3F1SB

Crystal structure of protein z complexed with protein z-dependent inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
259
Chain Sequence
NECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Protein Z-dependent protease inhibitor
total genus 66
structure length 259
sequence length 275
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3f1sB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB02
3EQ0H 1NT0A 2Y81B 2Y38A 1PPFE 1T7CA 3GCTF 1MZDA 1LQEA 3SW2A 2BMGA 1TA2A 1MQ5L 1QB9A 1C5WB 4CRBA 4DCDA 1MTVA 1L1JA 1O35A 4Y8XA 2I6QA 1TBZH 4Z6AL 1P2MA 2OC0A 3R3GB 1NT1A 3SGAE 1GI5A 2O8WA 1BCUH 5JBCE 1SBWA 5GJ4B 4O02B 3M3SA 2HVXA 4THNH 1D6WA 1WTHD 5IKRA 1C9PA 1TRNA 2DE9A 3VEQB 4UD9H 3RMLH 4D7FA 1HT5A 2XRCA 2VIOA 4FUIA 3GISB 2BMGB 1E35B 2PW8H 4UEHH 2YNBA 2BY9X 3RLWH 5A09A 1O3FA 4X1SU 3RP2A 2F83A 1T8LA 3ZVCA 3MFJA 5L2ZL 2Y6TA 1YGCH 1ZYOA 1FJSA 1L1NA 3QWCH 1RD3B 3RXRA 4J1YA 1C2HA 1SMFE 4NSVA 1AKSA 2WPLS 1OP8A 3RXEA 1EZSC 1P05A 3NXPA 4X8SH 4ABEA 1GBFA 4ASHA 5F8XA 3VB7A 1CA0C 4UFEH 1TPSA 2TRMA 2W5EA 3GY3A 1C4U2 2P3UB 1ZRKA 1Y8TA 4YESB 1GI9B 3MWIU 2H9EL 2A32A 2F9OA 8ESTE 4J2YB 1ZTLA 1UK4A 1MD8A 5FXLA 2BD8A 1K22H 1SLXB 1NESE 4ZXXH 1Z6JH 5IDKA 1GHZA 1XKBC 1FIWA 4FVDA 2A7HA 4FM5A 1GJ8B 3HK6B 4JMYA 2I9BA 4GSOA 1C5YB 1HV7A 1CT2E 4JK5A 2J94A 1A5IA 2Z9IA 3U1JB 4XBBA 2VVUL 4U2WA 1BHXF 1OXGA 2A7CA 2R3YA 1CBWB 2RNLA 1VCPA 1X7AC 3OSYA 3UOPA 1C2MA 1PPBH 4BAKB 1DWCH 2BXTH 2J2UA 3SGBE 1O32A 2FYRA 1DANH 2QXJA 3LGTA 2UUKB 4Y7BB 4LMFA 2ZEBA 5EU8A 3STJA 3UFAA 2HALA 2BDCA 1EP5A 1GJDB 1GG6C 1AI8H 5EGMA 1TGBA 4CRCA 3MH7A 3A84A 4KELA 2P95L 1NROH 2FPZA 5TJXA 1EKBB 3W95A 3U7UG 2BD7A 3MNXA 3KQDL 1CSOE 1UVOA 5EXMA 1NU7B 1V2WT 2DUCA 4COXA 2R0KA 1B0FA 1O30A 3TGKE 5L2ZH 3AVZA 1CCVA 1TIOA 1AUTL 1O3LA 3S9BA 1HX2A 2ZU5A 1X7AL 3PYHA 4NA9L 2GZ8A 5E0GA 5FPSA 5F03A 5FPYA 2FOMB 1SFIA 1V2ST 2V3OH 4ZKSU 2P8OB 4YT6L 4E06H 5K0HA 4AFQA 1D3QB 3RXMA 5EQSA 3V7TA 2WPHS 4FUHA 4ISHH 4SGBE 4INLA 1V2KT 2BYAX 2Z7FE 2ZGXH 2PSYA 2GD4B 2C8XB 4BTUB 2J95B 1DM4B 1GJAB 2QIQA 1C5MF 1S81A 1O34A 5IKVA 2QA9E 2PUQL 3O8RA 1P3EA 4I8KA 2Q1JB 1GMCF 3A7YA 1OWIA 2I6SA 2Z9GA 3SV2H 3E3TA 3T62A 3UUZA 1AQ7A 5COXA 4JK6A 1FY5A 4F49A 2KB9A 4HI3A 4WH6A 3RXVA 1GVLA 3LT3A 2FLRH 3S9AA 1W7GH 2J92A 2VWMK 4D9RA 2RDLA 4K69A 4VGCB 3JZ1B 4TYDA 2OC1A 1C1VH 4JZDH 1C1UH 1H8DH 1BTHH 1ELGA 5JB9E 2BOKL 1O2TA 1V6DA 1BQYA 1HDTH 1XUJA 1GI2A 3QH0A 1AN1E 3M5OA 5HXFA 3RUOA 4XL1A 1F7MA 3A89A 5JW1A 3FANA 1OPHB 4B1TA 1TBQH 4ISNA 5CMXH 1GDUA 1ELEE 1GK5A 1TNJA 1DPOA 1PPGE 4Y0ZE 4Y8YA 3AAUA 2A45B 2ZU1A 2ZU3A 1NFUB 1IP0A 3KHVA 4I8HA 2FOFA 2ZO3H 3S9CA 1B7XB 1ETSH 1BRAA 1EPJA 1DFPA 3T2NA 1P01A 4I32A 3MQEA 3A87A 1G3BA 5JYIA 2H5DA 1CEJA 2AMPA 2XTTB 1TA6A 1RJXB 2BLOA 3L3TA 4VGCC 1OKXA 5EG4A 3RXBA 3SQHE 2J34B 2MGPA 2Y80B 2G00A 3Q3KB 4QT8C 1EJNA 1OWDA 3S7HB 1JOUB 2ZU4A 1ZSLA 4NA7A 5DP6A 3QMOA 4RUTA 1HAEA 1IOEA 2GCTB 2ULLA 1L0ZA 1G36A 1O3CA 1W0YH 3RLYH 3P8GA 5FAHA 4XFQA 1C5QA 3K2UA 1U67A 2NU0E 2ZNKH 2VIPA 4Q80A 3FZDA 1SGCA 2EI7A 1RIWB 2OBQA 4MPUA 1LMWB 4ABAA 5ABWA 2BLQA 1IAUA 1SB1H 4FUFA 4FVBA 3ASIA 4U32A 5EW1H 3LAQA 4TPYA 5C1UA 2AIQA 1WQVH 1KDQA 2CF9H 4JCNA 2YNAA 2A2XH 3QDZB 2G8TA 4K1SA 3T5FH 4A1VA 1P2KA 1UCYK 4D76A 7LPRA 2PR3A 1NZQH 3F9GA 5E0JA 1Q31A 1UMAH 1BRCE 1HLTH 5GPIB 1SGRE 3UWJH 1HRFA 1NY22 3U98H 1V2RT 3QTOH 1CX2A 1YPJH 1O0DH 1QJ7B 3K6ZA 2BD2A 4AGJA 2G51A 5A8YA 1DDJA 4X1NU 1ATBA 1OP2A 5EXLA 1DT2A 2PKAA 4OS7A 3URDA 2ZQ2A 3PB1E 1O3PB 1GI7B 4UFFH 3SO3A 3E0PB 1GL0E 3M5MA 4E7NA 4OS2A 1W7XL 5B6OA 5L30H 1HAVA 4YOIA 1CVWL 2W3IB 2G4UA 3KF2A 2K1QA 2Y7ZA 1QCPA 2ZWLH 4Y8ZA 2BY7X 3LN0A 3TJVA 4Y76B 2HRVA 2PFEA 4GLYA 2H2ZA 1TE0A 4WMEA 4CBNA 1DE7H 1INCA 4B71A 2PHBB 1TBRH 1MTSA 1YUFA 1AO5A 3K6YA 1HAFA 4UFDH 3V12A 1YPKH 4JZFL 2AH4X 3BTGE 1DY8A 1EAWA 1THPB 1Z8GA 3M37A 2AERH 1GVKB 5GXPA 2ZPRA 3SJ8A 4CBOA 1OOKB 3M7TA 2FTMA 2VJ1A 2VH6B 1RTFB 3B23B 4U01A 1G3CA 1K1JA 3D49H 2Y7ZB 3WY8A 5SGAE 3ENSA 3CS7L 2H9HA 3MO9A 3OLTA 3BT1A 1XVOA 2VWMA 4IN2A 5L6NH 4ZHLU 2EI8B 1FAKL 2W26B 2STBE 1ZTJA 1MU8B 5F8TA 1APQA 8GCHF 1NFXB 1GBIA 1ZOMA 3F9FA 1A0HB 2ZIQH 2B0FA 1MQ6L 3GCWE 3ZZ9A 1LTOA 5DP8A 1OSSA 1SGTA 2FEQH 1GHYH 1KSNA 1TQ7B 1TMUH 4K5ZA 1I0UA 1ANBA 3SUGA 2WG4B 2HPPH 3GISX 3SNEA 3TIUA 1QL9A 3FAOA 1O33A 1EOJA 3M7QA 3VB5A 1KXFA 1LPKB 2JH0D 1IQKL 1TRMA 3HKJB 1KXAA 1ATAA 1HAVB 1NTPA 2SNVA 1C2EA 1TGSZ 4DG4A 1MTUA 3N8WA 3ZZCA 1P2NA 4BTIA 5ESTE 1K2I1 2OXSA 1QTFA 3MU8A 3P92A 4WMFA 4Y76A 4ZHAB 5DP4A 4NWLA 3RXSA 2TGPZ 3RXOA 4ZKOU 3TJOA 1ZPCA 3PTBA 3P5BL 1O2SA 3K65B 3KQEL 1O2GH 2OC7A 4Z0KA 4IC6A 1NC6A 3HS7A 1YLDA 2BZ6H 1EPTB 4H6TA 1P0SL 2P3FN 2P16A 4PROA 1TAWA 3UPEA 1BTYA 2D1JA 2G52A 5DPAA 2OUAA 2EI6B 4IBLH 1SL3A 5JBBS 1BMAA 1UZPA 1BTWA 3VGCC 3MH6A 3A80A 1XKAL 3IITB 1TPPA 4ZXXL 2VIVA 5F19A 4D0EA 3RXDA 1ZHMA 2FOAA 1IQIA 2G55A 2GT7A 1H8IH 3MO3A 1FXYA 1LQDB 1FAKH 2K2SB 2Y7XA 1GJCB 2FXRA 2TPIZ 1TX7A 2LNCA 1C1RA 1P9JA 2BD4A 1QQUA 1GBEA 5A2MH 1SSXA 2CGAA 2D1JB 5A0AE 1O3OA 2WPME 1FZZA 1DSTA 4Z0KB 1O5DL 3F9EA 3IITA 3TITA 4B2CA 1TPOA 1K28D 5FBIA 5C3NA 1ACBE 2G5NA 1OWKA 2NU4E 3LJJA 5A0BA 1P2OA 4ZAEA 1GCTC 3BSQA 1GJ9B 1C5TA 1PFXC 2KAIA 2ODQA 3TLOA 1P10A 5JB8E 4LK4A 2AGGX 2FS8A 1EPTC 3GDUA 3SOQA 1TX8A 4AQTA 2A5IA 3KQCA 3LDXH 1ZGVA 1JV2B 1P57B 3E16B 3KIDU 4FU7A 3TK5A 1EZUC 1HYLA 3F9HA 1Z1JA 2W2OE 1IQHA 1GI4A 5DK1A 3TK6B 1AVXA 4NA9H 3VXFH 4DVAU 3VPKA 1PQAA 2GCTC 3GDVA 4I8GA 1BITA 1CCFA 3ZZ6A 1Y5BT 1DSUA 1SGDE 2A4RA 4MNYA 1PRHA 1OS8A 2MGRA 1DVAL 4XLWA 2C8ZB 4YOGA 5FBEA 3SHCH 1ZLRA 2P8OC 2B9LA 4MVNA 4Z0LA 1O3HA 1EOLA 2ZFFH 3QN7A 1SVPA 3P6ZB 5I46H 1LPZA 1ZSKA 2TBSA 3SOSA 4NCYA 1CU1A 1HB0B 1DXWA 3GCHC 1EZQA 1W8BH 4O03A 1KLJH 3ELAH 3NJPC 2IPHA 2TGDA 3I77A 1AZZA 5JB9S 3ATWA 2QY0B 3RXKA 1VITG 3UR9A 1CHOG 3M3VA 4IGDA 2D2DA 3C1KA 1V2MT 5E8EH 3SN8A 4E1GA 5DGJA 1O2KA 3VFEA 1Z6CA 3ENSB 1PPZA 1MKWH 3KL6A 1V2QT 4K1TA 5DKMA 4AYYB 5DJ7A 4MQAA 1YC0A 2XNIA 4BAMB 3R0FA 1HJAB 1EJMA 3UQVA 3C9AC 1ARCA 2QXIA 1BIOA 3MYWA 1K1LA 2G5VA 1O5DH 1TNLA 1YPGH 4DIIH 1AFQB 1FY1A 1GHAG 1MH0A 4WF8A 4MG3A 1BRUP 2Z3DA 2PTNA 1UZQA 1O2NA 2SFAA 1YGCL 1TNIA 3FBYA 3SOVA 1FN8A 4AN7A 2BDAA 3E0NB 3QZRA 2VWNA 2ZZUH 1P02A 1S6FA 1C2IA 2J38A 4WJG2 1COUA 4OGYA 1L2EA 4A1TA 1B0EA 1MKXH 1YO8A 1MTWA 2ANWA 2GGVB 2DDUA 4TY6A 3ATKA 3PO1B 1FQ3A 1MMJN 4ZHAA 1YLCA 4DURA 3RM2H 3RC6A 1P2IA 1TB6H 4RN6A 4JZEH 6CHAB 2VIWA 1O3MA 4D0FA 1BA8B 1HAOH 5HMAA 1F7ZA 3CS7A 2TGAA 4TWWA 3VB6A 7KMEH 4XBCA 2YOLA 2H9EH 5EQRA 1NFYB 1C1QA 2ZTYA 4MMZB 1S0RA 2R2MB 2J4IA 2HNTF 1QRWA 4Y7BA 3M37L 4LZ4B 5DG6A 2O8TA 2XBVL 1THRH 2W7UA 1EPHA 2XWBI 1K36A 3LGVA 4LXBH 1GBCA 4ZH8B 5EGMB 1S6HA 1MBQA 3PTNA 4YT7L 1FONA 3TH3L 3DA9B 5GWZA 3U8TH 2FD6A 3QUMP 1A61H 1C2JA 1XDTR 3GDSA 4IS5A 1V2LT 2J34A 3UNSA 1C4Y2 4GHQA 2Y5GL 2WG3C 7GCHF 4CR5A 1BBRE 1N6XA 1G2LB 1DX5M 2OBOA 2WYGA 1YUKB 1VCQA 3UNRA 3CFWA 1O2RA 1AUTC 4IMZA 2CF8H 4NGAL 1O2LA 2BX4A 2SGAA 2XCFA 1QY6A 1LVBA 5CKQA 3L6PA 2AIPA 3HO4A 1QL8A 4NIVA 1C1MA 7ESTE 1EQ9A 3SNAA 3V65B 2XBXL 1EMOA 3F68H 1NS3A 1UTJA 3RXLA 2GDDA 1QB1A 2J95A 2FLBH 1TMBH 4AGKA 1TWXB 1XMNB 1D9IA 3TH2H 3PLPA 1W7XH 4K8YA 3U1IB 1O3AA 3FFGA 3MTYA 5HYOA 1PGEA 1AHTH 2J9NA 1OX1A 1QRXA 5KN5C 3GY7A 2ZFTA 1THSH 1XKBA 3Q3XA 2VH0A 1FY8E 5HGGA 4B76A 2NPRA 3BN9A 3CENA 2GVFA 1E34B 4D7GA 1L4DA 1IQFA 2A4OA 1MCVA 1HXFH 1EB1H 1F0SB 1IOEL 1Y59T 2SGPE 2V3HH 3Q3YA 4CREA 2LPRA 1AD8H 5L2YH 1TGTA 2ODPA 1KDQB 2A1DB 3Q00A 1D4PB 3GYLB 1XUHA 2ZDLA 2MHPA 4M10A 3NPSA 3SV9A 4RKOB 2P94L 1SR5C 1C5UA 3POYA 5I25A 3HGNA 1KXEA 3HK3B 1QL7A 2QCYA 1GMHG 1CO7E 3VB3A 3ATMA 1EQHA 3QTVH 4E7RG 2W3KB 4CUEA 4O9VA 1NQLB 1WYKA 1SI5H 1SQTA 3P8OA 1SZBA 2OYUP 3TGFA 1EUFA 5TCAA 1NM6A 4AZ2B 2PHBA 2FI4E 4AORA 2AMQA 1EASA 2WPKE 3FVFB 1B5GH 1IQMA 1F0UA 1T8MA 2RA0A 3T27A 1FAXL 4BOHA 3RXPA 2BTCE 1WV7H 1K1PA 2C93B 4NGAH 4F4OC 1IJQA 1MCTA 3KCGH 4NFEA 3TH4H 3TBDA 2ZTXA 4A7IB 1N1LA 1BBRK 1ANCA 3ZV9A 3HO3A 3P95A 3ZZ4A 2FS9A 2OC8A 1S0QA 2BDGA 1N1IA 2WPJE 1ZAQA 5DP9A 4OGXA 1BMNH 2GMTB 1ELBA 3ZVBA 5E0HA 3Q7DA 4X8UH 1G3DA 3SU0A 2WPHE 4GUXA 2NU1E 4CH8B 5J4SA 1KXCA 1O3DA 4AOQA 3EGFA 2WPKS 4KP0A 1G1QA 2OP9A 2P26A 5FPTA 2GTBA 3GY2A 3PMHB 4JYUL 1O5AB 6GCHG 1CVUA 4IW4E 3TJUA 2OQUA 4UFGH 2QGRA 2WYJA 5EPYA 3A88A 4GPGA 3GYMA 4CRFA 3AW0A 4AFUA 2O8MA 1EJAA 1G30B 1T32A 1YCPK 2VVVL 1HUTH 5E2PA 1PPHE 4X8TL 1O5EH 4NA8A 1VJAU 1GJ4H 1EPTA 1FAXA 1ZMJA 1VJ9U 1P03A 4X8VL 1WU1B 4OTYA 1GBTA 1UJ1A 1V2PT 1XXFA 1ZJKA 1A5GH 3OY6U 3RMOH 3P8FA 1QBVH 4KTUA 3GCTG 3CA7A 2AYLA 1FSBA 1RTKA 1SGEE 2BOHA 1LPGA 1GBLA 2ZGHA 2CXVA 1P06A 1JXPA 1ZTKA 5BPEA 1Y3YA 1BMLA 3TGJE 1FV9A 1NRQH 4KKDA 3M7UA 1F5KU 1UVUH 2W3IA 1GCTB 3RXFA 3KCGL 1FF7A 1WSSH 4I8JA 1ELTA 1UVTH 1CGJE 1VCWA 1ZZZA 4X2XA 1PTHA 2F9VA 2ALPA 4HFPB 3MNSA 1LHDH 1N8OC 1S82A 1HJAC 4CUFA 1NO9H 1UTKA 1IQGL 1L3YA 4GHTA 4H42U 1W0ZU 2FWWA 1NFWB 2ZG0H 3RXTA 1G2MB 4LORA 3GCXE 3PLBA 1T4VH 1GJ5H 1QIXB 2FOGA 1CVWH 3BT2A 3MNCA 4IN1A 4DY7B 3SUEA 1BT7A 4MLFB 5A8XA 3LC5B 2ZFSA 1GCDA 3SJ9A 4O1ZA 4MDSA 2FODA 1UVSH 4Y71A 1YPHE 5JB8S 4X8UL 5JBBE 2ANMH 3HO5A 1AUJA 3GCHB 4HZHA 3S7KB 1J15A 3FFGL 4FXGH 2ZTZA 1KIGH 4DIHH 2PR3B 2BVRH 2CJIA 3W94A 2UWLB 2NWNA 3A86A 4BXSA 1KLOA 4X8SL 1QHRB 1OWHA 2THFB 3NUMA 3A8AA 1YPLH 3TK5B 9ESTA 1O2VA 1O2UA 3N8ZA 1P11E 2A4GA 3PV4A 3KK6A 5DP7A 1ANDA 1KXDA 3VGCB 1K1MA 4ZAEB 1TRYA 3GY6A 3V3MA 1HXEH 1TOMH 2GDEH 1E38B 2HLCA 5ETXA 1TNGA 2ZHQH 1TOCB 3BTHE 3ZYGA 4ZKRU 1FJSL 5A8ZA 1DLEA 2A0QB 1GI6A 1UK2A 1XX9A 3A82A 3RR3A 3UY9A 1OYQA 1E37B 3MU5A 2GV7A 3MHWU 3MNBA 1IQJL 3PMBB 3M5LA 4B75A 2WFXB 3QGJA 2VINA 4RKJB 3E8LA 1PXXA 2ZPQA 3QLPH 1CT0E 5GDSH 2ZDMA 3O8CA 4SGAE 2ZU2A 4OS6A 3NKKA 3F6UL 4JYVH 1A3BH 1PPEE 2NU2E 2QXGA 2ALVA 4MNXA 1AMHA 4D90A 5CKMA 2JKHA 2GKVE 3UIRA 4LZ1H 3E91A 2XC4A 3NT1A 2R3UA 4X1QU 2VGCC 1MQ5A 4CSYA 4UDWH 3RM0H 1KTSB 1GBBA 4X0WU 1MAXA 3E90B 1ETTH 1Z8RA 1NRSH 2FOHA 2VVCK 1XXDA 3N8XA 3LGWA 1A7SA 1KLIH 1C1NA 5DO4H 2Y5HA 3RMMH 1J9CL 1IQEA 3MI4A 2VWNL 3TH3H 1W12U 1W11U 1A1RA 2HOBA 1XUIA 2XYAA 3B9FH 5G4BA 4A1XA 2FOCA 1IQJA 4FUDA 2J94B 1ESAA 1V3XB 1DQBA 1DITH 3OTJE 2ZGBH 4M7GA 5FCRA 1C5MD 4MNVA 2O9QA 1KSNB 1LVMA 3SJOA 4AFSA 1O3BA 3MH4A 1GHVH 1JIMA 2OCVB 2XBWA 1LPKA 1L5GB 2FESH 2ZF0H 3BTFE 2VWOA 2WV4A 3QCWA 4MMYB 3IWMA 4ABHA 1G32B 1HPGA 1NFYA 1CHGA 1HRTH 4DT7B 5LGOA 3ATIA 4MPVA 3U8OH 3ZZ7A 1Q3XA 2QAAA 3G01A 1JL9A 3K9XA 1IQLA 2EI8A 3RXGA 1EZQB 1EAUA 1SGFA 3FZZA 4K2YA 3IJEB 4ISOA 1GMDF 5IYTA 4OS4A 2C3SA 4HGCA 2J2UB 1DVAH 3HGPA 2A2QH 4ZROA 1UTNA 1QFKL 1LMJA 4K1EA 1P04A 4NZLA 2WYGB 3N8YA 3LGIA 1KLIL 1Z8JB 2QXHA 3ITIA 1W8BL 1F0RB 4YM9A 5C1XA 1J9CH 3SV8A 1UK3A 2WUBA 4WXVA 5EW2H 5HM9A 1P0SH 2Y7XB 1C4V2 2BHGA 3DFJA 5L2YL 1N6YA 3A83A 1QRZA 3PMAB 3SNCA 1HZ8A 1ABJH 1BMMH 1IQGA 3SJKA 2XBYL 2ZKSA 3KQCL 2PWXA 2M74A 3R05A 3SU2A 2PGBB 3BTKE 1ELDE 1GHXH 3V64C 2F9PA 3H5CB 1PYTC 1QNJA 1TLDA 2HNTE 3NWUA 3SU6A 4Y10E 1YPEH 1QR3E 1O2HA 1YYY1 1D3PB 1NRNH 3KQBA 1EB2A 1O3JA 1Y5UT 1AU8A 2BLWA 4FU9A 3SI4H 1LVYA 2QYIA 4MTBA 3MH5A 3N8YB 4Y7AB 1LHFH 2P3FH 1XKAC 1C5XB 5A0CA 1WOFA 1T8NA 1DWEH 4JYTA 1HAHH 1WAYB 1TFXA 5AFYH 1UTOA 4YZUA 2FLGA 3LIWB 1P3CA 2SGEE 5C20A 1A2CH 4FUEA 1TX6A 2Y5FL 1NPEB 2P93A 3LC3A 2VVVA 1H9HE 1G3EA 1J16A 2W3KA 5DP5A 4ABGA 2PUXB 1QFKH 2D8WA 4DW2U 1H4WA 1O5CB 1C1PA 1L4ZA 3LONA 1GMCG 2RHPA 1TLEA 1EXFA 2P16L 3RU4E 1C2LA 2ZECA 1ZHPA 1GHWH 4KGAA 4JYUH 1ZJDA 4BAHB 3KQEA 1VGCC 4CR9A 2FMJA 3ZZ3A 1TMTH 4CRAA 3N8VA 1UVPA 1OYTH 1MUEB 2FOEA 1GBDA 2TGTA 2ZGJA 4Q7XA 4Y7AA 2ZFRH 4XE4A 1GI3A 4ZXYL 4YTAA 2WV5A 1FLEE 3TNTA 3GY5A 1TYNA 3C27B 5LH8A 2ZP0H 1C5LH 5JBAE 4X6MA 2VJ3A 1FY4A 3D65E 2WPJS 1V2TT 3BTQE 1QGFA 5TCCA 1EMNA 1IQKA 1KY9A 1URKA 5JBTA 1SGQE 1Z8IB 1DWBH 1HAZB 1PJPA 3OX7U 1HJ7A 3QGNB 4X2YA 3NTBA 5J4QA 2EEKA 3I78A 1CA8B 1OWEA 2W86A 2SGDE 2ZGCA 1O3IA 2XWAA 3BF6H 3UQOA 1AY6H 4K3JA 2NU3E 1FNIA 2SGFE 1AGJA 1CBWC 3M35A 4GAWA 1MQ6A 3A7WA 1BF9A 6LPRA 1FUJA 5LPRA 5GCHG 4ABIA 1CHOF 1G37A 1PQ5A 2Z3CA 2JH6D 1S85A 2BD5A 3I29A 2F3CE 5EOKA 1GG6B 1TQ0B 2Q6FA 1TPGA 4AB9A 2P94A 3P17H 2W2PE 2VH0B 1IQNL 5GIBA 3ZVDA 2W2ME 2BDYA 4UONA 2BY5X 1GMHF 1N8OB 1BJVA 3ZZAA 2FI5E 2UWOA 1V2NT 4INHA 1WHEA 2WPMS 3BV9B 4Q7YA 2PSXA 2UWPA 1IQFL 4ZHMU 1ELAA 1UTPA 1K1IA 1ZMLA 2CHAB 5BRRE 4X2WA 4ABBA 4Y79B 3LH1A 2VNTA 2C4FH 2P3TA 3BTEE 4FUGA 3SHAH 1DUEA 2B7DH 1RFNA 1MTNC 1W13U 1FY3A 1WQSA 3M36L 1EPGA 3NK8A 2W26A 4CRDA 1L1GA 1QA7A 1W3CA 1BTXA 1SGNE 2KL7A 2QF3A 4ZH8A 1GJ7B 1JBUL 4WH8A 1AE8H 1O37A 3EE0B 1SLWB 3UTUH 1F0SA 4YT6H 2ZQ1A 5F8ZA 4A92A 1QA0A 3GCNA 3PMJA 3VXEH 1LDTT 1C1SA 2FTLE 3NCLA 1Y3VA 1QQ4A 2P3TB 2UUJB 2XBXA 4BTUA 1CQEA 3KNXA 2Z9JA 1FIZA 3BTME 2BZ6L 1TALA 6GCHF 2FO9A 3MU0A 1SQAA 6ESTA 2BQ7A 4K8BA 1C5SA 2QF0A 1A5HA 1Y5AT 2Z94A 1C2GA 1DUAA 1U8CB 3Q3KA 4OTJA 1C5RA 3QX5H 2FX6A 1WU1A 4HTCH 2Q6DA 1FFMA 3STIA 1ATEA 2KV4A 4RRWA 3TZIA 1GBHA 4YLQH 1AB9C 3LGUA 2FLRL 1GI0A 1MZAA 3M36A 3RXCA 1FI8A 3DT0H 2V0BA 2STAE 3ZZDA 1GPZA 2VWLL 3S69A 1P12E 2BQ7B 1KTTB 3N8WB 1TPAE 4Y79A 1RGQA 2EI6A 2ANYA 1G9IE 4BTTB 5HM2A 3F6UH 1LHEH 1SGIB 2BXUH 1HCGB 4PH9A 3SU3A 8KME2 2GCHG 3RU4T 4BDXA 2GZ9A 3SBKA 3NZIA 5JVYA 1NN6A 2WUCA 1J17T 3FCSB 1CE5A 1DLKB 1UZKA 1MAYA 1OP0A 2K2TA 2Y82A 1IQNA 3U8RH 1GJ6A 2FM2A 1TABE 2GT8A 1U6QA 1SGYE 2VGCB 5LPFA 1Z6EA 1FPCH 4BNRA 1A3PA 3RC5A 8LPRA 2XXLA 3H7OA 1VZQH 4NIYA 1WBGB 4TY7A 3SORA 1J8AA 3LOXA 7GCHG 1O39A 4K60A 5C2ZA 2Z9KA 2PV9B 1F0TA 5EXNA 1A4WH 2R2WU 3IG6B 2XC5L 1NPMA 4BTTA 1ZPZA 3BG8A 1EX3A 1AKSB 3TVJB 1RIWC 1AB9B 1HJ9A 3LTFB 3ZVFA 1AFEH 2VVCA 5FCKA 1A3EH 1NU9A 1K37A 1AWFH 1SC8U 4Y6DB 2PKSB 2YGPA 3A7VA 1BDAA 3TK6A 3SNDA 1LPGB 2ZHEH 1KLJL 4O97A 2IOTA 4LOYH 4I8LA 1HREA 5JBAS 3BEUA 3EA8A 3ZYDA 3LKWA 1K21H 1T31A 2HPQH 1MKWK 4OS1A 2GMTC 4NIWA 1Q4GA 1GVZA 4RRXA 1MBMA 2GP9B 1F5LA 1RXPA 1JRSA 3GY8A 3VB4A 3AW1A 4Z6AH 1QB6A 3RC4A 2ZDAH 5JVZA 1G2MA 1ZMNA 1UTMA 1HIAB 2PTCE 3PWBA 2UWLA 3HPTB 3UNQA 4OS5A 4CRGA 4FUJA 2P93L 1IVOC 3ZV8A 3M5NA 2A7JA 5GCHF 1YKTA 2WPIS 1JRTA 1YF4A 2ZCLP 2RCEA 2ODYB 4C16A 3FP7E 3L33A 4FUCA 3SU1A 4A6LA 3QZQA 4ABFA 5CE1A 1XFEA 1LPZB 1OB1C 2FYQA 3EGKH 3U69H 1O3EA 1SHYA 3M61U 2AGEX 2ASUB 2W2NE 1LKBA 3HPTA 3BTWE 3KQBL 2PUQH 1AE5A 2AMDA 1IQHL 2EC9H 3A85A 1AVWA 1O3GA 2OLGA 1XUFA 1G1RA 2ADXA 2RG3A 1SQOA 3EYDA 3KQDA 4Y6DA 5AF9H 1LVOA 3LN1A 3TK9A 2O8LA 1VR1H 4AX9H 4TGFA 4ESTE 1HBTH 1CA0B 1EATA 1AIXH 4ABDA 1ORFA 1A0LA 1HIAA 2IN2A 4WVPE 2P3UA 4YT7H 1P2JA 3H7TA 2Y81A 3KN2A 1IHSH 1WTGH 1YCPH 1GGDB 3ZZBA 1EQGA 3RMNH 4I31A 5EODA 1BOQA 1OWJA 1JIRA 2ZFPH 3A7XA 1P09A 3O8DA 3PM3A 2F9BH 3NTGA 1GBKA 2P3FL 4WXIA 2P28B 1O5FH 3DUXH 4RRZA 4FUBA 2BDHA 3Q77A 2D26C 3A81A 1Z71A 1ZGIA 3RDZA 4WWYA 1HGTH 1V2UT 3OY5U 5EPNA 1WHFA 1UO6A 5IKQA 2AYWA 1UTQA 1SGPE 2BVSH 4JZDL 1IQIL 1K9OE 2H5CA 1G1TA 1SG8B 3LGYA 5C1YA 5F6MA 2AEIH 4ISIH 1XM1A 1NFUA 3SOBB 2XW9A 5JPMH 5JBCS 1O31A 2A31A 1DS2E 3A8CA 1HAXB 2ZA5A 4R8TB 4H4FA 1SHHB 1IQLL 4IC5A 4YO9A 4RSPA 1VITF 3MOCA 3GY4A 2BQ6B 4ZMAH 1C5NH 1BJUA 3FP6E 3O8BA 3S0NA 2ZHWH 1YP9A 2ZFQH 2FIRH 1EZXC 3ZYEA 2YGOA 1QURH 5T6GA 2BDBA 3TPIZ 3ZVAA 4O3UA 2VWOL 1EAIC 1O3NA 1ZSJA 1AFQC 3CS0A 1GMDG 4NWKA 1K1OA 4XBMA 3DD2H 1ABIH 1W2KH 3P8NA 1HAPH 1F0RA 2XCNA 5FHTA 2WPLE 5CISA 5T3HA 1SLUB 4FU8A 3EA7A 1KIGL 2BZAA 2TGFA 2CN0H 1BTZA 2H6MA 1GI1A 2O8UA 1GHAF 4NG9H 1P2QA 2OQ5A 1C1OA 2XC5A 1APOA 1V3XA 2WINI 3D23A 3OU0A 3K9XB 1YCPM 2M5TA 2BOUA 4ISHL 2F9BL 1IQEL 1P9UA 1QJ6B 3ZYIB 4ISLA 1LKAA 4CHAB 4Q7ZA 1O2QA 3A8BA 2Y5HL 4ZUHA 1G2LA 1C5ZB 1QJ1B 1T8OA 1N7DA 2BQ6A 1LCYA 4GCHF 3DEMA 2FDAA 3RXUA 2WPIE 3BG4B 1Z6EL 5KIRA 1TONA 3BG4C 1TGNA 2FX4A 1CGHA 1DDXA 1BTUA 2GZ7A 1UCYH 1C2KA 2J38B 1D6RA 3ZZ5A 1GL1A 2XC4L 4O3TA 3TJNA 1DICA 2JKHL 2ZCHP 1JWTA 2RA3A 3ATLA 3U9AH 4B73A 2HGTH 5FDQA 1RTLA 1O2XA 4U30A 2GD4A 3EAJA 4X6OA 2VIQA 4JZ1A 5PTPA 2GV6A 4DJZB 1K1NA 3SQEE 2BDIA 3PROA 1TNKA 4YLUA 3LIWA 1C5OH 3P70B 2QC2A 3QK1A 1B9WA 4AFZA 4ISIL 1HAIH 3ESTA 1W14U 2B7DL 3BEFB 1Z7KA 3GOVB 2VWLA 3HS6A 4RRYA 5I46L 1ANEA 1D3DB 3UOUA 4CHAC 1C2DA 1DWDH 1MTNB 2JETC 5T6FA 3KL6B 1YPHC 2TIOA 1WCZA 1F2SE 1AZ8A 5L30L 1HFDA 1TOZA 5AFZH 4MPWA 4MMXB 3MU1A 4I7YH 1SOZA 2EA3A 4NG9L 3F1SB 1HJ8A 2PKAB 2R0LA 1YUGA 1S84A 4TPIZ 2BOXA 4AG1A 2FZZL 3BIVH 3ZVEA 1H1BA 3ZZ8A 2F9UA 2FOBA 4TWYA 3HATH 3SV7A 3UREA 4JZFH 1NZIA 3SV6A 4WMDA 3ODDA 2F91A 3SGQE 2ZPSA 2Y80A 1J14A 2Q1JA 3EDXB 2BY8X 2CV3A 2V6NA 3BTDE 3TGIE 3PLKA 4CUDA 2W2QE 2ZDVH 2Z6BD 1DY9A 3SU4A 1RRKA 2VIDA 1C2FA 2UWOB 1SOTA 1SFQB 3A7TA 4DOQA 3ZVGA 2BQWA 1LO6A 4Y0YE 1JMOH 1EAXA 3LTGD 2VB0A 3KRKA 1HNEE 1FDPA 3BTTE 4X8VH 1DIYA 3RXAA 3U73A 1F7EA 2OINA 1EAIA 2OD3B 1XUKA 3HS5A 2BY6X 2GX4A 2BO2A 1RS0A 1CQQA 1O2YA 5JDUB 2A4QA 2V35A 3T29A 2FP7B 2G00L 4H6SB 2C8WB 3JZ2B 1MOXC 4WY3A 3RU4D 4AYVB 4MPXA 2BQWB 6CHAC 1AWHB 5C5NA 2WFTA 1O2MA 5CHAC 1BTPA 4NIXA 1EPIA 2UWPB 3E6PH 1GGDC 1YPMH 2BD9A 4X2VA 1V2OT 2H1UA 2ZC9H 1GDQA 1Y3XA 3MU4A 2Z3EA 1SPJA 4DGJA 3HKIB 3LC5A 5E8DA 4NZQA 1QBOA 1HCGA 4B2BA 3KEEA 4YOJA 4M11A 2SGQE 1A46H 2GCHF 4CH2B 2I9AA 2G4TA 1FMGA 1ADXA 3LPRA 4BTIB 1PQ7A 1EBVA 2Y82B 2BLVA 4KTSA 1NRPH 1Q2WA 9LPRA 4BAQB 4ZKNU 1FN6A 3RXQA 3AAVA 4I33A 1HAYB 2JH5D 1MKXK 4D8NA 2BOKA 3OYPA 4XBDA 5E2OA 1G1SA 3AASA 3QO6A 2XC0L 3SUFA 2BOHB 2ANKH 5T6DA 4X6NA 4X1PU 1VITH 3FP8E 4JZIA 1O3KA 1ZHRA 1O36A 3B8JA 4X6PA 2AS9A 1PFXL 2VH6A 4UE7H 3EA9A 1GHBG 4R0IA 4A7IA 2IJOB 1BUIA 3LC3B 1T4UH 1MU6B 2AGIX 5CHAB 1MD7A 1SLVB 3T25A 1GBJA 3KGPA 2ILNA 3BPSE 2B8OH 1UHBA 2FLBL 2Q6GA 3OLUA 1GDNA 1IHTH 2A5AA 1PYTD 1ETRH 4D9QA 2VU8E 5EQQA 1O2WA 1GI8B 2Z9LA 1ELCA 3M3TA 4IMQA 3URCA 2XC0A 1HT8A 2CHAC 2B5TB 5FX6A 1EGFA 2Y5FA 8GCHG 1UTLM 1GBMA 1GJBB 3SI3H 1C9TA 1SGFG 2CMYA 2W7SA 3UR6A 2C8YB 1C1WH 4GCHG 4X1RU 2WYJB 2RA0L 4E05H 1RFNB 1IQML 4NFFA 4INKA 1UZJA 3V0XA 1TGCA 1GHBF 4YZUB 1O38A 3A7ZA 4KTCA 1C5PA 3LU9B 3MO6A 3ELAL 4Y11E 3DFLA 4B74A 4XDEA 3BIUH 5AHGH 3RXJA 1Y3WA 3RXIA 5FX5A 3SZNA 2AFQB 4GVUA 1BZXE 1LHCH 4JYVL 1P8VC 1UHBB 1ID5H 1C5VA 2ZHDA 4ZXYH 1YBWA 4BANB 1IGZA 3SUDA 3Q76A 1QBNA 1VGCB 2EI7B 2BD3A 5H4IB 1M1XB 1GWAA 4G1MB 3TNSA 2P95A 1IOXA 1DXPA 6COXA 5F1AA 3A8DA 1O2OA 2HNTC 2XBYA 3D62A 2BX3A 5K7RA 2ZDNA 2BVXH 2ESTE 3RXHA 1CT4E 2OTVA 1O5GH 1YM0A 1ESTA 1O2IA 1A0JA 1Z1IA 2OYEP 3CENL 2G81E 1CGIE 1HAGE 2DE8A 2JETB 5C67A 2VVUA 1PPCE 5IKTA 1NFXA 1AVGH 1P9SA 2FI3E 3V13A 3GCOA 1ZRBA 2UUFB 4AG2A 1EP6A 1ELVA 3SJIA 3ODFA 1C1TA 3SU5A 1TNHA 2QV1A 1LHGH 3ZYJB 2PKSC 4MNWA 1F5RA 3SW2B 3T28A 2ZDKA 3GICB 5LPEA 1O2ZA 4BAOB 1KYNA 2HWLB 1XUGA 1BBRH 1O5BB 2P59A 5CKNA 1E0FD 4Y71B 1V2VT 1O2PA 2ZI2H 1F92A 5C5OA 3SNBA 2KAIB 1V2JT 1LQDA 2ZCKP 2A5KA 1DOJA 3LH3A 1S83A 3PGHA 4XOJA 1NRRH 3T26A 4NSYA 1KXBA 1IGXA 1UCYE 1D3TB 2FZZA 2QN5T 1E36B 2H9TH 3PWCA 5DP3A 2J4IB 3MDLA 2SNWA 3MMGA 4JZEL 4AB8A 2PGQB 1S5SA 2BM2A 1BHXB 1Y3UA 2XBWL 1ZR0A 4BXWA 2BB4A 3N7OA 3UWIA 1ARBA 2Y5GA 3E1XB 1JBUH 1DX5I 1H9LB 1ELFA 4RS0A 1WUNH 2C90B 4X8TH 1GBAA 1KLTA 2R9PA 1O2JA 4Q2KA 3CP7A 1H9IE 3BEIB 1ZPBA 1W10U 5K0HB 1BRBE 1PQ8A 1XVMA 2PLXA 1ATDA 3TU7H 1FPHH 1ESBA 3LJOA 4A5TS 4BDWA 2F9NA 4ABJA 3DHKH 2ZHFH 3PO1C 4XSKU 4B2AA 1BB0B 1NFWA 1FE2A 2XBVA 2UUYA 5ESBA 5AVDA 1M9UA 2CJIB
chains in the Genus database with same CATH superfamily
3EQ0H 1NT0A 2Y81B 2Y38A 1PPFE 1T7CA 3GCTF 1MZDA 1LQEA 3SW2A 2BMGA 1TA2A 1MQ5L 1QB9A 1C5WB 4CRBA 4DCDA 1MTVA 1L1JA 1O35A 4Y8XA 2I6QA 1TBZH 4Z6AL 1P2MA 2OC0A 3R3GB 1NT1A 3SGAE 1GI5A 2O8WA 1BCUH 5JBCE 1SBWA 5GJ4B 4O02B 3M3SA 1E1RD 2HVXA 4THNH 2XOKD 1D6WA 1WTHD 5IKRA 1C9PA 1TRNA 2DE9A 2YMSC 3VEQB 4UD9H 3RMLH 4D7FA 1HT5A 2XRCA 2VIOA 4FUIA 3GISB 2BMGB 1E35B 2PW8H 4UEHH 2YNBA 2BY9X 3RLWH 5A09A 5EIYA 2LELA 1O3FA 4X1SU 3RP2A 2F83A 1T8LA 3ZVCA 3MFJA 5L2ZL 3OTPA 2Y6TA 1YGCH 4Z1MD 1ZYOA 1FJSA 1L1NA 3QWCH 5T1VA 1RD3B 3RXRA 4J1YA 1C2HA 1SMFE 4NSVA 1AKSA 3PRBA 2WPLS 1OP8A 3RXEA 1EZSC 1P05A 3NXPA 4X8SH 4ABEA 1YWUA 1GBFA 4ASHA 5F8XA 3VB7A 1CA0C 4UFEH 1TPSA 2TRMA 2W5EA 1UW7A 3GY3A 1C4U2 2P3UB 1ZRKA 1Y8TA 4YESB 1COWD 1GI9B 2H9EL 3MWIU 2A32A 2F9OA 8ESTE 4J2YB 1ZTLA 1UK4A 1MD8A 5FXLA 2BD8A 1K22H 1SLXB 3S6XA 1NESE 4ZXXH 1Z6JH 5IDKA 1GHZA 1XKBC 1FIWA 4FVDA 2A7HA 4FM5A 1GJ8B 3HK6B 4JMYA 2I9BA 4GSOA 1C5YB 1HV7A 1CT2E 4JK5A 2J94A 5HIZA 1A5IA 2Z9IA 3U1JB 4XBBA 2VVUL 4U2WA 1BHXF 1OXGA 2A7CA 2R3YA 1CBWB 2RNLA 1VCPA 1X7AC 5DN6D 3OSYA 3UOPA 1C2MA 1PPBH 4BAKB 1DWCH 2BXTH 2J2UA 3SGBE 1O32A 2FYRA 1DANH 2QXJA 3LGTA 2UUKB 4Y7BB 4LMFA 3AK5A 2ZEBA 5EU8A 3STJA 3UFAA 2HALA 2BDCA 4XD7D 1EP5A 1GJDB 1GG6C 1AI8H 5HIYA 5EGMA 1TGBA 4CRCA 3MH7A 3A84A 2KR7A 4KELA 2P95L 1NROH 2FPZA 2KZ4A 5TJXA 1EKBB 3W95A 3U7UG 2BD7A 3MNXA 2IPQX 3KQDL 1CSOE 1UVOA 5EXMA 1NU7B 1V2WT 2DUCA 4COXA 2R0KA 2QE7D 1B0FA 1O30A 3TGKE 5L2ZH 3AVZA 1CCVA 1TIOA 1AUTL 1O3LA 3S9BA 1HX2A 2ZU5A 1X7AL 3PYHA 4NA9L 2GZ8A 5E0GA 5FPSA 4TSFD 5F03A 5FPYA 2FOMB 1SFIA 1V2ST 3UAIC 2V3OH 4ZKSU 2J97A 4YT6L 2P8OB 4E06H 5K0HA 4AFQA 1D3QB 3RXMA 5EQSA 3V7TA 2WPHS 4FUHA 4ISHH 1VKYA 4SGBE 4INLA 1V2KT 2BYAX 2Z7FE 2ZGXH 2PSYA 2GD4B 3EE7A 2C8XB 4BTUB 2WSSD 2J95B 1KKEA 1DM4B 1GJAB 2QIQA 1C5MF 1S81A 1O34A 5IKVA 2QA9E 2PUQL 3O8RA 1P3EA 4I8KA 2Q1JB 1GMCF 3A7YA 1OWIA 2I6SA 2Z9GA 3SV2H 3E3TA 3T62A 3UUZA 1AQ7A 5COXA 4JK6A 1FY5A 4F49A 2KB9A 4HI3A 4WH6A 3RXVA 1GVLA 3LT3A 2FLRH 3S9AA 5CHBA 1W7GH 2IJD1 2J92A 2VWMK 4D9RA 2RDLA 4K69A 2L6OA 4VGCB 3JZ1B 4TYDA 2OC1A 1C1VH 4JZDH 1C1UH 1H8DH 1BTHH 1ELGA 5JB9E 2BOKL 1O2TA 1V6DA 1BQYA 1HDTH 1XUJA 1GI2A 3QH0A 1AN1E 3M5OA 5HXFA 3RUOA 4XL1A 1F7MA 3A89A 5JW1A 3FANA 1OPHB 4B1TA 1TBQH 4ISNA 5CMXH 1GDUA 1ELEE 1GK5A 1TNJA 1DPOA 1PPGE 4Y0ZE 4Y8YA 3AAUA 2A45B 2ZU1A 2ZU3A 3F2FA 1NFUB 1IP0A 3KHVA 4I8HA 2FOFA 1MABB 2ZO3H 3S9CA 1B7XB 1ETSH 1BRAA 1EPJA 1DFPA 3T2NA 1P01A 4I32A 3MQEA 3A87A 1G3BA 5JYIA 2H5DA 1CEJA 2AMPA 2XTTB 1TA6A 1RJXB 2BLOA 3L3TA 4VGCC 1OKXA 5EG4A 3RXBA 3SQHE 2J34B 2MGPA 2Y80B 2G00A 3Q3KB 4QT8C 1EJNA 1OWDA 3S7HB 1JOUB 2ZU4A 1ZSLA 4NA7A 5DP6A 3QMOA 4RUTA 1HAEA 1IOEA 2GCTB 2ULLA 1L0ZA 1G36A 1O3CA 1W0YH 3RLYH 3P8GA 5FAHA 4XFQA 1C5QA 3K2UA 1U67A 2NU0E 2ZNKH 2VIPA 4Q80A 3FZDA 1SGCA 2EI7A 3DSOA 1RIWB 2OBQA 4MPUA 1LMWB 4ABAA 5ABWA 2BLQA 1IAUA 1SB1H 4FUFA 4FVBA 3ASIA 4U32A 5EW1H 3LAQA 4TPYA 5C1UA 2AIQA 1WQVH 1KDQA 2CF9H 2WZQA 4JCNA 2YNAA 2OK5A 4M9FA 2A2XH 3QDZB 2G8TA 4K1SA 3T5FH 4A1VA 1P2KA 1UCYK 4D76A 7LPRA 2PR3A 1NZQH 3F9GA 5E0JA 1Q31A 3F2GA 1UMAH 1BRCE 1HLTH 5GPIB 1SGRE 3UWJH 1HRFA 1NY22 3U98H 1V2RT 3QTOH 1CX2A 1YPJH 1O0DH 1QJ7B 3K6ZA 2BD2A 3N7EA 3KQ5A 2G51A 4AGJA 1DDJA 5A8YA 4X1NU 1ATBA 1OP2A 5EXLA 1DT2A 2PKAA 4OS7A 3URDA 2ZQ2A 3PB1E 1O3PB 2WV9A 1GI7B 4UFFH 1WXRA 3SO3A 3E0PB 1GL0E 3M5MA 4E7NA 4OS2A 1W7XL 5B6OA 5L30H 5EJ1A 1HAVA 4YOIA 1CVWL 2W3IB 2G4UA 3KF2A 2K1QA 2Y7ZA 1QCPA 2ZWLH 4Y8ZA 2BY7X 3LN0A 3TJVA 4F55A 4Y76B 2HRVA 2PFEA 4GLYA 2H2ZA 1TE0A 4WMEA 4CBNA 1DE7H 1INCA 4B71A 4RI0A 2PHBB 1TBRH 1MTSA 1YUFA 1AO5A 1YLNA 3K6YA 1HAFA 4UFDH 3V12A 1YPKH 4JZFL 2AH4X 3BTGE 1DY8A 1EAWA 1THPB 1Z8GA 3M37A 2AERH 1GVKB 5GXPA 2ZPRA 3SJ8A 4CBOA 1OOKB 3M7TA 2FTMA 2V3MA 2VH6B 1RTFB 2VJ1A 3B23B 4U01A 1G3CA 1K1JA 3D49H 2Y7ZB 3WY8A 5SGAE 3ENSA 3CS7L 2H9HA 3MO9A 3OLTA 3BT1A 1XVOA 2VWMA 4IN2A 5L6NH 4ZHLU 2EI8B 1FAKL 2W26B 2STBE 1ZTJA 1MU8B 5F8TA 1APQA 8GCHF 1NFXB 1GBIA 1ZOMA 3F9FA 1A0HB 2ZIQH 2B0FA 1MQ6L 3GCWE 3ZZ9A 1LTOA 5DP8A 1OSSA 4YXWD 1SGTA 2FEQH 1GHYH 1KSNA 1TQ7B 1TMUH 4K5ZA 1I0UA 1ANBA 3SUGA 2WG4B 2HPPH 3GISX 3SNEA 3TIUA 1QL9A 2PP6A 3FAOA 1O33A 1EOJA 3M7QA 3VB5A 1KXFA 1LPKB 2JH0D 1IQKL 1TRMA 3HKJB 1KXAA 1ATAA 1HAVB 1NTPA 2SNVA 1C2EA 1TGSZ 4DG4A 1MTUA 3N8WA 3ZZCA 1P2NA 4BTIA 5ESTE 1K2I1 2OXSA 1QTFA 3MU8A 3P92A 4WMFA 4Y76A 4ZHAB 5DP4A 4NWLA 3RXSA 2TGPZ 3RXOA 4ZKOU 3OE7D 3TJOA 1ZPCA 3PTBA 3P5BL 1O2SA 3K65B 3KQEL 1O2GH 2OC7A 4Z0KA 4IC6A 1NC6A 3HS7A 1YLDA 2BZ6H 1EPTB 4H6TA 1P0SL 2P3FN 2P16A 4PROA 1TAWA 3UPEA 1BTYA 2D1JA 2G52A 5DPAA 2OUAA 2EI6B 4IBLH 1SL3A 5JBBS 1BMAA 1UZPA 1BTWA 3VGCC 3MH6A 3A80A 1XKAL 3IITB 1TPPA 4ZXXL 2VIVA 5F19A 4D0EA 3RXDA 1ZHMA 2EY4C 2FOAA 1IQIA 2G55A 2GT7A 1H8IH 3MO3A 1FXYA 1LQDB 1FAKH 2K2SB 2Y7XA 1GJCB 2FXRA 2TPIZ 1TX7A 2LNCA 1C1RA 1P9JA 2BD4A 1QQUA 1GBEA 5A2MH 1SSXA 2CGAA 2D1JB 5A0AE 1O3OA 2WPME 1FZZA 1DSTA 4Z0KB 1O5DL 3F9EA 3IITA 3TITA 4B2CA 1TPOA 1K28D 5FBIA 5C3NA 1ACBE 2G5NA 1OWKA 2NU4E 3LJJA 5A0BA 1P2OA 4ZAEA 1GCTC 3BSQA 1FX0B 1GJ9B 1C5TA 1PFXC 2KAIA 2ODQA 3TLOA 1P10A 5JB8E 4LK4A 2AGGX 2FS8A 1EPTC 3GDUA 3SOQA 1TX8A 4AQTA 2A5IA 3KQCA 3LDXH 1ZGVA 1JV2B 1P57B 3E16B 3KIDU 4FU7A 3TK5A 3ZIAD 1EZUC 1HYLA 3F9HA 1Z1JA 2W2OE 1IQHA 1GI4A 5DK1A 5C0UA 3TK6B 1AVXA 4NA9H 3VXFH 4DVAU 3VPKA 1PQAA 2GCTC 3GDVA 4I8GA 1BITA 3OFND 1CCFA 3ZZ6A 1Y5BT 1DSUA 5CDFE 1SGDE 2A4RA 4MNYA 5KECA 1PRHA 1OS8A 2MGRA 1DVAL 4XLWA 2C8ZB 4YOGA 5FBEA 3SHCH 1ZLRA 2P8OC 2B9LA 4MVNA 4Z0LA 1O3HA 1EOLA 2ZFFH 3QN7A 1SVPA 3P6ZB 3OAAD 5I46H 1LPZA 1ZSKA 2TBSA 3SOSA 4NCYA 1CU1A 1HB0B 1DXWA 3GCHC 1EZQA 1W8BH 4O03A 1KLJH 3ELAH 3NJPC 2IPHA 2TGDA 3I77A 1AZZA 5JB9S 3ATWA 2QY0B 3RXKA 4ZCNA 1VITG 3UR9A 1CHOG 3M3VA 4IGDA 1NBME 2D2DA 1V2MT 3C1KA 5E8EH 3SN8A 4E1GA 5DGJA 1O2KA 3VFEA 1Z6CA 3ENSB 1PPZA 1MKWH 3KL6A 1V2QT 4K1TA 5DKMA 4AYYB 5DJ7A 4MQAA 1YC0A 2XNIA 4BAMB 3R0FA 2JJ2D 1HJAB 1EJMA 3UQVA 3C9AC 1ARCA 2QXIA 1BIOA 3MYWA 1K1LA 2G5VA 1O5DH 1TNLA 1YPGH 4DIIH 1AFQB 1FY1A 1GHAG 1MH0A 3KYFA 4MG3A 4WF8A 1BRUP 2Z3DA 2PTNA 1UZQA 1O2NA 2SFAA 1YGCL 1TNIA 3FBYA 3SOVA 1FN8A 3GS9A 4AN7A 2BDAA 3E0NB 3QZRA 2VWNA 2ZZUH 1P02A 1S6FA 1C2IA 2J38A 4WJG2 1COUA 4OGYA 1L2EA 4A1TA 1B0EA 1MKXH 1YO8A 1MTWA 2ANWA 2GGVB 2DDUA 4TY6A 3ATKA 3PO1B 1FQ3A 1MMJN 4ZHAA 1YLCA 4DURA 3RM2H 3RC6A 1P2IA 1TB6H 4RN6A 4JZEH 6CHAB 2VIWA 1O3MA 4D0FA 1BA8B 1HAOH 5HMAA 1F7ZA 3CS7A 2TGAA 4TWWA 3VB6A 7KMEH 2JDID 4XBCA 2YOLA 2H9EH 5EQRA 1NFYB 4GU3A 1C1QA 2ZTYA 4MMZB 4OM9A 1S0RA 2R2MB 2J4IA 2KNIA 2HNTF 1QRWA 4Y7BA 3M37L 1E79D 5DG6A 4LZ4B 2O8TA 2XBVL 1THRH 2W7UA 1EPHA 2XWBI 1K36A 3LGVA 4LXBH 1GBCA 4ZH8B 5EGMB 1S6HA 1MBQA 3PTNA 4YT7L 1FONA 3TH3L 3DA9B 5GWZA 3U8TH 2FD6A 3QUMP 1A61H 1C2JA 1XDTR 2KCAA 3GDSA 4IS5A 1V2LT 2J34A 3UNSA 3KYGA 1C4Y2 4GHQA 2Y5GL 2WG3C 7GCHF 4CR5A 1BBRE 1N6XA 1G2LB 1DX5M 2OBOA 2WYGA 1YUKB 1VCQA 3UNRA 3CFWA 1O2RA 1AUTC 4IMZA 2CF8H 4NGAL 1O2LA 2BX4A 2SGAA 2XCFA 1QY6A 1LVBA 2KCPA 5CKQA 3L6PA 2AIPA 3HO4A 1QL8A 2VBCA 4NIVA 1C1MA 7ESTE 1EQ9A 3SNAA 3V65B 2CK3D 2XBXL 1EMOA 4B6FA 3F68H 1NS3A 1UTJA 3RXLA 2GDDA 1QB1A 2J95A 2FLBH 1TMBH 4AGKA 1TWXB 2HORA 1XMNB 1D9IA 3TH2H 3PLPA 1W7XH 4K8YA 3U1IB 1O3AA 3FFGA 3MTYA 5HYOA 1PGEA 1AHTH 2J9NA 1OX1A 1QRXA 4RT1A 5KN5C 2KX4A 3GY7A 2ZFTA 1THSH 1XKBA 3Q3XA 2VH0A 1FY8E 5HGGA 4B76A 2NPRA 3BN9A 3CENA 2GVFA 1E34B 4D7GA 1L4DA 1IQFA 2A4OA 1MCVA 1HXFH 1EB1H 1F0SB 1IOEL 1Y59T 2RDEA 2SGPE 2V3HH 3Q3YA 4CREA 2LPRA 1AD8H 5L2YH 1TGTA 2ODPA 1KDQB 2YGQA 2A1DB 3Q00A 1D4PB 3GYLB 1XUHA 2M2AA 2ZDLA 2MHPA 4M10A 3NPSA 3SV9A 4RKOB 2P94L 1SR5C 1C5UA 3POYA 5I25A 3HGNA 1KXEA 3FKSD 3HK3B 1QL7A 2QCYA 1GMHG 1CO7E 3FO8D 3ATMA 3VB3A 1EQHA 3QTVH 4E7RG 2W3KB 4CUEA 2L74A 4O9VA 1NQLB 1WYKA 1SI5H 1SQTA 2YMSB 3P8OA 1SZBA 2OYUP 3TGFA 1EUFA 5TCAA 1NM6A 4AZ2B 2PHBA 2FI4E 4AORA 2AMQA 1EASA 2WPKE 3FVFB 1B5GH 1IQMA 1F0UA 1T8MA 2RA0A 3T27A 1FAXL 4BOHA 3RXPA 2BTCE 1WV7H 1K1PA 2C93B 4NGAH 4F4OC 1IJQA 1MCTA 3KCGH 4NFEA 3TH4H 3TBDA 2ZTXA 4A7IB 1N1LA 1BBRK 1ANCA 2BSFA 3ZV9A 3HO3A 3P95A 3ZZ4A 2FS9A 2OC8A 1S0QA 2BDGA 1N1IA 2WPJE 1ZAQA 5DP9A 4OGXA 1BMNH 2GMTB 1ELBA 3ZVBA 5E0HA 3Q7DA 2KM0A 4X8UH 1G3DA 3SU0A 2WPHE 4GUXA 2NU1E 4CH8B 5J4SA 1KXCA 1O3DA 4AOQA 3EGFA 2WPKS 4KP0A 1G1QA 2OP9A 2P26A 5FPTA 2GTBA 3GY2A 3PMHB 4JYUL 1O5AB 6GCHG 3PV5A 1CVUA 4IW4E 4Q63A 2OQUA 3TJUA 4UFGH 2QGRA 2WYJA 5EPYA 3A88A 4GPGA 3GYMA 4CRFA 3AW0A 4AFUA 2O8MA 1EJAA 1G30B 1T32A 1YCPK 2VVVL 1HUTH 5E2PA 1PPHE 4X8TL 1O5EH 4NA8A 1VJAU 1GJ4H 4P00A 1EPTA 1FAXA 1ZMJA 1VJ9U 1P03A 4X8VL 1WU1B 4OTYA 1GBTA 1UJ1A 1V2PT 1XXFA 1ZJKA 2W6JD 1A5GH 3OY6U 3RMOH 3P8FA 1QBVH 4KTUA 3DSPA 3GCTG 3CA7A 2AYLA 1FSBA 1RTKA 1SGEE 2BOHA 1LPGA 1GBLA 2ZGHA 2CXVA 1P06A 1JXPA 1ZTKA 2J5UA 1Y3YA 1BMLA 5BPEA 1FV9A 3TGJE 1NRQH 4KKDA 3M7UA 1F5KU 1UVUH 2W3IA 1GCTB 3RXFA 3KCGL 1FF7A 1WSSH 4I8JA 1BMFD 1ELTA 1UVTH 1CGJE 1VCWA 1ZZZA 4X2XA 1PTHA 2F9VA 2ALPA 4HFPB 3MNSA 1LHDH 1N8OC 1S82A 1HJAC 4CUFA 1NO9H 1UTKA 1IQGL 1L3YA 4GHTA 4H42U 1W0ZU 2FWWA 1NFWB 2ZG0H 3N7DA 3RXTA 1G2MB 3SZEA 4LORA 3GCXE 3PLBA 1T4VH 1GJ5H 1QIXB 2FOGA 1CVWH 3BT2A 3MNCA 2AHME 3OEHD 4IN1A 4F48B 4DY7B 3SUEA 1BT7A 4MLFB 5A8XA 3LC5B 2ZFSA 1GCDA 3SJ9A 4O1ZA 4MDSA 2FODA 1UVSH 4Y71A 1YPHE 5JB8S 4X8UL 5JBBE 2ANMH 3HO5A 1AUJA 3GCHB 4HZHA 3S7KB 1J15A 3FFGL 4FXGH 5KEDA 2WZPP 2ZTZA 1KIGH 4DIHH 2PR3B 2BVRH 2CJIA 3W94A 2UWLB 2K0QA 2NWNA 3A86A 4BXSA 1KLOA 4X8SL 1QHRB 1OWHA 2THFB 3NUMA 3A8AA 1YPLH 3TK5B 9ESTA 1O2VA 1O2UA 3N8ZA 1P11E 2A4GA 3PV4A 3KK6A 5DP7A 1ANDA 1KXDA 3VGCB 1K1MA 4ZAEB 1TRYA 3GY6A 3V3MA 1HXEH 1TOMH 2GDEH 1E38B 2HLCA 5ETXA 1TNGA 2ZHQH 1TOCB 3BTHE 3ZYGA 4ZKRU 1FJSL 5A8ZA 1DLEA 2A0QB 1GI6A 1UK2A 1XX9A 3A82A 2HOXA 3RR3A 3UY9A 1OYQA 1E37B 3MU5A 2GV7A 2J98B 3MHWU 1IQJL 3MNBA 3PMBB 3M5LA 4B75A 2WFXB 3QGJA 2VINA 4RKJB 3E8LA 1PXXA 3WW7A 2ZPQA 3QLPH 1CT0E 5GDSH 2ZDMA 3O8CA 4SGAE 2ZU2A 4AC9A 4OS6A 3NKKA 3F6UL 4JYVH 1A3BH 1PPEE 2NU2E 3N99A 2QXGA 2ALVA 4MNXA 1AMHA 4D90A 5CKMA 2JKHA 2GKVE 3UIRA 4LZ1H 3E91A 2XC4A 3NT1A 2R3UA 4X1QU 2VGCC 1MQ5A 4CSYA 4UDWH 3RM0H 1KTSB 1GBBA 4X0WU 1MAXA 3E90B 1ETTH 1Z8RA 1NRSH 2FOHA 2VVCK 1XXDA 3N8XA 3LGWA 1A7SA 1KLIH 1C1NA 5DO4H 2Y5HA 3RMMH 1J9CL 1IQEA 3MI4A 2VWNL 3TH3H 1W12U 1W11U 1A1RA 2HOBA 1XUIA 2XYAA 3B9FH 5G4BA 4A1XA 2FOCA 1IQJA 4FUDA 2J94B 1ESAA 5GNDA 2KCYA 1V3XB 1DQBA 1DITH 3OTJE 2ZGBH 4M7GA 5FCRA 1C5MD 4MNVA 2O9QA 1KSNB 1LVMA 2K8IA 3SJOA 4AFSA 1O3BA 3MH4A 1GHVH 1JIMA 2KCOA 2OCVB 2XBWA 1LPKA 1L5GB 2FESH 2ZF0H 3BTFE 2VWOA 2WV4A 3QCWA 4MMYB 3IWMA 4ABHA 1G32B 1HPGA 1NFYA 1CHGA 1HRTH 4DT7B 5LGOA 3ATIA 4MPVA 3U8OH 3UB0A 3ZZ7A 1Q3XA 2QAAA 3G01A 1JL9A 3K9XA 1IQLA 2EI8A 3RXGA 1EZQB 1EAUA 1H8HD 1SGFA 3FZZA 3NRLA 4K2YA 3IJEB 1V1HA 4ISOA 1GMDF 5IYTA 1W0KD 4OS4A 2C3SA 4HGCA 2J2UB 1DVAH 3HGPA 2A2QH 4ZROA 1UTNA 1QFKL 1V1IA 1LMJA 4K1EA 1P04A 4NZLA 4TT3D 2WYGB 3N8YA 3LGIA 1KLIL 1Z8JB 2QXHA 3ITIA 1W8BL 1F0RB 4YM9A 5C1XA 1J9CH 3SV8A 1UK3A 2WUBA 4WXVA 5EW2H 5HM9A 1P0SH 5KGOA 3MQKC 2Y7XB 1C4V2 2BHGA 3DFJA 5L2YL 5IK2D 1N6YA 3A83A 1QRZA 3PMAB 3SNCA 1HZ8A 1ABJH 1BMMH 1IQGA 3SJKA 2XBYL 2ZKSA 3KQCL 2PWXA 2M74A 1LMMA 3R05A 3SU2A 2PGBB 3BTKE 1ELDE 1GHXH 3V64C 2F9PA 3H5CB 1PYTC 1QNJA 1TLDA 2HNTE 3NWUA 3SU6A 4Y10E 1YPEH 1QR3E 1O2HA 1YYY1 1D3PB 1NRNH 3KQBA 1EB2A 1O3JA 1Y5UT 1AU8A 2BLWA 4FU9A 3SI4H 1LVYA 2QYIA 4MTBA 3MH5A 3N8YB 4Y7AB 1LHFH 2P3FH 1XKAC 1C5XB 5A0CA 1WOFA 1T8NA 1DWEH 3SYJA 4JYTA 5DSFA 1HAHH 1WAYB 1TFXA 5AFYH 1UTOA 3WWBA 4YZUA 2FLGA 3LIWB 1P3CA 2SGEE 5C20A 1A2CH 4FUEA 1TX6A 2Y5FL 1NPEB 2P93A 3LC3A 2VVVA 1H9HE 1G3EA 1J16A 2W3KA 5DP5A 4ABGA 2PUXB 1QFKH 2D8WA 4DW2U 1H4WA 1O5CB 1C1PA 1L4ZA 3LONA 1GMCG 2RHPA 3F0PA 1TLEA 1EXFA 2P16L 3RU4E 1C2LA 2ZECA 1ZHPA 1GHWH 4KGAA 5EJZA 4JYUH 1ZJDA 4BAHB 3KQEA 1VGCC 4CR9A 2FMJA 3ZZ3A 1TMTH 4CRAA 3N8VA 1UVPA 1OYTH 1MUEB 2FOEA 1GBDA 2JIZD 2TGTA 2ZGJA 4Q7XA 4Y7AA 2ZFRH 4XE4A 1GI3A 4ZXYL 4YTAA 2WV5A 1FLEE 3TNTA 3GY5A 1TYNA 3C27B 5LH8A 2ZP0H 1C5LH 5JBAE 2F43B 4X6MA 2VJ3A 1FY4A 3U28C 5HKKD 3D65E 2WPJS 1V2TT 3BTQE 1QGFA 5TCCA 1EMNA 1IQKA 1KY9A 1URKA 5JBTA 1SGQE 1Z8IB 1DWBH 1HAZB 1PJPA 3OX7U 1HJ7A 3QGNB 4X2YA 3NTBA 5J4QA 2EEKA 3I78A 1CA8B 1OWEA 2W86A 2SGDE 2ZGCA 1O3IA 2XWAA 3BF6H 1EFRD 3UQOA 1AY6H 4K3JA 2NU3E 1FNIA 2SGFE 1AGJA 1CBWC 3M35A 4GAWA 1MQ6A 3A7WA 1BF9A 6LPRA 1FUJA 5LPRA 5GCHG 4ABIA 1CHOF 1G37A 3DCLA 1PQ5A 2Z3CA 2JH6D 5C17A 1S85A 2BD5A 3I29A 2F3CE 5EOKA 1GG6B 1TQ0B 2Q6FA 3OEED 1TPGA 4AB9A 2P94A 3P17H 2W2PE 2VH0B 1IQNL 5EJLA 5GIBA 3ZVDA 2W2ME 2BDYA 4UONA 2BY5X 1GMHF 1N8OB 1BJVA 3ZZAA 2FI5E 2UWOA 1V2NT 4INHA 1WHEA 2WPMS 3BV9B 4Q7YA 2PSXA 2UWPA 1IQFL 4ZHMU 1ELAA 1UTPA 1K1IA 1ZMLA 2CHAB 5BRRE 4X2WA 4ABBA 4Y79B 3LH1A 2VNTA 2C4FH 2P3TA 3BTEE 4FUGA 3SHAH 1DUEA 2B7DH 1RFNA 1MTNC 1W13U 1FY3A 1WDIA 1WQSA 3M36L 1EPGA 3NK8A 2W26A 4CRDA 1L1GA 1QA7A 1W3CA 1BTXA 2HLDD 2LP6A 1SGNE 2KL7A 2QF3A 4ZH8A 1GJ7B 1JBUL 4WH8A 1AE8H 1O37A 3EE0B 1SLWB 3UTUH 1F0SA 4Q4LA 4YT6H 2ZQ1A 5F8ZA 4A92A 1QA0A 3GCNA 3PMJA 3VXEH 1LDTT 1C1SA 2FTLE 3NCLA 1Y3VA 1QQ4A 2P3TB 2UUJB 2XBXA 4BTUA 1CQEA 3KNXA 2Z9JA 1FIZA 1H8ED 3BTME 2BZ6L 1TALA 6GCHF 2FO9A 3MU0A 1SQAA 6ESTA 2BQ7A 4K8BA 1C5SA 2QF0A 1A5HA 1Y5AT 2Z94A 1C2GA 1DUAA 1U8CB 3Q3KA 4OTJA 1C5RA 3QX5H 2FX6A 1WU1A 4HTCH 2Q6DA 1FFMA 3STIA 1ATEA 2KV4A 4RRWA 3TZIA 1GBHA 4YLQH 1AB9C 3LGUA 2FLRL 1GI0A 1MZAA 3M36A 5C0TA 5C94A 3RXCA 1FI8A 4FETA 3DT0H 2V0BA 2STAE 3ZZDA 1GPZA 2VWLL 3S69A 1P12E 2BQ7B 1KTTB 3N8WB 1TPAE 4Y79A 1RGQA 2EI6A 2ANYA 1G9IE 4BTTB 4RT0A 5HM2A 4XRNA 3F6UH 1LHEH 2W6ID 1SGIB 2BXUH 1HCGB 4PH9A 3SU3A 8KME2 2GCHG 3RU4T 4BDXA 2GZ9A 3SBKA 3NZIA 5JVYA 1NN6A 2WUCA 1J17T 3FCSB 1CE5A 1DLKB 1UZKA 1MAYA 1OP0A 2K2TA 2Y82A 1IQNA 3U8RH 1GJ6A 2FM2A 1TABE 2GT8A 2H9EC 1U6QA 1SGYE 2VGCB 5LPFA 1Z6EA 1FPCH 4BNRA 1A3PA 3RC5A 8LPRA 2XXLA 3H7OA 1VZQH 4NIYA 1WBGB 4TY7A 3SORA 1J8AA 3LOXA 7GCHG 1O39A 4I86A 4K60A 5C2ZA 2Z9KA 2PV9B 1F0TA 5EXNA 1A4WH 2R2WU 3IG6B 2XC5L 1NPMA 4BTTA 1ZPZA 3BG8A 1EX3A 1AKSB 3TVJB 1RIWC 1AB9B 1HJ9A 3LTFB 3ZVFA 1AFEH 2VVCA 3F0OA 5FCKA 1A3EH 1NU9A 1K37A 1AWFH 1SC8U 4Y6DB 2PKSB 2YGPA 3A7VA 1BDAA 3TK6A 3SNDA 1LPGB 2ZHEH 1KLJL 4O97A 2IOTA 4LOYH 4I8LA 1HREA 5JBAS 3BEUA 3EA8A 3ZYDA 3LKWA 1K21H 1T31A 2HPQH 1MKWK 4ASUD 4OS1A 2GMTC 4NIWA 1Q4GA 1GVZA 4RRXA 1MBMA 2GP9B 1F5LA 1RXPA 1JRSA 3GY8A 3VB4A 3AW1A 4Z6AH 1QB6A 3RC4A 2ZDAH 5JVZA 1G2MA 1ZMNA 1UTMA 1HIAB 2PTCE 3PWBA 2UWLA 3HPTB 3UNQA 4OS5A 4CRGA 4FUJA 2P93L 1IVOC 3ZV8A 3M5NA 2A7JA 5GCHF 1YKTA 2WPIS 1JRTA 1YF4A 2ZCLP 2RCEA 2ODYB 4C16A 3FP7E 3L33A 4FUCA 3SU1A 4A6LA 3QZQA 4ABFA 5CE1A 1XFEA 1LPZB 1OB1C 2FYQA 3EGKH 3U69H 1O3EA 1SHYA 3M61U 2XNDD 2AGEX 2ASUB 2W2NE 1LKBA 3HPTA 3BTWE 3KQBL 2PUQH 2WPDD 1AE5A 2AMDA 1IQHL 2EC9H 2F4LA 3A85A 1AVWA 1O3GA 2OLGA 1XUFA 1G1RA 2ADXA 2RG3A 1SQOA 3EYDA 3KQDA 4Y6DA 5AF9H 1LVOA 3LN1A 3TK9A 2O8LA 1VR1H 4AX9H 4TGFA 4ESTE 1HBTH 1CA0B 1EATA 1AIXH 4ABDA 1ORFA 1A0LA 1HIAA 2IN2A 4WVPE 2P3UA 4YT7H 1P2JA 3H7TA 2Y81A 3KN2A 1IHSH 1WTGH 1YCPH 1GGDB 3ZZBA 1EQGA 3RMNH 4I31A 5EODA 1BOQA 1OWJA 1JIRA 2ZFPH 3A7XA 1P09A 3O8DA 3PM3A 2F9BH 3NTGA 1GBKA 2P3FL 4WXIA 4B6EA 2P28B 1O5FH 3DUXH 4RRZA 4FUBA 2BDHA 3Q77A 2D26C 3A81A 1Z71A 1ZGIA 3RDZA 4WWYA 1HGTH 1V2UT 3OY5U 5EPNA 1WHFA 1UO6A 5IKQA 2AYWA 1UTQA 1SGPE 2BVSH 4JZDL 1IQIL 1K9OE 2H5CA 1G1TA 1SG8B 3LGYA 5C1YA 5F6MA 2AEIH 4ISIH 1XM1A 1NFUA 3SOBB 2XW9A 5JPMH 5JBCS 1O31A 2A31A 1QIUA 1DS2E 1HAXB 3A8CA 2ZA5A 2JJ1D 4R8TB 4H4FA 1SHHB 1IQLL 4IC5A 4YO9A 4RSPA 1VITF 3MOCA 3GY4A 2BQ6B 2BT7A 4ZMAH 1C5NH 1BJUA 3FP6E 3O8BA 3S0NA 3FN8A 2ZHWH 1YP9A 2ZFQH 2FIRH 1EZXC 3ZYEA 2YGOA 4ACBA 1QURH 5T6GA 1OHHD 2BDBA 3TPIZ 3ZVAA 4O3UA 2VWOL 1EAIC 1O3NA 1ZSJA 1AFQC 3CS0A 1GMDG 4NWKA 1K1OA 4XBMA 3DD2H 1ABIH 1W2KH 3P8NA 2VRSA 1HAPH 1F0RA 2XCNA 5FHTA 2WPLE 5CISA 5T3HA 1SLUB 4FU8A 3EA7A 1KIGL 2BZAA 2TGFA 2CN0H 1BTZA 2H6MA 2WHXA 1GI1A 2O8UA 1GHAF 4NG9H 1P2QA 2OQ5A 1C1OA 2XC5A 1APOA 1V3XA 2WINI 3D23A 3OU0A 3K9XB 1YCPM 2M5TA 2BOUA 4ISHL 2F9BL 1IQEL 1P9UA 1QJ6B 3ZYIB 4ISLA 1LKAA 4CHAB 4Q7ZA 1O2QA 3A8BA 2Y5HL 4ZUHA 1G2LA 1C5ZB 2BT8A 1QJ1B 1N7DA 1T8OA 2BQ6A 1LCYA 4GCHF 3F3BA 3DEMA 2FDAA 3RXUA 2WPIE 3BG4B 1Z6EL 5KIRA 1TONA 2V7QD 3BG4C 1TGNA 2FX4A 1CGHA 1DDXA 1BTUA 2GZ7A 1UCYH 1C2KA 2J38B 1D6RA 3ZZ5A 1GL1A 2XC4L 4O3TA 3TJNA 2EQNA 1DICA 2JKHL 2ZCHP 1JWTA 2RA3A 3ATLA 3U9AH 4B73A 2HGTH 5FDQA 1RTLA 1O2XA 4U30A 2GD4A 3EAJA 4X6OA 2VIQA 4JZ1A 5PTPA 2GV6A 4DJZB 5B6LA 1K1NA 3SQEE 2BDIA 3PROA 1TNKA 4YLUA 3LIWA 4ACAA 1C5OH 3P70B 2QC2A 3QK1A 1B9WA 4AFZA 4ISIL 1HAIH 3PRDA 3ESTA 1W14U 2B7DL 3BEFB 1Z7KA 3GOVB 2VWLA 2RFKC 3HS6A 4RRYA 5I46L 1ANEA 1D3DB 3UOUA 4CHAC 1C2DA 1DWDH 1MTNB 2JETC 5T6FA 3KL6B 1YPHC 2TIOA 1WCZA 1F2SE 1AZ8A 1K0HA 5L30L 1HFDA 1TOZA 5AFZH 4MPWA 4MMXB 3MU1A 4I7YH 1SOZA 2EA3A 4NG9L 3F1SB 1HJ8A 2PKAB 2R0LA 1YUGA 1S84A 4TPIZ 2BOXA 4AG1A 2FZZL 2JJLA 3BIVH 3ZVEA 1H1BA 3ZZ8A 2F9UA 2FOBA 4TWYA 3HATH 3SV7A 3UREA 4JZFH 1NZIA 3SV6A 4WMDA 3ODDA 1QZ8A 2F91A 3SGQE 2ZPSA 2Y80A 1J14A 2Q1JA 3EDXB 2BY8X 2CV3A 2V6NA 2KFWA 3BTDE 3TGIE 3PLKA 4CUDA 2W2QE 2ZDVH 2Z6BD 5FL7D 1DY9A 3SU4A 1RRKA 2VIDA 1C2FA 4A94C 2UWOB 1SOTA 1SFQB 3A7TA 5F53A 4DOQA 3ZVGA 2BQWA 4HG6A 1LO6A 4Y0YE 1JMOH 1EAXA 3LTGD 2VB0A 3KRKA 1HNEE 1FDPA 3BTTE 4X8VH 1DIYA 3RXAA 3U73A 1F7EA 2OINA 2HVYB 1EAIA 2OD3B 1NBMD 3HS5A 1XUKA 2BY6X 2GX4A 2BO2A 1RS0A 1CQQA 1O2YA 1S6LA 3PV2A 5JDUB 2A4QA 2V35A 3T29A 2FP7B 2G00L 4H6SB 2C8WB 3WWFA 3JZ2B 1MOXC 4WY3A 3RU4D 4AYVB 4MPXA 2BQWB 6CHAC 1AWHB 5C5NA 2WFTA 1O2MA 5CHAC 1BTPA 4FOUC 3FOAA 1EPIA 2UWPB 3E6PH 1GGDC 4NIXA 1YPMH 1LK9A 2BD9A 4X2VA 1V2OT 2H1UA 2ZC9H 1GDQA 1Y3XA 1SQRA 2Z3EA 1SPJA 3MU4A 3HKIB 4DGJA 3LC5A 5E8DA 4NZQA 1QBOA 1HCGA 4B2BA 3KEEA 4YOJA 4M11A 1SKYE 1A46H 2GCHF 2SGQE 2I9AA 2G4TA 4CH2B 1FMGA 1ADXA 3LPRA 4BTIB 1PQ7A 1EBVA 2Y82B 2BLVA 4KTSA 1NRPH 1Q2WA 9LPRA 4BAQB 4ZKNU 1FN6A 3RXQA 3AAVA 4I33A 1HAYB 2JH5D 1MKXK 4D8NA 2BOKA 3OYPA 4XBDA 5E2OA 1G1SA 3AASA 3QO6A 2XC0L 3SUFA 2BOHB 2ANKH 4P02A 5T6DA 4X6NA 4X1PU 1VITH 3FP8E 4JZIA 1O3KA 1ZHRA 1O36A 3B8JA 4X6PA 2AS9A 1PFXL 2VH6A 4UE7H 3EA9A 1GHBG 4R0IA 4A7IA 2IJOB 1BUIA 3LC3B 1T4UH 1MU6B 1E1QD 2AGIX 5CHAB 1MD7A 1SLVB 3T25A 3CNRA 1GBJA 3KGPA 2ILNA 3BPSE 2B8OH 1KMHB 1UHBA 2FLBL 2Q6GA 3OLUA 1GDNA 1IHTH 2A5AA 1PYTD 1ETRH 4D9QA 2VU8E 5EQQA 1O2WA 2YMSD 1GI8B 2Z9LA 1ELCA 3M3TA 4IMQA 3URCA 2XC0A 1HT8A 2CHAC 2B5TB 5FX6A 1EGFA 2Y5FA 8GCHG 1UTLM 1GBMA 1GJBB 3SI3H 1C9TA 1SGFG 2CMYA 2W7SA 3UR6A 2C8YB 1C1WH 4GCHG 4X1RU 2WYJB 2RA0L 4E05H 1RFNB 1IQML 4NFFA 4INKA 1UZJA 3V0XA 1TGCA 1GHBF 4YZUB 1O38A 3A7ZA 4KTCA 1C5PA 3LU9B 3MO6A 3ELAL 4Y11E 3DFLA 4B74A 4XDEA 3BIUH 5AHGH 3RXJA 4GU4A 1Y3WA 3RXIA 5FX5A 3SZNA 2AFQB 4GVUA 1BZXE 1LHCH 4JYVL 1P8VC 1UHBB 1ID5H 1C5VA 2ZHDA 4ZXYH 1YBWA 4BANB 1IGZA 3SUDA 3Q76A 1QBNA 3W1EA 1VGCB 2EI7B 2BD3A 5H4IB 1M1XB 1GWAA 4G1MB 3TNSA 2P95A 1IOXA 1DXPA 6COXA 5F1AA 3A8DA 1O2OA 2HNTC 2XBYA 3D62A 2BX3A 5K7RA 4DT4A 2ZDNA 2BVXH 2ESTE 3RXHA 1CT4E 3DSGA 2OTVA 1O5GH 1YM0A 1ESTA 1O2IA 1A0JA 1Z1IA 2OYEP 3CENL 2G81E 1CGIE 1HAGE 2DE8A 2JETB 5C67A 2VVUA 1PPCE 5IKTA 1NFXA 2QF5A 1AVGH 1P9SA 2FI3E 3V13A 3GCOA 1ZRBA 2UUFB 4AG2A 1EP6A 1ELVA 3SJIA 3ODFA 1C1TA 3SU5A 1TNHA 2QV1A 1LHGH 3ZYJB 1W0JD 2PKSC 4MNWA 1F5RA 3SW2B 3T28A 2ZDKA 3GICB 5LPEA 1O2ZA 4BAOB 1KYNA 2HWLB 1XUGA 2QF4A 1BBRH 3F2HA 1O5BB 2P59A 5CKNA 1E0FD 4Y71B 1V2VT 1O2PA 2ZI2H 1F92A 1YY3A 5C5OA 3SNBA 2KAIB 1V2JT 1LQDA 2ZCKP 2A5KA 1DOJA 3LH3A 1S83A 3PGHA 4XOJA 1NRRH 3T26A 4NSYA 1KXBA 1IGXA 1UCYE 1D3TB 2FZZA 2QN5T 1E36B 2H9TH 3PWCA 5DP3A 2J4IB 3MDLA 2SNWA 3MMGA 4JZEL 4AB8A 2PGQB 1S5SA 2BM2A 1BHXB 1Y3UA 2XBWL 1ZR0A 4BXWA 2BB4A 3N7OA 3UWIA 1ARBA 3VG8A 2Y5GA 3E1XB 3H09A 1JBUH 1DX5I 1H9LB 1ELFA 4RS0A 1WUNH 2C90B 4X8TH 1GBAA 1KLTA 2R9PA 1O2JA 4Q2KA 3CP7A 1H9IE 3BEIB 1ZPBA 1W10U 5K0HB 1BRBE 1PQ8A 1XVMA 2PLXA 1ATDA 3TU7H 1FPHH 1ESBA 3LJOA 4A5TS 4BDWA 2F9NA 4ABJA 3DHKH 2ZHFH 3PO1C 4XSKU 4B2AA 1BB0B 1NFWA 1FE2A 2XBVA 2UUYA 2GJGA 2J98A 5ESBA 5AVDA 1M9UA 2CJIB
chains in the Genus database with same CATH topology
3EQ0H 1NT0A 2Y81B 2Y38A 1PPFE 1T7CA 3GCTF 1MZDA 1LQEA 3SW2A 2BMGA 1TA2A 1MQ5L 1QB9A 1C5WB 4CRBA 4DCDA 1MTVA 1L1JA 1O35A 4Y8XA 2I6QA 1TBZH 4Z6AL 1P2MA 2OC0A 3R3GB 1NT1A 3SGAE 1GI5A 2O8WA 1BCUH 5JBCE 1SBWA 5GJ4B 4O02B 3M3SA 2HVXA 4THNH 1D6WA 1WTHD 5IKRA 1C9PA 1TRNA 2DE9A 3VEQB 4UD9H 3RMLH 4D7FA 1HT5A 2XRCA 2VIOA 4FUIA 3GISB 2BMGB 1E35B 2PW8H 4UEHH 2YNBA 2BY9X 3RLWH 5A09A 1O3FA 4X1SU 3RP2A 2F83A 1T8LA 3ZVCA 3MFJA 5L2ZL 2Y6TA 1YGCH 1ZYOA 1FJSA 1L1NA 3QWCH 1RD3B 3RXRA 4J1YA 1C2HA 1SMFE 4NSVA 1AKSA 2WPLS 1OP8A 3RXEA 1EZSC 1P05A 3NXPA 4X8SH 4ABEA 1GBFA 4ASHA 5F8XA 3VB7A 1CA0C 4UFEH 1TPSA 2TRMA 2W5EA 3GY3A 1C4U2 2P3UB 1ZRKA 1Y8TA 4YESB 1GI9B 3MWIU 2H9EL 2A32A 2F9OA 8ESTE 4J2YB 1ZTLA 1UK4A 1MD8A 5FXLA 2BD8A 1K22H 1SLXB 3S6XA 1NESE 4ZXXH 1Z6JH 5IDKA 1GHZA 1XKBC 1FIWA 4FVDA 2A7HA 4FM5A 1GJ8B 3HK6B 4JMYA 2I9BA 4GSOA 1C5YB 1HV7A 1CT2E 4JK5A 2J94A 1A5IA 2Z9IA 3U1JB 4XBBA 2VVUL 4U2WA 1BHXF 1OXGA 2A7CA 2R3YA 1CBWB 2RNLA 1VCPA 1X7AC 3OSYA 3UOPA 1C2MA 1PPBH 4BAKB 1DWCH 2BXTH 2J2UA 3SGBE 1O32A 2FYRA 1DANH 2QXJA 3LGTA 2UUKB 4Y7BB 4LMFA 2ZEBA 5EU8A 3STJA 3UFAA 2HALA 2BDCA 1EP5A 1GJDB 1GG6C 1AI8H 5EGMA 1TGBA 4CRCA 3MH7A 3A84A 4KELA 2P95L 1NROH 2FPZA 5TJXA 1EKBB 3W95A 3U7UG 2BD7A 3MNXA 3KQDL 1CSOE 1UVOA 5EXMA 1NU7B 1V2WT 2DUCA 4COXA 2R0KA 1B0FA 1O30A 3TGKE 5L2ZH 3AVZA 1CCVA 1TIOA 1AUTL 1O3LA 3S9BA 1HX2A 2ZU5A 1X7AL 3PYHA 4NA9L 2GZ8A 5E0GA 5FPSA 5F03A 5FPYA 2FOMB 1SFIA 1V2ST 2V3OH 4ZKSU 2P8OB 4YT6L 4E06H 5K0HA 4AFQA 1D3QB 3RXMA 5EQSA 3V7TA 2WPHS 4FUHA 4ISHH 4SGBE 4INLA 1V2KT 2BYAX 2Z7FE 2ZGXH 2PSYA 2GD4B 2C8XB 4BTUB 2J95B 1DM4B 1GJAB 2QIQA 1C5MF 1S81A 1O34A 5IKVA 2QA9E 2PUQL 3O8RA 1P3EA 4I8KA 2Q1JB 1GMCF 3A7YA 1OWIA 2I6SA 2Z9GA 3SV2H 3E3TA 3T62A 3UUZA 1AQ7A 5COXA 4JK6A 1FY5A 4F49A 2KB9A 4HI3A 4WH6A 3RXVA 1GVLA 3LT3A 2FLRH 3S9AA 1W7GH