I 2ANWA 2AMDA 1PPFE 5GWZA 2WYJB 3U8RH 4BDWA 4Q7YA 3LGUA 8GCHF 2C3SA 3E1XB 1UHBB 3ZZ7A 3DA9B 4K3JA 1SVPA 1T8OA 4FETA 2ZDKA 4RKJB 3NK8A 1IQGL 1MD8A 5DG6A 4X0WU 4JYUH 1GJAB 4ZHAA 1WXRA 4MVNA 2XC5A 2ANMH 1OWIA 3E0NB 4HGCA 1J8AA 1PRHA 2TGAA 3SUGA 2ZFSA 2WZPP 1SGYE 1FUJA 2GZ7A 1O5BB 3BSQA 1L0ZA 2G00A 2Z9GA 3UTUH 4K2YA 1TABE 1HRFA 5LPEA 1K28D 3DFLA 3Q00A 5K0HA 1C5UA 1HREA 1MBMA 3P5BL 1DANH 3ATKA 2XNIA 1O2ZA 5IK2D 3RXBA 2A5AA 2BT8A 1UW7A 2ILNA 2YNAA 3SU2A 3QH0A 2KCAA 4MLFB 1O33A 2K8IA 3KQEA 1SQOA 2GKVE 3LGTA 4TY7A 3IG6B 1PFXC 3LGYA 2PGBB 3F9GA 2F9OA 1CBWB 3A8DA 3DSGA 1S5SA 2Z94A 4MNVA 2Y7ZB 3SU4A 1V1IA 1MTVA 1AQ7A 2GCHG 2VU8E 2ZFQH 1ZYOA 1DWCH 4ZROA 3FVFB 3LT3A 2Y82B 2WPJE 1E1RD 2YGQA 1GI4A 1RIWC 1D6WA 5E0JA 1UTMA 1E37B 1H8DH 1C5OH 2FOBA 3ZVDA 4B75A 2QF3A 3E90B 1TPOA 4WMDA 1CT0E 3M7TA 4XOJA 1KXBA 1GI6A 1ZTJA 1LPGA 2BQ7B 2ZCLP 1SSXA 1F2SE 4IN2A 1UK3A 1FNIA 1QB1A 2BXUH 1CQQA 1EJMA 4K1EA 2XNDD 3KRKA 2BY5X 1TFXA 3GY7A 1TNLA 1ZPBA 4INLA 2JDID 1ZJDA 2FS9A 1MKXK 2F9NA 3A7WA 3M5NA 4KP0A 2OK5A 2W6ID 4NFEA 1G3CA 2ZKSA 4XBBA 2NU1E 1TOZA 3MH7A 4R0IA 2KNIA 4X6NA 4JYVH 3A7VA 2EI8B 1YP9A 4IN1A 1JIMA 1TRNA 3LGVA 1KLTA 4UEHH 1A0LA 1V2KT 1YCPK 1ZGIA 2VWNA 3SBKA 1K22H 1V2PT 5GJ4B 3B8JA 4BTUA 3HGNA 1NFWA 2G5VA 2A45B 3QX5H 2J2UB 1BJVA 2JJ2D 3U9AH 3LONA 1A3EH 6ESTA 1TRYA 3TGIE 4FUCA 1IQKL 3K6YA 1O36A 1EPGA 4Y0YE 2ZC9H 1C1OA 1L4DA 3P92A 1SGRE 3BTQE 4BAHB 2FOGA 2W7SA 5EU8A 3KIDU 1HBTH 3RXEA 2THFB 2ZU1A 2C8YB 3L33A 1K1IA 4X1QU 3Q3KB 1SLWB 1UO6A 2NWNA 3KQDA 4INHA 1O3HA 1UTOA 2HRVA 3ESTA 1CT4E 1WYKA 3GCTF 3E6PH 4Y7BA 1BBRH 6CHAC 1LPZB 3RXHA 3SUEA 3RMMH 2H5CA 1RXPA 2SGAA 4Y11E 3A89A 1BMMH 1RTKA 4Y7AA 1EAXA 1KXEA 4A1XA 2WPKE 1O34A 2BDBA 2XBYA 2R0KA 1ESBA 1RGQA 2PTCE 3A8CA 2B5TB 1O5EH 3F2HA 3FP6E 1GWAA 2P94L 1LKAA 1AY6H 2CHAC 2J5UA 5JB9E 3W95A 1HV7A 1EPHA 1H8IH 1SZBA 3SOVA 4OTJA 4GPGA 1RFNB 1UMAH 3NPSA 4B76A 3O8CA 1KLIL 1WBGB 2YOLA 4JZIA 1H8HD 1NPMA 2WFXB 2H9EH 5KEDA 1O3PB 1OB1C 1QFKL 4RS0A 3DD2H 2Y5GA 1EPTA 1O2SA 3UOPA 3IITB 4O03A 2F9UA 1W11U 1ZZZA 4CH8B 3KQBL 1QHRB 4FUGA 1N8OB 1O2XA 4X8SL 5C5NA 3GDVA 4GCHF 4RRZA 1IHSH 1DIYA 1C2KA 1AU8A 1GK5A 3RXVA 5E2PA 1GJBB 1SGCA 1N1IA 1GHAG 1IHTH 1G2LB 1B5GH 7GCHG 1YCPH 3BTDE 1MD7A 1T4VH 3MO9A 4Z0LA 1BMAA 1EASA 1I0UA 2UWOB 3PTNA 4DOQA 5I46L 2ZGXH 4BDXA 3HK3B 4OGYA 1Q31A 1WAYB 4BTIB 3HKJB 4ABFA 2P3TA 3TU7H 2VH6A 3HS7A 4JZFH 1P2KA 1XX9A 2JJ1D 1MQ6L 1W3CA 4X2XA 3ENSA 3QTVH 3RP2A 5L2ZL 3MO3A 1GJDB 3VEQB 1GHYH 1KTSB 3G01A 1AHTH 4AFQA 3LTGD 2A4GA 3GY5A 4K5ZA 1TIOA 4AGKA 5JYIA 1QJ1B 5GCHG 3AAVA 1F0SB 4K60A 3UR6A 1OHHD 1A0JA 5BRRE 7LPRA 2HNTC 4D9RA 4MG3A 1APOA 1EQ9A 1S82A 3SJIA 1P09A 1KLJL 1EZUC 4WWYA 2ASUB 4JCNA 1C1RA 4RUTA 1Z6CA 2R9PA 3HO3A 4K8YA 4X2WA 3ATLA 1ABIH 1MQ5A 3D49H 3TIUA 1LPKB 1CHOF 1NROH 3PB1E 1SL3A 3BPSE 2UUJB 1YC0A 2F4LA 4NGAL 3BTME 3LC5A 5B6OA 2P3FL 2OYEP 3OY5U 1F7ZA 2XC0A 4NIWA 1K37A 3T25A 3TPIZ 1QRWA 4FU9A 2Z9LA 3F2FA 1ETTH 3A7TA 1HAYB 3UWJH 4X6MA 2BY9X 2KFWA 3LDXH 1EBVA 1KMHB 3ZYJB 4DW2U 3I78A 2ODYB 2VWLL 3AW0A 4JYUL 1DICA 2Y80A 2J94A 4DGJA 1MZAA 3OAAD 2I6QA 4JYTA 1CVWH 3UY9A 1O3CA 3E91A 1MABB 4FXGH 1SQTA 4ASHA 1O3OA 1TWXB 1COUA 1WHFA 4M7GA 1ELTA 3SHAH 1L1JA 5FCRA 1IGZA 3C1KA 3WWFA 2OC8A 1A61H 1THSH 2ZA5A 3MH6A 5F8ZA 1VZQH 2QAAA 1AMHA 3PLKA 2PFEA 2WV9A 2YMSB 5E2OA 1BRUP 2ZTXA 3SN8A 1IOXA 2W5EA 1IQLA 4GU3A 2OCVB 1YLCA 5FHTA 2GCTC 1DY8A 5JBCS 3FP8E 3LJJA 1ZAQA 3TGKE 1P9JA 1E36B 5JPMH 3LKWA 4THNH 1W0YH 1C5VA 3TK5A 1YKTA 1UVOA 2EEKA 2BD2A 1KTTB 2XRCA 3WWBA 2GTBA 2QXHA 2JH0D 3BN9A 3Q77A 1CCVA 4M9FA 1EAIA 1TQ7B 1L4ZA 1NFUA 1QA0A 1A3PA 3BTHE 4XRNA 1IQNL 3RXSA 1GBFA 3T27A 1C1VH 1GHXH 2CXVA 1EUFA 1SMFE 3OE7D 4U30A 1LTOA 2ZHWH 1TNHA 4U01A 1A5HA 5E0HA 5K0HB 3KK6A 1SC8U 3OLTA 5J4SA 2CF8H 2J95A 1QGFA 3KF2A 1PQ7A 1UZPA 3N8YA 3MYWA 2HPQH 1A3BH 4NA7A 1G1TA 2BLWA 3T2NA 5T6GA 5A09A 2HGTH 3PV4A 4DY7B 4X6PA 4JYVL 2Q1JA 1TGTA 2BT7A 5DO4H 3MNBA 3STJA 5FXLA 4ZXXH 3F0PA 5CDFE 1ZMNA 3IJEB 2VWMA 2ZHDA 4DIHH 3ZZCA 1EOJA 2SGPE 2P28B 2Q6GA 3ZZBA 1LK9A 2W2PE 1F92A 1ZPZA 1O2LA 1CSOE 3EQ0H 1HAXB 5IDKA 2WPMS 4HI3A 2G4UA 4TYDA 2W2OE 4X1NU 1LPGB 1G30B 3ASIA 1TPPA 1F5LA 3S6XA 1ELGA 2A5KA 3P8OA 1MKWK 3POYA 3Q7DA 5COXA 1C5WB 3LC3A 4D7FA 2WPDD 1OP0A 2J34A 1C5SA 5EJZA 3OEED 1CO7E 3OU0A 3GY8A 1YY3A 1G2MB 2BD3A 2P59A 3V12A 4E06H 1C1TA 1GBAA 4GAWA 3SJ9A 4X1PU 4MNWA 4CUFA 1P10A 3HGPA 9ESTA 2IJOB 3BEFB 2DUCA 1TPSA 3N7OA 1O2KA 2HORA 1K9OE 3JZ1B 2VGCB 5GPIB 2GV7A 2AS9A 3HKIB 4NIVA 3UFAA 2RCEA 1NFWB 4ZKOU 7ESTE 1JXPA 2Q6FA 2XW9A 4DT7B 1B0FA 5I25A 2PKSB 3SNCA 4WMEA 3M37A 2H9EL 1O38A 4TSFD 1PYTC 3MWIU 3ZZ6A 1C5YB 4H4FA 1EP6A 1QZ8A 4JZDL 1JRTA 1MTNB 1P2MA 3JZ2B 3NT1A 3HATH 1RRKA 2FI3E 2W7UA 1H1BA 2WYGA 2VJ1A 2RDEA 3H5CB 1HAVA 3BTEE 1BUIA 4FUFA 1VCWA 4AB8A 1NFYA 2HLCA 2WPKS 1S81A 2FOAA 4WH6A 4DURA 1Z6EL 1HX2A 1ZHMA 1P11E 5EGMA 4KGAA 4E05H 4Y7BB 2P95A 3N7EA 2JKHL 2AHME 5JB9S 3Q3XA 2VBCA 2V6NA 1THPB 4Q80A 3MMGA 4Y7AB 4Z6AH 3F6UH 5JBAE 4M11A 2HNTE 2QA9E 3BF6H 3TNSA 2W2NE 3GCHB 1TAWA 2ZU4A 1WV7H 3O8DA 4P00A 3UB0A 1C5XB 3RXRA 1W2KH 1ETRH 4GCHG 3V64C 1GHWH 4KTUA 1GMDG 4JZFL 1UVTH 4YLUA 3UOUA 1APQA 3A84A 3UR9A 3M3TA 1TX6A 1V2VT 2TIOA 3SV2H 4D8NA 4ISIL 1FN8A 5IYTA 3SV7A 3P8FA 1V2OT 4UONA 1C4V2 1FE2A 3ZVFA 5SGAE 1O2JA 5F1AA 5KGOA 1GJ4H 2BDIA 1UTLM 2ZPSA 3GS9A 4ZKNU 5HGGA 5TJXA 1NPEB 4WXIA 1FAKL 1SOTA 2C8WB 3SV9A 2BM2A 2XWBI 1V2MT 2FTLE 1W10U 4SGBE 4MMYB 2FEQH 3A85A 2J97A 1WDIA 1C4Y2 3SYJA 1KLIH 1QBOA 3MU8A 1LHCH 2PSXA 3VB4A 4Y8YA 4JK5A 2P93A 1M1XB 2I9AA 3M35A 4F55A 2DE8A 4DVAU 5ESBA 2B7DH 4HZHA 8KME2 4NIYA 2XC5L 1FIZA 3A86A 4A1VA 2M2AA 4MNYA 2TGTA 1BCUH 4U32A 1P2JA 2BD9A 2G51A 4B73A 1DLKB 2F91A 5EPYA 4FUJA 5C2ZA 3RXDA 1YPMH 2QF5A 2G00L 1N8OC 3PRBA 4I8KA 5A8ZA 3BTGE 3VGCB 2P3TB 2VH6B 3OYPA 3Q76A 4RI0A 3RM0H 4YZUA 1O2PA 1EZQA 3MI4A 4KTCA 1CA0C 1FJSA 3I77A 1AE8H 2ZDLA 1CGIE 1ANBA 3TJOA 1EJNA 1CVWL 1C1UH 4TPYA 3SZNA 1ELDE 3RMOH 3N8XA 3ZZAA 2RA0L 3KQEL 3EYDA 1DSTA 1QRZA 1DXWA 4FU7A 1BTHH 1INCA 1C9TA 2XBVA 3V3MA 4FUDA 2Y7XA 4LK4A 1KKEA 1EFRD 1QJ7B 2BXTH 1GI5A 1DWDH 2QCYA 3FZZA 1DOJA 3CS7A 1XXDA 1C2JA 4NWKA 3S7HB 3DHKH 3GCXE 5FBEA 2ZIQH 3UNSA 3LC5B 1LMJA 5DPAA 4I8GA 4RRXA 1AGJA 4R8TB 1V6DA 3DEMA 1O5GH 2NU4E 1HCGA 1PJPA 3OY6U 1DUEA 5A0CA 3NCLA 4IGDA 1ZSKA 2ANYA 3RXUA 3V7TA 1WTGH 2FZZA 2Y5HL 1NTPA 2PSYA 1QBNA 1XUHA 2DDUA 1JIRA 4Q4LA 2H9EC 1Y3WA 2BZAA 1QCPA 1NT1A 1O2HA 2Y80B 2J94B 1OWHA 1O35A 3U98H 4ZMAH 3ODFA 1AB9B 2ODPA 2P3FH 3FZDA 4Y71A 1EZSC 1E38B 2ZHEH 2F9VA 2O8UA 3IWMA 2F9BH 5F53A 5FBIA 5H4IB 2ZZUH 5IKRA 1WU1B 3WW7A 4GSOA 2PHBA 3HO5A 1AVWA 3QGJA 2JH5D 2C8XB 5JBCE 3LH3A 1YPLH 4X8TH 2VRSA 1HDTH 2G5NA 1ANEA 1URKA 1NT0A 2P8OB 2QY0B 4Q7XA 5TCCA 1NS3A 2GP9B 1Z1JA 1AVXA 2PUQH 1FZZA 1VITH 4ZXXL 4I31A 2WV4A 2BSFA 4FUEA 1DDJA 4KELA 3TNTA 1OOKB 1DDXA 3P6ZB 3B9FH 3KQDL 3TK5B 4IMZA 2A4QA 3SU1A 1PQ5A 2VWOL 4IMQA 4ZCNA 2HVYB 3MNCA 3BTFE 2F3CE 1V2UT 4WMFA 3SI4H 2WFTA 2YMSC 1Z8IB 1GVKB 1NFUB 1BBRK 1U8CB 4C16A 1V2TT 1GDQA 2MGPA 3P8GA 3U73A 4ABHA 1C1QA 2AEIH 5FX5A 5A8YA 9LPRA 4X1SU 4KTSA 1LQDA 3GDUA 4I7YH 1RS0A 1O3LA 1C5MD 4XBCA 2W3IA 3O8RA 3F68H 1O0DH 1PQAA 5CKNA 3SOSA 2J95B 2AMQA 3ZZ3A 1P57B 2ZF0H 1SKYE 1S6HA 3N8YB 3DFJA 2UUKB 1IQIA 1SPJA 1V1HA 2P3UA 1WSSH 5T1VA 3BT1A 1YPGH 2QGRA 3A7ZA 1BTUA 2Q1JB 4COXA 1J16A 3QWCH 2Y5GL 1F5KU 1PPBH 1HAEA 5JBTA 2BQWA 3AAUA 4P02A 4MQAA 1W7GH 1J9CH 3PMAB 4MDSA 2H5DA 2WPME 5L6NH 2HOBA 2Z9IA 5LPFA 5DP6A 2EA3A 1HJ8A 3TJNA 1S84A 3T28A 2WV5A 1MTWA 4DCDA 5IKQA 1N7DA 1AFQB 2UUYA 2FPZA 2GDEH 4ABAA 1PGEA 5F6MA 4E1GA 5HIYA 4MPVA 1SR5C 4NCYA 4RT1A 2FWWA 1O2IA 2ZTZA 1GJ7B 2FLGA 1C5ZB 2KAIA 1DE7H 2BB4A 2J34B 1EOLA 3GCWE 2EI7A 3U69H 2VH0A 1WOFA 2QYIA 1T4UH 2XXLA 2ZECA 4Y10E 1JMOH 1O5AB 4HTCH 1T7CA 1MBQA 1GGDB 1O2VA 3PROA 1FIWA 3RC5A 4Z6AL 3TK6A 3F6UL 2W3KA 2AFQB 2SGQE 1GJ6A 4K1SA 2BOUA 1RJXB 2BOHA 1A4WH 2IJD1 6GCHG 3TLOA 2EI6A 2UWLA 1DM4B 4B6EA 2HPPH 3RXPA 2XBXA 5C17A 1IQGA 3FFGL 3TGJE 1O32A 3RXAA 1DLEA 1P9SA 3PMJA 3SO3A 5EW1H 5DP7A 1O3GA 1GHBG 1P2NA 3AASA 3SI3H 3PLBA 1GMHG 1TPAE 1TX7A 1MQ5L 1ZGVA 3VFEA 1OYQA 2BOKA 4GVUA 1HZ8A 3QGNB 1D3TB 2KCPA 5GXPA 1RTFB 2VGCC 2WYGB 2VB0A 1C5RA 1HAVB 2WPLE 2XC0L 5C0UA 2XTTB 5GIBA 1Z8JB 1MCVA 1O2MA 2CV3A 1GCDA 1ZRBA 3MHWU 4Q7ZA 2AMPA 4WH8A 1CX2A 4ZKSU 3TITA 5JBAS 1QIXB 2BQ6A 1V2LT 2PKSC 1KXCA 3PGHA 3SGBE 5EGMB 2ZGBH 4A92A 1QR3E 1VGCB 4GHQA 1D3QB 1XKBA 1IQEA 1ZTLA 1C1NA 2J92A 3BIVH 2GGVB 2B7DL 3A80A 2SNVA 1H9LB 4JZDH 3SGAE 1GL0E 1C2LA 1W0ZU 2ANKH 5A0BA 2C90B 5AFZH 4LZ4B 4F48B 1IOEL 4CRDA 1F0RA 1MAXA 1NZQH
chains in the Genus database with same CATH topology
1AFEH 1BBRE 2XWAA 1AI8H 1FY4A 1GCTC 1HJAB 1MUEB 2P3FN 1ESTA 2FODA 2VVVA 3UWIA 1VITF 3AW1A 1NRQH 1GI8B 1ORFA 4GHTA 1ANDA 1LKBA 4HFPB 1K1JA 2ALPA 2NU0E 4ABJA 3M61U 1IQLL 1TGSZ 3ZVBA 3E0PB 4LOYH 3GCHC 1SB1H 3VB7A 5HXFA 1A1RA 1SGQE 3GYMA 3LGIA 3KCGH 4ZKRU 4XLWA 3VB3A 1UCYH 1TLDA 2BZ6H 1ATBA 1EQHA 1CE5A 3I29A 2KV4A 3TH3L 1TX8A 5CHAB 1O2YA 1GMCF 4WF8A 4LZ1H 1FY3A 2FOCA 1D3DB 3CS0A 2FIRH 2ZP0H 4ISIH 1GI0A 2GX4A 1NRPH 3BG4C 4CRBA 4B74A 3URDA 1HYLA 1IQJA 2JETC 2Y5FA 2ZTYA 4Y8ZA 3S9AA 4AZ2B 3VB5A 3RMNH 4CRAA 2VVCA 3FP7E 1E0FD 4BAMB 2VIDA 4YOIA 3A87A 1K1PA 1FAKH 1EPJA 2VJ3A 2KB9A 1P3CA 1CEJA 2GMTB 1KXDA 1UTPA 3PWCA 4XDEA 2CF9H 3PYHA 3RXFA 4YZUB 3ZZ4A 5K7RA 2RNLA 1NRSH 3TGFA 3S9BA 1EZQB 1TALA 1WCZA 3RLWH 5CE1A 2JH6D 5EQQA 3T29A 3D65E 2P16A 3BT2A 1C1PA 1IQMA 3MNXA 2W26A 3ZZ9A 1SFIA 4O9VA 3MU1A 3LN0A 1XUFA 4AYVB 1Z7KA 1BTWA 3WY8A 2CJIB 1WQSA 4ABGA 1NU9A 1Y59T 2F9BL 3RR3A 4CRGA 1HAZB 6COXA 2FOMB 2K2TA 2Y7XB 1YUGA 2FOEA 1PQ8A 3GY3A 4YOGA 3HK6B 5C20A 1GI9B 1C5NH 1HRTH 3R05A 4YT6H 4X8TL 1TNIA 1TA6A 3ZV9A 4AFSA 1K1MA 3RXQA 1GJ8B 4ABBA 3LGWA 1YCPM 4NSVA 4ZHLU 4ISOA 3SU6A 2PUQL 1P0SH 1GG6B 1QTFA 2H9TH 4LXBH 1V3XA 1O5FH 4WY3A 4A5TS 1BT7A 1HCGB 1P06A 2A4OA 1W12U 2WG4B 1GVLA 1LDTT 1LVBA 3F9HA 1HXFH 2BY8X 8GCHG 1UTNA 4IBLH 1C2DA 1W14U 1IGXA 3M7QA 4UD9H 1YPEH 2BOXA 2OC7A 5DP9A 1G37A 3L3TA 1OPHB 1XM1A 3LJOA 1ELAA 5FPYA 2A7JA 1QL9A 3L6PA 3KQCL 2AIPA 3PWBA 1F0TA 2BDYA 3HPTA 2PHBB 3E16B 4OGXA 2BDHA 1LVOA 3EA7A 3RC6A 3K65B 1P03A 1BRBE 4XFQA 5CISA 2A2QH 2SNWA 1G1RA 1GBBA 3ZVEA 4ZHAB 4YTAA 4NG9L 5HMAA 1DVAL 5EXMA 3RUOA 5C3NA 1LMMA 2R3YA 3MQEA 1O3AA 1G1SA 2ZU5A 1EPIA 2FMJA 2ZCKP 1FPCH 2YNBA 1JWTA 1NY22 1J9CL 1C1MA 1UZKA 1O3MA 1Y3VA 2Y81A 5FX6A 1YM0A 3OTJE