3F1SB

Crystal structure of protein z complexed with protein z-dependent inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
259
Chain Sequence
NECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Protein Z-dependent protease inhibitor
publication title Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 259
sequence length 275
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3f1sB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB02
2EI7B 1T8LA 2A5KA 1GJ5H 3BTGE 3OX7U 1FI8A 3ENSB 1EPJA 2NWNA 1XXDA 4ABGA 1NZQH 1QQUA 4SGAE 4E7RG 1P57B 1FV9A 4MPVA 1C1SA 4UEHH 1P2IA 3TNSA 1EPTB 3LGUA 1NFYA 3BEIB 1SR5C 3RXBA 2VWLL 2KAIB 3E6PH 5K7RA 1OP2A 3A8CA 3C27B 1ATEA 1MCVA 2GT8A 1N8OC 1YPGH 4K8BA 4AG2A 4LZ1H 3RXQA 1KXCA 3TJVA 1GHAG 4X8UL 1P0SL 5DP9A 2VU8E 4K3JA 1YCPM 5ABWA 1HNEE 1WHEA 2G5VA 1OPHB 1Q2WA 3FZZA 4LK4A 2UWOB 1EZQA 1HAVB 3TNTA 2HLCA 4NA8A 2SGFE 5EG4A 2CMYA 4AORA 2Q1JA 2UUKB 3F6UL 1C2EA 2A5IA 1W7GH 2A0QB 4CRAA 4R8TB 5KIRA 1FIZA 1GI8B 1NESE 1EAIA 1K21H 4FM5A 1ZAQA 1DWCH 1EZSC 5DG6A 1L3YA 1W7XH 5JB8E 2WPHS 1OSSA 4I8GA 1P2KA 1YUKB 1IQFL 4XOJA 1SOTA 4D0EA 3KCGL 3AW0A 4NG9H 1AVWA 1V2PT 2TGAA 2UWLB 1RJXB 5JVZA 3BV9B 2ULLA 1O2SA 3L3TA 2ZFPH 1L4ZA 5HM9A 1KLTA 1BDAA 4TY7A 1O3AA 3Q3YA 1HJ7A 3A7VA 1FY1A 1PQAA 2FTLE 3SN8A 1KXFA 1ETTH 1SGQE 4M11A 3EA8A 4X1SU 1HZ8A 2A5AA 2V0BA 1LCYA 5JBTA 1S83A 3HK3B 5A8XA 5F03A 1ETSH 2M74A 2VH0A 1O3PB 3A83A 5BRRE 2P93A 2XC5A 4ABIA 4JK6A 2P3UA 1DQBA 1OWEA 3M3TA 5H4IB 1EMOA 3QZQA 1ELBA 2BDHA 3GCOA 4CRFA 2W26A 2QN5T 3SW2B 1TPSA 1IHSH 1NFWA 2XRCA 1BCUH 2BZ6H 5GWZA 2P93L 3TK9A 2XC5L 1THSH 3A86A 5CISA 4TGFA 4WXVA 5L30L 5C1UA 1N7DA 5C67A 2BDYA 3HK6B 4CUDA 2GDDA 1UVUH 4J1YA 1W8BL 1ELEE 6CHAB 3VXEH 1BTXA 1VITF 1BHXB 1UHBA 2AEIH 4WY3A 3T25A 2GCTC 1DE7H 1O2IA 1NRRH 1C1WH 2PW8H 2ZECA 4ISLA 1UVPA 1FMGA 2MGPA 3S7KB 2WFXB 1QQ4A 4IW4E 1AVGH 1CSOE 3KQCA 1MCTA 3MU1A 2A1DB 1GPZA 4PROA 1O3GA 3LTGD 1NFXA 4FUJA 5I25A 4K2YA 2FESH 1C4U2 3GY3A 3LONA 3SZNA 1ACBE 4J2YB 1GBAA 1HFDA 1E36B 3SU2A 1ZTLA 4GLYA 3PLPA 3GY5A 3B9FH 1O3CA 4Y6DB 3LN0A 1AE8H 2FOAA 2O9QA 3UR9A 3KQCL 1YC0A 1Q4GA 4CREA 1ZZZA 2BOHB 3GY8A 3ATWA 1HXEH 1A4WH 4NIWA 1EJMA 5A8YA 3HPTB 5T6GA 1PQ7A 3EE0B 3SUFA 4ZMAH 2P95L 1IOXA 8KME2 2BQ7A 1HRTH 3UPEA 1MTVA 3BEUA 2Y5HA 1RTFB 1ELAA 2FLRH 2J34A 1P2OA 4I8JA 3LOXA 1ZHRA 4O3UA 1V2OT 4XSKU 1KDQB 2ZHWH 4C16A 1DXPA 1CGHA 1O30A 4AFUA 4BTUA 1QFKH 1UMAH 1KTTB 3UUZA 2Y5HL 1RTKA 4OTYA 1J17T 4ISIH 1MQ5A 3MU8A 1AIXH 1KYNA 4JYUH 1SGFG 1UO6A 2YOLA 3A7YA 4XBCA 3RXKA 1YGCL 1G2MA 1YYY1 1K22H 1P05A 1Z6CA 4BAMB 4ZXYL 4H6SB 4INLA 1L5GB 3R05A 3M37A 2V3HH 1J9CH 2WINI 2ZCLP 5E8DA 3SORA 3EGFA 3GDSA 2VB0A 3CP7A 1TX6A 2OUAA 2HNTE 1BOQA 4X0WU 1IHTH 4XLWA 3KEEA 1ANBA 5E2PA 1UTKA 2CJIB 9ESTA 1YLDA 2QCYA 1TA6A 1TA2A 2DE9A 2BD9A 3SV6A 3M37L 5E2OA 4YESB 5ESBA 1BZXE 4CBOA 5TCAA 4M7GA 3LAQA 4X8SL 1O5DL 1C5UA 2J38A 2PGQB 1HDTH 1O3BA 2HVXA 1NFYB 2BY7X 3HATH 1EXFA 1KXEA 1XKBC 1BTHH 5DP4A 3RXPA 3SGBE 1SQTA 3SI3H 1P2QA 1GI5A 1Y3WA 3HGNA 4X6OA 4AN7A 1W13U 2LNCA 1CGJE 3SU4A 1P02A 4X8VL 1P06A 2RHPA 4SGBE 1GI6A 1XKAC 1LMJA 1APOA 3PMBB 4AFQA 4OTJA 3ZZ4A 1EZQB 2GX4A 2XWAA 4FUDA 2VIPA 4GCHG 1G2LA 4ZROA 2BLWA 2Q1JB 1QA7A 1W0YH 5F6MA 1DS2E 1TRYA 1FQ3A 3A82A 5JB9S 5HM2A 1SGTA 4D0FA 1AO5A 1K1OA 1EKBB 3N8YA 3RM0H 5F8ZA 1ATBA 3CS0A 2F9BL 3PTNA 1PGEA 1KY9A 1F5LA 1DIYA 3CFWA 2Z9GA 3EQ0H 1DVAH 4DCDA 2TGTA 1B7XB 3U8OH 1ATDA 1AFQB 3RXJA 4KKDA 1BTWA 1O39A 1UVOA 1HX2A 2CV3A 3E0NB 2QY0B 1O2NA 2A4GA 2DUCA 4Y7BA 1C5OH 1WBGB 2FOFA 3UFAA 3UNRA 5TCCA 2EC9H 1MAXA 3MO9A 1DXWA 2FIRH 1GBJA 1NS3A 1O2TA 1SLXB 3TK5A 1A5IA 1YPEH 1E35B 3SJ9A 1TYNA 3NXPA 1H1BA 2VH0B 2ZU4A 7GCHG 1H9LB 4NIVA 2PWXA 3QDZB 4IS5A 2P3UB 1G1RA 3SUEA 3MYWA 5EXLA 3DD2H 4UDWH 1IQKA 1F5RA 1PPGE 1VZQH 2F83A 2PKAA 1G3CA 4D7GA 5J4SA 1CGIE 5IKTA 4FXGH 3ZVCA 8GCHF 2R2WU 1IQLL 2W26B 4B2CA 4NIXA 1PXXA 3SJOA 2HNTF 1O5AB 4BDXA 1JRSA 2PLXA 3KQDL 1TX7A 3SNEA 3BIUH 4MNXA 5EGMA 1A5HA 4O02B 3SBKA 3K9XA 1O31A 4X8UH 1BF9A 1IJQA 3KK6A 1P0SH 2JETB 5JPMH 3S7HB 5C5OA 1FPHH 3OTJE 1C2JA 6GCHG 1O2JA 1UHBB 2D8WA 2Y82A 1NQLB 4G1MB 3TJUA 2QIQA 3SGQE 2FOEA 4MNWA 2G00A 4ISOA 1O38A 1G3BA 2PR3A 1NFXB 4OS5A 5KN5C 1OOKB 1SGNE 2ZP0H 1PFXL 3LDXH 1C1TA 1K1JA 1JBUL 3TH2H 1EAUA 2P3FL 2HGTH 1F0UA 4BNRA 3LJJA 4NSYA 1AFQC 3MNXA 3LTFB 2G00L 2J92A 1BUIA 2Y5GA 1DITH 2TPIZ 5FX6A 4XDEA 4MVNA 3V13A 2D2DA 4ABBA 3P8GA 1C2FA 1XVOA 4TYDA 1D3DB 2VH6A 5EQQA 1GJ4H 2BQ7B 1D4PB 1WQVH 3E3TA 1QL9A 1O2XA 2C8YB 2J34B 2Z3EA 3D23A 1OB1C 3MDLA 2QXGA 1LPKA 3TZIA 2ZTZA 4ABDA 2KL7A 3AASA 1UK2A 4D90A 1P2NA 2CXVA 1FY8E 1FAKL 4BTUB 5C1YA 2ZNKH 2ZFSA 3RXLA 4A1XA 3P95A 1O3EA 1GMDG 1GJ7B 3R0FA 1C2MA 3TGKE 1V2MT 2JETC 3STIA 3ZYGA 1IQJA 1WAYB 2H9EH 1BTPA 1P9UA 3I29A 2GD4A 2TGDA 2H5CA 3KQBA 3LGYA 3HO4A 1F5KU 5FPSA 2G51A 2OQUA 4GVUA 1C5PA 1G2MB 1JWTA 3QN7A 5AFZH 5L30H 2OLGA 4JYVL 5DP7A 3BTFE 3MO3A 3MNBA 4OS4A 1X7AC 1GHBG 4KGAA 1QIXB 1DDJA 1CQEA 1PPBH 5IKQA 4YZUA 1IQJL 2NPRA 3PGHA 2OYEP 2SFAA 2XW9A 3ZZDA 2BDAA 5C2ZA 2SNWA 3FFGA 4JZDH 3KQBL 3E90B 2BDCA 1A0LA 1FE2A 2QAAA 3CA7A 2XNIA 1ZHMA 1EPHA 2ANYA 3ASIA 1B0FA 1YPHE 1PYTC 2HPQH 2NU2E 3A81A 2VGCB 3PMJA 5T6FA 2FPZA 3VB7A 1EATA 1ANDA 1YCPH 2ZEBA 4K60A 5JYIA 1CA8B 3QGNB 3GISX 1BRUP 3TH3H 1LKBA 1HJAB 3RU4E 2WYGA 1DSTA 1S5SA 1UTQA 4QT8C 4MTBA 1GBEA 3RXEA 1A7SA 2IN2A 4NFFA 1IQML 3KL6A 2AIPA 1C2IA 3MMGA 1C5XB 3OLUA 1ELDE 2AMPA 3DFJA 3M5LA 5L2YH 3QUMP 5C1XA 2ILNA 1I0UA 3M35A 1SB1H 3A8AA 1QL7A 5E0JA 3SNBA 3UOPA 3K6ZA 1ZLRA 2PKSC 2XC0L 2Z9KA 1IGZA 1NC6A 3E1XB 1LVBA 1TLDA 4DG4A 1UVTH 1G2LB 1FJSA 2YGPA 1C1QA 2FLBL 4ZH8A 1GCDA 3HS6A 1GMHF 3ZZCA 3GDVA 1O34A 3VGCC 1C4Y2 1J8AA 1TPPA 4YT6L 4WMFA 2B5TB 4IC5A 4WMEA 2B0FA 4CBNA 2O8MA 3T62A 3P8NA 2OYUP 4ISNA 3KQEA 1MAYA 3H7OA 1EASA 1CE5A 4GUXA 1FJSL 1PPEE 2ESTE 2FX4A 2ZKSA 4IGDA 1IP0A 3LN1A 4ABFA 1Z1IA 3SU0A 4NFEA 1OP8A 3SV8A 3PROA 1C5RA 4B71A 2FZZA 4JZFL 2OXSA 4RRYA 2VGCC 1GJAB 2BTCE 4XBBA 3LGTA 2FOCA 3KQEL 4Y7BB 1TGSZ 4Q7XA 1W3CA 1HT5A 3FBYA 1HAXB 2P16L 4YTAA 3VPKA 1HT8A 3TK5B 4AFSA 3RXDA 1HJAC 5IDKA 1GK5A 2W2ME 1SGCA 5JW1A 1HAHH 4O03A 3N8WA 1GHYH 4Y7AA 4AB8A 3MNSA 1XUIA 1N8OB 1QJ1B 4THNH 4A7IA 4X8SH 6ESTA 4LMFA 1TMBH 2FZZL 2BZAA 2XBVL 4CHAB 4LORA 2STBE 1FUJA 1S6FA 5FXLA 1O3OA 1TQ7B 1JXPA 1AWFH 4Y71A 4X6NA 1AY6H 5JBCE 1DDXA 1HAGE 1SGFA 2OP9A 5EGMB 1HJ8A 2ZPQA 4I32A 3DT0H 5DKMA 4AGJA 1NM6A 3K9XB 1AUTC 2ZFRH 1Z6EA 2GDEH 1NRSH 2ZDMA 4YT7L 1SHHB 4D8NA 1IQGL 1GBFA 2ZHQH 3RXOA 3UQOA 3A8BA 1O3MA 1GMCF 2Y82B 5DPAA 2FI5E 2QF3A 4VGCC 1OX1A 1C2GA 2XCFA 4CRDA 2Y7ZA 2PR3B 1FLEE 2WPLS 3RXHA 3RXMA 1ANCA 1KSNA 4TWWA 2BD5A 1Z6EL 3W95A 1ZSKA 3ATKA 3RM2H 1Z8GA 2VWLA 3UREA 3PYHA 4IN1A 2THFB 4RKOB 2Y7XA 3PTBA 2VWMK 3V0XA 4JCNA 2CF9H 1TGTA 4K1TA 1RIWB 1MOXC 2SGDE 1FXYA 5IKVA 4CR9A 1K37A 2ZDNA 1O2KA 1TQ0B 3ZYEA 1K9OE 2WYJA 2VWOL 4IMZA 2VH6B 2W3IA 1UTMA 2BLOA 2A31A 4ZXXL 1ABIH 2W86A 1J15A 1CHOF 3ATMA 1C1NA 2IPHA 1LPKB 2BY9X 2B8OH 4CHAC 4NGAH 3RXAA 3TJNA 1QHRB 4H6TA 1A3BH 2WPIE 3PWCA 4I31A 4INHA 1C2DA 1MTNB 1O5FH 1O5GH 2P59A 1MZAA 2PTNA 1EBVA 1C5QA 1ZYOA 3QWCH 2FOBA 1IQFA 4Z6AL 3TGIE 4CR5A 4UE7H 4Y8XA 5C5NA 4E06H 4HI3A 1XUGA 2FO9A 2VVUL 1QY6A 2GCTB 2AFQB 2C93B 2ZI2H 1PFXC 1K36A 5JBBE 1O3DA 2F9OA 2GD4B 4NA9L 1G30B 1YPHC 2STAE 2PV9B 4AFZA 1FFMA 1KLIL 2HWLB 1C1MA 2K1QA 1C1UH 3M5MA 1P01A 4YOIA 1HRFA 1O3NA 2ZGBH 1MKWK 1V2LT 4YZUB 1A0JA 1ZGVA 3IG6B 3ELAH 3U7UG 4GHQA 4LXBH 1SFQB 4RRWA 4RUTA 1EJNA 3W94A 1DLEA 2A2QH 3EGKH 2J94A 3O8RA 1GGDC 1E34B 3D62A 3P8FA 1EMNA 5IYTA 1O2YA 1RIWC 3BF6H 3RXRA 2ZHEH 2B7DL 4A92A 4DJZB 5T3HA 2Y81A 4IC6A 3U9AH 2OTVA 1RFNA 3NJPC 2GTBA 1XUFA 3PB1E 3T29A 1N1LA 1O37A 3SJKA 2WYGB 2UUFB 1GI1A 4RRXA 1NY22 3TBDA 2WPMS 1GJCB 5HXFA 1DX5I 3KL6B 1TNIA 1WV7H 1UJ1A 1SOZA 3GCXE 1T4UH 2PUQH 2ZFQH 1UTNA 4X1PU 4Y79A 1MTNC 3BTDE 2BXTH 2NU1E 4HTCH 2HALA 3GCNA 1BTUA 1TBRH 1ETRH 1ZTKA 3LH1A 1BHXF 3PLKA 1C1VH 1QRZA 1SQOA 1G1QA 2FXRA 1FAKH 2BD8A 2DDUA 4ZH8B 1V2ST 3TH4H 1GHWH 1O2RA 4X2VA 3A85A 5EPYA 2BQWA 3V64C 3O8CA 1P03A 2O8TA 2EEKA 2P95A 3LPRA 4FVBA 1YF4A 3ATIA 2HOBA 2BYAX 4WVPE 3T5FH 3KRKA 1EJAA 1K1NA 2G4TA 1A3EH 1Y59T 1M1XB 4X2XA 1A61H 4DVAU 1VITG 4Q2KA 2QXIA 1AZZA 1BRCE 3G01A 3FAOA 1WHFA 1CA0B 2WPHE 1KLJH 3UR6A 3BT1A 3MH6A 2GKVE 4E05H 1P04A 4KTCA 3IITA 2FOHA 3ITIA 1QJ6B 2BX4A 3TK6B 2I9AA 3A87A 5L2ZL 1IAUA 3TGFA 4O1ZA 1QB9A 1V2QT 2TRMA 3NTGA 4DURA 3N8WB 4Y7AB 2UUYA 3WY8A 4BXSA 3RDZA 4A7IB 4NZQA 1QBOA 4Z0KA 1TPAE 3PO1C 1EQ9A 2TBSA 3VEQB 3LIWA 1GHVH 5EOKA 4BOHA 2O8LA 3C1KA 4Y71B 4HZHA 1HUTH 1F0TA 1ZJDA 1G3DA 3QK1A 4RN6A 2XCNA 1YPMH 5E8EH 4O97A 2R0LA 1XMNB 1Z7KA 1C5TA 3Q7DA 5A2MH 1J16A 2A4OA 3VXFH 2WPME 1VCWA 4Q80A 3VFEA 1OXGA 1RTLA 1GI9B 4ASHA 1EQHA 1LTOA 1ESBA 1O2VA 1WYKA 4UONA 1HLTH 1C5LH 1MD8A 2F9NA 3E0PB 1GI0A 2BD2A 5LH8A 2JH0D 4NWLA 1WTHD 1YUGA 2C8XB 3MH7A 1B5GH 2SGQE 2ZGXH 1O2WA 5I46L 2Y7ZB 2YNBA 1FPCH 5AVDA 1XXFA 2PFEA 1PPFE 1ARBA 1UCYK 2SGAA 3E8LA 1EP5A 1F0RA 1T31A 2VWMA 2GV6A 3LC5A 2ZO3H 2Z94A 1NFUA 3GY6A 2FOMB 2AH4X 4MNYA 2Y7XB 2NU4E 2PHBA 3GDUA 2ODPA 3HKIB 4B76A 2BMGA 3OU0A 1CA0C 1DX5M 3F9GA 3KHVA 1PRHA 1OS8A 2BDBA 2Y38A 2FM2A 3SV9A 1HCGA 1GJ6A 5AFYH 3FZDA 1QBVH 2W2OE 2WYJB 3SNAA 2W3IB 1JMOH 1CVWL 3MO6A 1TMTH 2BHGA 2WUCA 1HGTH 1GJBB 2BVSH 4CRGA 5DP8A 2YGOA 1MBMA 4U30A 1DFPA 2BDGA 1SGPE 4BAKB 1O2OA 3MQEA 3A7TA 1L4DA 3ZVAA 1SG8B 3SUGA 4GPGA 2ZWLH 4GCHF 1DWDH 3RXVA 1ZOMA 4DOQA 1PPCE 2BXUH 1IOEA 1GG6C 2ZU2A 3BG8A 1OWHA 4NIYA 4X6MA 3RP2A 1T8OA 2QXJA 3VB3A 1T8MA 3RLWH 4MPXA 4WXIA 3EDXB 2Q6FA 2JKHL 2P28B 4RSPA 1RRKA 4MMYB 3Q76A 2PGBB 4CH8B 4GHTA 2BOKL 3U8RH 2O8WA 1LMWB 1F92A 1GDQA 1IOEL 4CUFA 4RS0A 4JZEL 4Y76A 2WG3C 5F8XA 1APQA 4ISHL 1KXBA 3VB5A 2BY6X 5G4BA 2A4RA 1VCQA 3AAUA 1JL9A 2J94B 1C2HA 3UY9A 1JV2B 2QYIA 3MI4A 3RMOH 1SQAA 1HAFA 1AD8H 1TALA 1IQLA 2XWBI 3TU7H 1MQ6A 4DY7B 1ZGIA 1UTLM 1GCTB 1AE5A 3SQEE 4ZHMU 4AQTA 1VGCB 2Y81B 3ZYJB 1RS0A 2QC2A 3KQDA 3P6ZB 1Q3XA 1RFNB 1Z8IB 2ZC9H 4OS2A 3SOBB 4NSVA 2FYQA 1H9HE 3HO5A 3UWJH 4FUHA 1Y3XA 1AZ8A 1SL3A 1UZPA 2ZU5A 4X2YA 2AGIX 1SMFE 2VJ3A 3TLOA 3Q3KA 2G55A 1MQ6L 3BTHE 4ABHA 1NFWB 1YBWA 1Z1JA 3DA9B 2AERH 4Y79B 3M7QA 4LZ4B 2NU0E 6GCHF 4ZKRU 1FY4A 2I6QA 2F3CE 4BAOB 3RXFA 3S69A 3OY6U 1F0SA 1JRTA 2K2TA 5FDQA 3N8XA 1DT2A 2A4QA 3KNXA 1XX9A 2BDIA 1SGEE 3SU1A 1C5VA 3B8JA 3M7UA 2GV7A 3RXCA 4Z6AH 1P9SA 2ANWA 3F6UH 2KB9A 1GI3A 3UOUA 8GCHG 1THPB 1D9IA 2BQWB 1FAXL 3QMOA 4NA9H 4CRCA 3ESTA 3Q3XA 3SJIA 1PQ5A 1H8DH 4MDSA 3GYLB 1IQHL 4NG9L 1CU1A 5F1AA 1Y8TA 5JB9E 4DW2U 3KCGH 1A0HB 4PH9A 1C5MD 1DY8A 1C4V2 2ZFTA 3GYMA 2BY5X 3BTTE 2VVCK 1AKSA 1K1LA 1O32A 1WQSA 1YPKH 5GDSH 3SOVA 1TGNA 3GCTF 3N8ZA 4BTTA 3A7ZA 2P94A 1GCTC 3OYPA 3FVFB 3IITB 4X2WA 5F8TA 1VGCC 1Z8RA 1BQYA 3BG4B 4WWYA 1LO6A 1GBTA 1P10A 1N1IA 1C9PA 2ZCKP 2H1UA 2ZPSA 1JIMA 4XFQA 2FX6A 2J9NA 1C1RA 4JYTA 4D9QA 1HREA 1LKAA 1EPTA 1FONA 4Z0KB 2G4UA 1FF7A 1GL1A 1KIGL 2ZDLA 4OS6A 2XXLA 2P94L 2TGFA 3LIWB 3P70B 4DIIH 2PKSB 2TGPZ 2XC4A 2IJOB 3EA7A 4NWKA 1T7CA 2CGAA 1CEJA 3P92A 1ZMLA 1RGQA 2EI8A 4H4FA 1WSSH 1T8NA 3T26A 2ZQ1A 3QH0A 5DP6A 1U8CB 2A7JA 3VGCB 5HGGA 1GHBF 1TFXA 2ANKH 1O2GH 3M5OA 3ODFA 4I33A 3SHCH 8LPRA 2EA3A 1UTOA 1URKA 1O0DH 4UFEH 2BLVA 3P8OA 3MU4A 1C5MF 1W8BH 2XC4L 5FBEA 1GL0E 2R9PA 1GBCA 1VJ9U 1IQNA 1S81A 3FCSB 5DK1A 4U32A 2PTCE 3DUXH 1C9TA 1YLCA 1DOJA 1EZUC 1W2KH 1AGJA 2DE8A 2FLGA 1ZRKA 4UFDH 1RD3B 4Z0LA 2H2ZA 2HRVA 1F0RB 4Y8ZA 3U69H 3LC5B 3LJOA 1Y5UT 1NFUB 1OP0A 1IQMA 2ALPA 2D26C 1PPHE 2W5EA 2PHBB 2SGPE 1IQNL 2H6MA 1TBQH 2ZZUH 1NTPA 4E7NA 2BMGB 4ZKOU 5C20A 1D3QB 2J38B 1O3FA 1G3EA 1HCGB 1MUEB 4AGKA 2PUXB 3DEMA 3BG4C 4WJG2 2XC0A 3ZYDA 3UNQA 4DT7B 2ASUB 3IJEB 1MTUA 3M7TA 1AHTH 4IMQA 2FLRL 1MU8B 1TIOA 1C1PA 6COXA 4MNVA 1HB0B 2OBOA 2ZU1A 3PMAB 1AMHA 1EGFA 4D7FA 1EP6A 1V6DA 2OCVB 1ZMNA 1NT0A 5JBAS 5LPFA 2GZ7A 1QFKL 1ELGA 1G1SA 3SV7A 1C5YB 2WG4B 4COXA 3TJOA 4XL1A 1Z71A 2QF0A 1CX2A 2WFTA 1ZJKA 2XBYA 3LC3A 1Z6JH 3A8DA 3CENL 2W2NE 3KIDU 2XBXL 4GAWA 3BTQE 4VGCB 1OKXA 1V2TT 2AYWA 3P17H 2NU3E 4ZHLU 2FS8A 3V12A 2JH6D 1N6YA 4AYYB 1QRWA 3PM3A 3N8YB 4ZHAA 4H42U 1YGCH 4KTSA 3D65E 2A7CA 3RC4A 1TRNA 3QTVH 4ZXYH 2H5DA 1EB1H 2P16A 2GZ8A 1O3KA 2XBYL 3VB6A 2UUJB 3HO3A 1ARCA 1QTFA 3T2NA 5I46H 2FWWA 1S6HA 4JZ1A 5BPEA 4TY6A 3RU4D 2XBVA 1E37B 4XBDA 1N6XA 4F49A 2P26A 1GMHG 1TRMA 2VIOA 4UD9H 5CKMA 2F91A 1QRXA 1FIWA 3SU6A 1QJ7B 4AOQA 5FAHA 1BBRE 1AN1E 1GJ8B 3T27A 3MH4A 3ZZ6A 1M9UA 1UCYE 1TNGA 1C5ZB 2BO2A 2ZIQH 1LPGA 2BB4A 3S0NA 1O5DH 1GBMA 1O5CB 3MHWU 4RRZA 1TBZH 1IQGA 2PKAB 2J95A 3A88A 4Y8YA 5CKNA 1OWKA 2Y5FA 2ZU3A 1L1JA 1UVSH 3SU3A 1ID5H 1MKXK 3Q3KB 1WCZA 1BTZA 1MZDA 2AYLA 3U1JB 8ESTE 3M36A 1EOJA 4A5TS 4TWYA 2XBWL 1MTWA 3U98H 3R3GB 1HXFH 1HAPH 2TIOA 4X8VH 4Y11E 1XVMA 2VVVA 5LPRA 1F0SB 2Y5FL 3RC5A 1KXAA 3FP7E 4E1GA 1QA0A 3BPSE 1NU9A 1GJDB 1C5NH 1LQEA 4JK5A 4U2WA 3EYDA 5GCHF 3OLTA 3M36L 1L1NA 1XUJA 2A45B 4K69A 3ZV9A 1UZKA 4NCYA 2C8ZB 5DO4H 1U6QA 4U01A 2ZDAH 5K0HA 2VWOA 4Y10E 2VVVL 1GBLA 1BB0B 4FVDA 5A09A 1O3LA 2F9BH 2VVCA 2Z9IA 4BAQB 1GGDB 1DVAL 3QCWA 1CT0E 1MMJN 1Y3VA 3KN2A 4I8LA 1TGCA 2AIQA 1BJUA 1ZMJA 4ISHH 1AKSB 1TNJA 1SLUB 5ETXA 3RU4T 1ZHPA 3RXUA 4BTTB 1BA8B 3EAJA 4CRBA 3UQVA 1GHAF 2Y6TA 2GCHG 1MKWH 5GXPA 4AYVB 1QURH 1C5SA 4Y0YE 4YM9A 2VVUA 5EU8A 3MNCA 1K1MA 1O2HA 1BMAA 3DFLA 4D76A 2UWPA 3Q77A 3U8TH 4INKA 4D9RA 9LPRA 1J14A 1TNKA 3K65B 1W10U 2EI6A 1SGDE 1G36A 1F7ZA 1TMUH 2AMQA 4JMYA 2B9LA 2VIVA 3OY5U 3RR3A 2H9TH 2OC8A 5E0GA 4DIHH 3E91A 1GVZA 1O36A 3LKWA 2W7SA 1IQIA 1O2ZA 1XUHA 3F9HA 2EI8B 1FNIA 5CKQA 4X8TL 5JVYA 3MU0A 2Z3DA 1EZXC 1MTSA 1W12U 1CHOG 1EX3A 2H9HA 5CHAC 2XYAA 5FPYA 4FUEA 2GZ9A 1IQIL 3PMHB 2D1JA 2V6NA 1YO8A 3T28A 4A6LA 4GSOA 5HMAA 2BY8X 1CT2E 5CMXH 1DWBH 1SPJA 1BRAA 2A7HA 1HJ9A 4YLUA 1V2NT 1QB6A 2WPJS 2BM2A 1DSUA 1JBUH 2F9VA 2FI4E 3O8BA 2R0KA 2G5NA 2R3YA 4O9VA 4OS1A 1Y3YA 5EXMA 2WPLE 2P3FH 1GBIA 3GY4A 3ZVFA 2ZHDA 4ZUHA 3ZZ9A 3PV4A 4M10A 1YKTA 5FX5A 1ELCA 1QL8A 1O2PA 1DLKB 1C1OA 1TOZA 1O35A 1QNJA 1A5GH 1OYQA 3V7TA 3PO1B 1GI4A 1LVMA 3ATLA 4K5ZA 3SU5A 2W2QE 3SOSA 4FUCA 1EPTC 4ABJA 5PTPA 1QBNA 2ZF0H 3F9EA 4MMXB 2MHPA 1CQQA 3AVZA 4WH6A 1SGRE 1GI7B 1Q31A 1KIGH 5GPIB 1ORFA 1BJVA 1V2RT 1F2SE 5DJ7A 4AZ2B 2GMTB 3Q00A 5FBIA 2QXHA 3LC3B 1DWEH 1G37A 2H9EL 1GBHA 1JOUB 3VB4A 4ESTE 4BXWA 2G52A 1UTPA 4AG1A 3NK8A 3ZVDA 5B6OA 4HGCA 1O3HA 2P3TA 1E0FD 2C8WB 1L0ZA 2P8OB 4BDWA 4YOJA 1QGFA 4ZHAB 4BANB 3BIVH 1DM4B 1ANEA 5J4QA 4JYVH 1GHXH 1BTYA 3ZYIB 2ZGCA 1QCPA 1P12E 4OS7A 1UTJA 5GJ4B 4JZDL 1O3JA 5DP3A 1GBDA 3BTWE 1FSBA 3H5CB 5F19A 2BQ6A 2OC0A 1BBRH 3MH5A 1ADXA 5AF9H 1UCYH 2ZDKA 1SLVB 3TH3L 2W3KA 4AB9A 1MBQA 3MTYA 1YUFA 1X7AL 1LPGB 4FUBA 1NO9H 2G81E 2VIDA 2WPJE 2JH5D 4RKJB 5DGJA 3ZZBA 1L1GA 5SGAE 3M61U 2J95B 5CE1A 3C9AC 1DY9A 1P11E 3HKJB 1QB1A 5L2YL 7ESTE 1AFEH 1GG6B 4ZAEA 1GJ9B 1CT4E 2BX3A 2ZPRA 1TPOA 3LGIA 2Y80A 4IBLH 3URDA 3N8VA 1S0RA 4A1VA 3SUDA 3BT2A 2GMTC 1Y5BT 3RXGA 1OWIA 1FN8A 3SQHE 4BTIA 3JZ1B 3A7WA 1MU6B 1YPJH 4K1SA 2FLBH 1NPMA 2P8OC 2WUBA 1LVOA 1BBRK 3V3MA 1KSNB 2BD4A 4CUEA 3BTKE 4FU7A 1FN6A 4YT6H 3SJ8A 6CHAC 3RMNH 4B73A 2BLQA 5K0HB 3OSYA 1W14U 2PSYA 1NZIA 3K6YA 2ZFFH 1P3EA 2SGEE 1OWDA 1UZQA 1BRBE 2OD3B 3ZZAA 4FU8A 1MH0A 2ALVA 3F9FA 2ZGHA 3LT3A 2Q6GA 1MQ5L 1THRH 1CCFA 1VR1H 3UTUH 1HPGA 2OC1A 1W11U 1Z8JB 4JZFH 4MPWA 5C3NA 1TNHA 2BVXH 2GP9B 3KF2A 2F9PA 2ZG0H 1XUKA 4TPYA 1A2CH 3SGAE 1EUFA 4UFFH 2FEQH 1TPGA 1BMMH 4HFPB 1NU7B 3H7TA 1D3PB 1G32B 1VITH 1ESTA 3M3VA 1O2MA 2C4FH 2JKHA 4CSYA 2UWPB 1AU8A 2BOKA 1ELVA 1EOLA 2EI6B 1ABJH 2VJ1A 2BD7A 4B2BA 1K28D 1NPEB 3UIRA 1EAXA 3A84A 3MOCA 5A0BA 2WV5A 1S0QA 3U73A 4MQAA 3RXSA 1S84A 1UZJA 2RCEA 1LHCH 1O5BB 3BSQA 3UNSA 1V2KT 4B1TA 2FDAA 5A0CA 1ZR0A 1Y5AT 1LQDA 2W7UA 1F7EA 4YT7H 1SGIB 3O8DA 1HIAA 2QV1A 1BMLA 1SVPA 1ELFA 1UK4A 1XDTR 2W2PE 1LHFH 1EQGA 3QLPH 3RMMH 1YP9A 1O2QA 4X6PA 2Z6BD 4LOYH 1GDUA 2D1JB 3GICB 1B0EA 2F9UA 1AI8H 4B2AA 3UWIA 1ZRBA 1GHZA 2C3SA 1V2VT 1LHGH 2WV4A 2GGVB 2R2MB 1SC8U 3SO3A 7GCHF 1AUTL 3QX5H 1O2LA 5A0AE 1P2MA 1HV7A 1HBTH 3P5BL 4F4OC 2RA3A 4AX9H 2PSXA 1TB6H 1PYTD 2BD3A 3E16B 4KTUA 4ABAA 4TPIZ 2VNTA 1C2KA 3RUOA 3NT1A 2GT7A 2J2UA 2ZQ2A 5DP5A 2K2SB 1A46H 1NT1A 1SSXA 4ZKNU 1C5WB 1O33A 2ZGJA 4ZKSU 1AWHB 2FI3E 2BOXA 2ZTYA 1V2JT 5FPTA 1OYTH 4ZXXH 4NGAL 4CH2B 3A80A 1ZTJA 5HYOA 1P9JA 1SBWA 1KTSB 1TNLA 2FOGA 3NKKA 3D49H 3L6PA 2V3OH 2MGRA 1FAXA 1E38B 3GY2A 3ZZ5A 4XBMA 1A3PA 3PWBA 3ZZ7A 1ELTA 3FANA 5EQSA 1QR3E 3BEFB 1IQHA 1WOFA 1HAOH 3ODDA 3URCA 1U67A 3EA9A 2ZA5A 1SFIA 3M5NA 4IN2A 1HAZB 2P3TB 2XTTB 3NPSA 1W7XL 1LPZA 4X8TH 1LVYA 1Y3UA 1IQKL 3TITA 4JZIA 3I78A 1KLIH 2I6SA 1DPOA 1V3XA 4UFGH 3QTOH 2P3FN 2RDLA 4O3TA 3GCWE 2A32A 2OQ5A 2ZTXA 3ELAL 1EAIC 1TONA 4K1EA 2FD6A 1BT7A 2CF8H 1TABE 3NTBA 1WU1A 3L33A 3ZVGA 3A7XA 3AW1A 3GCHB 2J4IA 3CS7A 1IGXA 5TJXA 6LPRA 1UK3A 2ZDVH 2EI7A 2VWNA 3S9AA 2BQ6B 1ESAA 3ENSA 1INCA 1A1RA 2ODYB 2WPKS 5EODA 5JDUB 2B7DH 3IWMA 1TX8A 2W3KB 4YO9A 2VIWA 7LPRA 3B23B 3GOVB 1H9IE 4FUGA 4Q7ZA 5FHTA 3CS7L 2A2XH 1SZBA 1GMDF 4Y0ZE 2KAIA 3NWUA 4XE4A 1C2LA 3LH3A 2VWNL 2PUQL 3GCTG 1P09A 3ZZ3A 2BZ6L 2FP7B 1T4VH 3NZIA 2QA9E 4I8HA 1ZPCA 1AUJA 4ZAEB 4YOGA 2Y5GL 1JIRA 5A8ZA 1BIOA 2AGGX 1GWAA 2Y80B 4MMZB 3RLYH 2G8TA 4A1TA 3SOQA 2UWOA 4BTIB 1HAVA 1NRPH 2HNTC 1P3CA 1ZSLA 3BTME 2R3UA 1ZPBA 1TOCB 1GVKB 3RMLH 2Z7FE 1P8VC 1WUNH 3M3SA 2CHAB 2AS9A 5EW1H 2AMDA 1CCVA 1BITA 3GCHC 1P2JA 4FU9A 2FTMA 1CVUA 1SI5H 1ZSJA 1DANH 2UWLA 4YLQH 3GY7A 3QGJA 1EPIA 1SLWB 2OC7A 2RNLA 2HPPH 1KLJL 3N7OA 3U1IB 1K1IA 4FUFA 1RXPA 1YM0A 2Q6DA 5EXNA 1TWXB 5LPEA 2Z9LA 2AGEX 2C90B 5EW2H 1SGYE 1CHGA 1CO7E 2M5TA 3HS7A 5L6NH 1EAWA 1O3IA 5L2ZH 3CENA 1EPGA 2VIQA 2XBXA 3NUMA 1VCPA 3FP8E 1F7MA 1D6RA 1NN6A 5EQRA 4MLFB 1TOMH 4B75A 5JBCS 3S9BA 3FFGL 1HAIH 3RXTA 1GVLA 1LHDH 1WTGH 1EB2A 1H4WA 3DHKH 4OGYA 2BVRH 1GI2A 2ADXA 2WPKE 1PPZA 1OWJA 2FS9A 4ISIL 3HS5A 3SW2A 1FZZA 4X1QU 2RG3A 2LPRA 1AB9B 3SI4H 4JYUL 1NRNH 3LGWA 2SNVA 1AVXA 4I8KA 4NZLA 1MKXH 1KXDA 1LQDB 1HYLA 3RXIA 1NRQH 3F68H 1HIAB 1TLEA 2IOTA 1IQEA 3ZVBA 3ZVEA 1J9CL 3POYA 2FMJA 2BOUA 5ESTE 3S9CA 3FP6E 2RA0A 4KP0A 4Y76B 3I77A 1COUA 1G1TA 5COXA 3TIUA 3LU9B 1V2WT 1FY3A 4NA7A 1XFEA 4MG3A 2Z9JA 1PTHA 4BAHB 3TVJB 1K1PA 2V35A 2CHAC 1DICA 1YCPK 4Q7YA 4FUIA 1VJAU 5IKRA 1TE0A 1CBWB 2CN0H 1IQEL 3HGPA 1ATAA 3SNCA 5LGOA 3TPIZ 4ABEA 2RA0L 1GBKA 5FCRA 4Y6DA 1PQ8A 1NROH 1O5EH 1S82A 1D6WA 3ZZ8A 2XBWA 2BOHA 2VINA 1TGBA 2O8UA 2J2UB 3K2UA 2ANMH 5E0HA 3HPTA 1TAWA 3SHAH 2Z3CA 3F1SB 2WPIS 3BTEE 2ODQA 2OBQA 1CVWH 5GIBA 3NCLA 1L2EA 3TK6A 5FCKA 1H8IH 3BN9A 4WMDA 1XKBA 4DGJA 3QZRA 1HAYB 4WH8A 3SNDA 2FYRA 3QO6A 3JZ2B 2ZCHP 3A89A 1LDTT 1KDQA 1MD7A 2ZHFH 1B9WA 2GVFA 4MPUA 1LHEH 1G9IE 5JBBS 1YPLH 3ZV8A 2QGRA 4X1NU 5EPNA 2YNAA 1AB9C 3STJA 5CHAB 1SHYA 3LGVA 5JB8S 1W0ZU 1GBBA 1FDPA 1DUEA 5T6DA 5JBAE 1PJPA 3MFJA 1S85A 5AHGH 1HAEA 3TGJE 2OINA 1BMNH 3GISB 1LPZB 3V65B 1XM1A 1KLOA 3PLBA 1AQ7A 7KMEH 1IVOC 4I7YH 1DUAA 3AAVA 2FODA 1FY5A 1O2UA 1GDNA 4KELA 1V3XB 3MWIU 1D3TB 1XKAL 3RC6A 4JZEH 4WF8A 4B74A 1WU1B 1V2UT 3KGPA 3MU5A 1GMCG 1CBWC 2I9BA 2GCHF 1T32A 1K2I1 4R0IA 2J4IB 3SV2H 4OGXA 2KV4A 1ZPZA 2CJIA 4X1RU 5GCHG 4K8YA
chains in the Genus database with same CATH superfamily
2EI7B 1T8LA 2A5KA 1GJ5H 3BTGE 3OX7U 1FI8A 3ENSB 1EPJA 2NWNA 1XXDA 3N7EA 4ABGA 1NZQH 1QQUA 4SGAE 4E7RG 1P57B 1FV9A 4MPVA 1C1SA 4UEHH 1P2IA 2QF5A 3TNSA 1EPTB 3LGUA 1NFYA 3BEIB 1SR5C 3RXBA 2VWLL 2KAIB 3E6PH 5K7RA 1OP2A 3A8CA 3C27B 1ATEA 1MCVA 2GT8A 1N8OC 2WZPP 1YPGH 4K8BA 4AG2A 4LZ1H 5HKKD 3RXQA 1KXCA 3TJVA 1GHAG 4X8UL 1P0SL 5DP9A 2VU8E 4K3JA 1YCPM 5ABWA 1HNEE 1WHEA 2G5VA 1OPHB 1Q2WA 3FZZA 4LK4A 2UWOB 1EZQA 1HAVB 3TNTA 2HLCA 4A94C 4NA8A 2SGFE 5EG4A 2CMYA 4AORA 2Q1JA 2UUKB 3F6UL 1C2EA 2A5IA 1W7GH 2A0QB 4CRAA 4R8TB 5KIRA 1FIZA 1GI8B 1NESE 1EAIA 1K21H 4FM5A 1ZAQA 1DWCH 1EZSC 5DG6A 1L3YA 1W7XH 3MQKC 5JB8E 2WPHS 1OSSA 4I8GA 1P2KA 1YUKB 1IQFL 4XOJA 1SOTA 4D0EA 3KCGL 3AW0A 4NG9H 1AVWA 1V2PT 2TGAA 2UWLB 1RJXB 5JVZA 3BV9B 2ULLA 1O2SA 3L3TA 2ZFPH 1L4ZA 5HM9A 1KLTA 1BDAA 4TY7A 1O3AA 3Q3YA 1HJ7A 3A7VA 1FY1A 1PQAA 2FTLE 3SN8A 1KXFA 1ETTH 1SGQE 4M11A 3EA8A 4X1SU 1HZ8A 2A5AA 2V0BA 1LCYA 5JBTA 1S83A 3HK3B 5A8XA 5F03A 1ETSH 2M74A 2YGQA 2VH0A 5GNDA 1O3PB 3A83A 5BRRE 2P93A 2XC5A 4ABIA 4JK6A 2P3UA 1DQBA 1OWEA 3M3TA 5H4IB 1EMOA 3QZQA 1ELBA 2BDHA 3GCOA 4RT1A 2KCYA 4CRFA 2W26A 2QN5T 3SW2B 1TPSA 1IHSH 1NFWA 2XRCA 1BCUH 2BZ6H 5GWZA 2P93L 3TK9A 2XC5L 1THSH 3A86A 5CISA 4TGFA 4WXVA 5L30L 5C1UA 1N7DA 5C67A 2BDYA 3HK6B 4CUDA 2GDDA 1UVUH 4J1YA 1W8BL 1ELEE 6CHAB 3VXEH 1BTXA 2GJGA 1VITF 5CDFE 1BHXB 1UHBA 2AEIH 2JIZD 4WY3A 2GCTC 1DE7H 1O2IA 1NRRH 1C1WH 2PW8H 2ZECA 4ISLA 1UVPA 1FMGA 2MGPA 3S7KB 2WFXB 3S6XA 1QQ4A 4IW4E 1AVGH 1CSOE 3KQCA 1MCTA 2YMSB 3MU1A 2A1DB 1GPZA 4PROA 1O3GA 3LTGD 1NFXA 4FUJA 5I25A 4K2YA 2FESH 1C4U2 3GY3A 3LONA 3SZNA 1COWD 1ACBE 4J2YB 1GBAA 1V1IA 1HFDA 1E36B 3SU2A 1ZTLA 4GLYA 3PLPA 3GY5A 3B9FH 1O3CA 4Y6DB 3LN0A 1LK9A 1AE8H 2FOAA 2O9QA 3UR9A 3KQCL 1YC0A 1Q4GA 4CREA 1ZZZA 2BOHB 3FO8D 3GY8A 3ATWA 1HXEH 2W6JD 1A4WH 4NIWA 1EJMA 5A8YA 3HPTB 5T6GA 1PQ7A 3EE0B 3SUFA 4ZMAH 2P95L 1IOXA 8KME2 2BQ7A 1HRTH 3UPEA 1MTVA 3BEUA 2Y5HA 2K0QA 1RTFB 1ELAA 2FLRH 2J34A 1P2OA 4I8JA 3LOXA 1ZHRA 4O3UA 1V2OT 4XSKU 1KDQB 2ZHWH 4C16A 1DXPA 1CGHA 1O30A 4AFUA 1H8HD 4BTUA 1QFKH 4M9FA 1UMAH 1KTTB 3UUZA 2Y5HL 1RTKA 4OTYA 1J17T 4ISIH 1MQ5A 3MU8A 4B6FA 1AIXH 1KYNA 4JYUH 1SGFG 1UO6A 2YOLA 3A7YA 4XBCA 4GU3A 3RXKA 1YGCL 1G2MA 1YYY1 1K22H 1P05A 1Z6CA 4BAMB 4ZXYL 4H6SB 4INLA 1L5GB 3R05A 3M37A 2V3HH 2YMSC 1J9CH 2WINI 2ZCLP 5E8DA 3SORA 5EIYA 3KQ5A 3EGFA 3GDSA 2VB0A 3CP7A 1TX6A 2OUAA 2HNTE 1BOQA 4X0WU 1IHTH 4XLWA 3KEEA 1ANBA 5E2PA 1UTKA 2CJIB 2VRSA 9ESTA 1YLDA 2QCYA 1TA6A 1TA2A 2DE9A 2BD9A 3SV6A 3M37L 5E2OA 4YESB 5ESBA 1BZXE 4CBOA 5TCAA 4M7GA 3LAQA 4X8SL 1O5DL 1C5UA 2J38A 2PGQB 1HDTH 1O3BA 2EY4C 2HVXA 1NFYB 2BY7X 3HATH 4Q63A 1EXFA 1KXEA 1XKBC 1BTHH 5DP4A 3RXPA 3SGBE 1SQTA 3SI3H 1YWUA 3OE7D 1P2QA 1W0JD 1GI5A 1Y3WA 3HGNA 4X6OA 4AN7A 1W13U 2LNCA 1CGJE 3SU4A 1P02A 4X8VL 1P06A 2RHPA 4SGBE 1GI6A 1XKAC 1LMJA 1APOA 3PMBB 4AFQA 4OTJA 3ZZ4A 1EZQB 2GX4A 2XWAA 4FUDA 2VIPA 4GCHG 1G2LA 4ZROA 1H8ED 2BLWA 2Q1JB 1QA7A 1W0YH 5F6MA 1DS2E 2IPQX 1TRYA 1FQ3A 3A82A 5JB9S 5HM2A 1SGTA 4D0FA 1AO5A 1K1OA 3F3BA 1EKBB 3N8YA 3NRLA 3RM0H 5F8ZA 1ATBA 3CS0A 2F9BL 3PTNA 1PGEA 1KY9A 1F5LA 5T1VA 1DIYA 3CFWA 2Z9GA 3EQ0H 1DVAH 4DCDA 2TGTA 1B7XB 3U8OH 1ATDA 1AFQB 3RXJA 4KKDA 1BTWA 1O39A 1UVOA 1HX2A 2CV3A 3E0NB 2QY0B 1O2NA 2A4GA 2DUCA 4ZCNA 4Y7BA 1C5OH 1WBGB 2FOFA 3UFAA 3UNRA 5TCCA 2EC9H 1MAXA 3MO9A 1DXWA 2FIRH 1GBJA 1NS3A 1O2TA 1SLXB 3TK5A 1A5IA 1YPEH 1E35B 3SJ9A 1TYNA 3NXPA 1H1BA 2VH0B 2ZU4A 7GCHG 1H9LB 4NIVA 2PWXA 3QDZB 4IS5A 2P3UB 1G1RA 3SUEA 3MYWA 5EXLA 3DD2H 4UDWH 1IQKA 1F5RA 1PPGE 1VZQH 2F83A 2PKAA 1G3CA 4D7GA 5J4SA 1CGIE 5IKTA 4FXGH 3ZVCA 8GCHF 2R2WU 1IQLL 2W26B 4B2CA 4YXWD 4NIXA 1PXXA 3SJOA 2HNTF 2F43B 1O5AB 4BDXA 1JRSA 2PLXA 3KQDL 1TX7A 3SNEA 3BIUH 4MNXA 5EGMA 1A5HA 4O02B 3SBKA 3K9XA 1O31A 4F48B 4X8UH 1BF9A 1IJQA 3KK6A 1P0SH 2JETB 5JPMH 3S7HB 5C5OA 1FPHH 3OTJE 1C2JA 6GCHG 1O2JA 1UHBB 2D8WA 2Y82A 1NQLB 4G1MB 3TJUA 2QIQA 3SGQE 2FOEA 4MNWA 2G00A 4ISOA 1O38A 1G3BA 2PR3A 1NFXB 4OS5A 5KN5C 1OOKB 1SGNE 2ZP0H 1PFXL 3LDXH 1C1TA 2JDID 1K1JA 1JBUL 3TH2H 1EAUA 2P3FL 2HGTH 1F0UA 4BNRA 3LJJA 4NSYA 1AFQC 3MNXA 3LTFB 2G00L 2J92A 4F55A 1BUIA 2AHME 2Y5GA 1DITH 2TPIZ 5FX6A 4XDEA 4MVNA 3V13A 2D2DA 4ABBA 3P8GA 1C2FA 1XVOA 4TYDA 4RI0A 1D3DB 2VH6A 5EQQA 1GJ4H 2H9EC 2BQ7B 1D4PB 5FL7D 1WQVH 3E3TA 1QL9A 1O2XA 3WWFA 2C8YB 2J34B 2Z3EA 3D23A 1OB1C 3MDLA 2OK5A 2QXGA 1LPKA 3TZIA 2ZTZA 4ABDA 2KL7A 3AASA 1UK2A 4D90A 1P2NA 2CXVA 1FY8E 3T25A 1FAKL 4BTUB 5C1YA 2ZNKH 2ZFSA 3RXLA 4A1XA 3P95A 1O3EA 1GMDG 1GJ7B 3R0FA 1C2MA 3TGKE 1V2MT 2JETC 3STIA 3ZYGA 1IQJA 1WAYB 2H9EH 1BTPA 1P9UA 3I29A 2GD4A 4XD7D 2TGDA 2H5CA 3KQBA 3LGYA 3HO4A 1F5KU 5FPSA 2G51A 2OQUA 2BT7A 1C5PA 1G2MB 1JWTA 3QN7A 4GVUA 4RT0A 5AFZH 5L30H 2OLGA 4JYVL 5DP7A 3BTFE 3MO3A 3MNBA 4OS4A 1X7AC 1GHBG 4KGAA 1QIXB 1DDJA 1CQEA 1PPBH 5IKQA 4YZUA 1IQJL 2NPRA 3PGHA 2OYEP 2SFAA 2XW9A 3ZZDA 2BDAA 5C2ZA 2SNWA 3FFGA 4JZDH 3KQBL 3E90B 2BDCA 1A0LA 1FE2A 2QAAA 3CA7A 2XNIA 1ZHMA 1EPHA 2ANYA 3ASIA 1B0FA 1YPHE 1PYTC 2HPQH 2NU2E 2WSSD 2VGCB 3A81A 3PMJA 5T6FA 2FPZA 3VB7A 1EATA 1S6LA 1ANDA 2BSFA 1YCPH 2ZEBA 4K60A 5JYIA 1CA8B 3QGNB 3GISX 1BRUP 3TH3H 1LKBA 1HJAB 3RU4E 2WYGA 1DSTA 1S5SA 1UTQA 1UW7A 4MTBA 1GBEA 4QT8C 1A7SA 3RXEA 2RFKC 2IN2A 4NFFA 1IQML 3KL6A 2KCAA 2AIPA 1C2IA 3MMGA 1C5XB 3OLUA 1ELDE 2AMPA 3DFJA 3M5LA 3VG8A 5L2YH 3QUMP 5C1XA 2ILNA 1I0UA 3M35A 1SB1H 3A8AA 1QL7A 5E0JA 2V3MA 3SNBA 3UOPA 3K6ZA 1ZLRA 2PKSC 2XC0L 2Z9KA 1IGZA 1NC6A 3E1XB 1LVBA 1TLDA 2RDEA 4DG4A 1UVTH 1G2LB 1FJSA 2YGPA 1C1QA 2FLBL 4ZH8A 1GCDA 3HS6A 1GMHF 3ZZCA 3GDVA 1O34A 3ZIAD 3VGCC 1C4Y2 1J8AA 1TPPA 4YT6L 4FOUC 1YLNA 4WMFA 4Z1MD 2B5TB 4IC5A 4WMEA 2B0FA 4CBNA 2O8MA 3T62A 3P8NA 2OYUP 4ISNA 1QIUA 3KQEA 1MAYA 3H7OA 1EASA 1CE5A 4GUXA 1FJSL 1PPEE 2ESTE 2FX4A 2ZKSA 4IGDA 1IP0A 3LN1A 4ABFA 1Z1IA 3SU0A 4NFEA 1OP8A 3FOAA 3SV8A 3PROA 1C5RA 4B71A 2QE7D 2FZZA 4JZFL 2OXSA 4RRYA 2VGCC 1GJAB 4HG6A 2BTCE 4XBBA 5HIYA 3LGTA 2FOCA 3KQEL 4Y7BB 1TGSZ 4Q7XA 1W3CA 1HT5A 3FBYA 1HAXB 2P16L 4YTAA 3VPKA 1HT8A 3TK5B 4AFSA 3RXDA 1HJAC 5IDKA 1GK5A 2W2ME 1SGCA 5JW1A 1HAHH 4O03A 3N8WA 1GHYH 4Y7AA 4AB8A 3MNSA 1XUIA 1N8OB 1QJ1B 4THNH 4A7IA 4X8SH 6ESTA 4LMFA 1TMBH 1LMMA 2FZZL 2BZAA 2XBVL 4CHAB 4LORA 2STBE 1FUJA 1S6FA 4TT3D 2F4LA 5FXLA 3F0PA 1O3OA 1TQ7B 1JXPA 1AWFH 4Y71A 4X6NA 1AY6H 5JBCE 1DDXA 1HAGE 1SGFA 2OP9A 5EGMB 1HJ8A 2ZPQA 4I32A 3DT0H 5DKMA 4AGJA 1NM6A 3K9XB 1AUTC 2ZFRH 4AC9A 1Z6EA 2GDEH 1NRSH 2ZDMA 4YT7L 1SHHB 4D8NA 1IQGL 1GBFA 2ZHQH 3RXOA 3UQOA 3A8BA 1O3MA 1GMCF 2Y82B 5DPAA 2FI5E 2QF3A 4VGCC 1OX1A 1C2GA 2XCFA 4CRDA 2Y7ZA 2PR3B 1FLEE 2WPLS 3RXHA 3RXMA 1ANCA 1KSNA 4TWWA 2BD5A 1Z6EL 3W95A 1ZSKA 2KCOA 3ATKA 3RM2H 1Z8GA 2VWLA 3UREA 3PYHA 4IN1A 2THFB 4RKOB 2Y7XA 3PTBA 2VWMK 3V0XA 4JCNA 2CF9H 1TGTA 4K1TA 3OEED 1RIWB 1MOXC 2SGDE 1FXYA 5IKVA 4CR9A 1K37A 2ZDNA 1O2KA 1TQ0B 3ZYEA 1K9OE 2WYJA 2VWOL 4IMZA 2VH6B 2W3IA 1UTMA 2BLOA 2A31A 4ZXXL 1ABIH 2W86A 1J15A 1CHOF 3ATMA 1C1NA 2IPHA 1LPKB 2BY9X 2B8OH 4CHAC 4NGAH 3RXAA 3TJNA 1QHRB 4H6TA 1A3BH 2WPIE 3PWCA 4I31A 4INHA 1C2DA 1MTNB 1O5FH 1O5GH 2P59A 1MZAA 2PTNA 1EBVA 1C5QA 1ZYOA 3QWCH 2FOBA 1IQFA 4Z6AL 3TGIE 4CR5A 4UE7H 4Y8XA 5C5NA 4E06H 4HI3A 1XUGA 2FO9A 2VVUL 1QY6A 2GCTB 2AFQB 2C93B 2ZI2H 1PFXC 1K36A 5JBBE 1O3DA 2F9OA 2GD4B 4NA9L 1G30B 1YPHC 2STAE 2PV9B 4AFZA 1FFMA 1KLIL 2HWLB 1C1MA 2K1QA 1C1UH 3M5MA 1P01A 4XRNA 4YOIA 1HRFA 1O3NA 2ZGBH 1MKWK 1V2LT 4YZUB 1A0JA 1ZGVA 3IG6B 3ELAH 2KZ4A 3U7UG 4GHQA 4LXBH 1SFQB 2YMSD 3PV5A 4RRWA 4RUTA 1EJNA 3W94A 1DLEA 2A2QH 3EGKH 2J94A 3O8RA 1GGDC 1E34B 3D62A 3P8FA 1EMNA 5IYTA 1O2YA 1RIWC 3BF6H 3RXRA 2ZHEH 2B7DL 4A92A 4DJZB 5T3HA 2Y81A 4IC6A 3U9AH 2OTVA 1RFNA 3NJPC 2GTBA 1XUFA 3PB1E 3T29A 1N1LA 1O37A 2IJD1 3SJKA 2WYGB 2UUFB 1GI1A 4RRXA 1NY22 3TBDA 2WPMS 1GJCB 5HXFA 1DX5I 3KL6B 1TNIA 1WV7H 1UJ1A 1SOZA 3GCXE 1T4UH 2PUQH 2ZFQH 1UTNA 4X1PU 2J5UA 4Y79A 1MTNC 3BTDE 2BXTH 4DT4A 2NU1E 4HTCH 2HALA 1W0KD 3GCNA 1BTUA 1TBRH 1ETRH 1ZTKA 2PP6A 3LH1A 1BHXF 3PLKA 1C1VH 1QRZA 1SQOA 1G1QA 2FXRA 3F0OA 1FAKH 2BD8A 2DDUA 4ZH8B 1V2ST 3TH4H 1GHWH 1O2RA 4X2VA 3A85A 5EPYA 2BQWA 5EJ1A 3V64C 3O8CA 1P03A 2O8TA 2EEKA 2P95A 3LPRA 4FVBA 1YF4A 3ATIA 2HOBA 2BYAX 2KX4A 4WVPE 3T5FH 3KRKA 1EJAA 1K1NA 2G4TA 1A3EH 1K0HA 1Y59T 1M1XB 4X2XA 1A61H 4DVAU 1V1HA 1VITG 4Q2KA 2QXIA 1AZZA 1BRCE 3G01A 3FAOA 1WHFA 1CA0B 2WPHE 1KLJH 5HIZA 3UR6A 3BT1A 3MH6A 2GKVE 4E05H 1P04A 4KTCA 3IITA 2FOHA 3ITIA 1QJ6B 2BX4A 3TK6B 2I9AA 3A87A 5L2ZL 1IAUA 3TGFA 4O1ZA 1QB9A 1V2QT 2TRMA 3NTGA 4DURA 3N8WB 4Y7AB 2UUYA 3WY8A 4BXSA 3RDZA 4A7IB 4NZQA 1QBOA 5EJLA 4Z0KA 1TPAE 3PO1C 1EQ9A 2TBSA 3VEQB 3LIWA 1GHVH 5EOKA 4BOHA 2O8LA 2QF4A 3C1KA 4Y71B 4HZHA 1HUTH 1F0TA 1ZJDA 1G3DA 3QK1A 4RN6A 2XCNA 1YPMH 5E8EH 4O97A 2R0LA 1XMNB 1Z7KA 1C5TA 3Q7DA 5A2MH 1J16A 2A4OA 3VXFH 2WPME 1VCWA 2LP6A 4Q80A 3VFEA 1OXGA 1RTLA 1GI9B 4ASHA 1EQHA 1LTOA 1ESBA 1O2VA 1WYKA 4UONA 1HLTH 1C5LH 1MD8A 2F9NA 3E0PB 1GI0A 2BD2A 2W6ID 3DCLA 5LH8A 2JH0D 4NWLA 1WTHD 1YUGA 2C8XB 3MH7A 1B5GH 4GU4A 2SGQE 2ZGXH 1O2WA 5I46L 2Y7ZB 2KR7A 2YNBA 1FPCH 5AVDA 1XXFA 2PFEA 1PPFE 1ARBA 1UCYK 3UB0A 2SGAA 3E8LA 1EP5A 1F0RA 1T31A 2VWMA 3F2HA 2GV6A 3LC5A 2ZO3H 2Z94A 1NFUA 3GY6A 1YY3A 2FOMB 2AH4X 4MNYA 3KYFA 2Y7XB 2NU4E 2PHBA 3GDUA 2ODPA 3HKIB 4B76A 2BMGA 3OU0A 1CA0C 1DX5M 3F9GA 3KHVA 1PRHA 1OS8A 2BDBA 2Y38A 2FM2A 3SV9A 1HCGA 1GJ6A 5AFYH 3FZDA 1QBVH 2W2OE 2WYJB 3SNAA 2W3IB 1JMOH 1CVWL 3MO6A 1TMTH 2BHGA 2WUCA 1HGTH 1GJBB 2BVSH 4CRGA 4P02A 5DP8A 2YGOA 1MBMA 4U30A 1DFPA 2BDGA 1SGPE 4BAKB 1O2OA 3MQEA 3A7TA 1L4DA 3ZVAA 1SG8B 3SUGA 4GPGA 2ZWLH 4GCHF 1DWDH 3RXVA 1ZOMA 4DOQA 1PPCE 2BXUH 1IOEA 1GG6C 2ZU2A 3BG8A 1OWHA 4NIYA 4X6MA 3RP2A 1T8OA 2QXJA 3VB3A 1T8MA 3RLWH 4MPXA 4WXIA 3EDXB 2Q6FA 2JKHL 2P28B 4RSPA 1RRKA 4MMYB 3Q76A 2PGBB 4CH8B 4GHTA 2BOKL 3U8RH 2O8WA 1LMWB 1F92A 1GDQA 1IOEL 4CUFA 4RS0A 4JZEL 3FKSD 4Y76A 2WG3C 5F8XA 2J98A 1APQA 4ISHL 1KXBA 4B6EA 3VB5A 2BY6X 5G4BA 2A4RA 1VCQA 3AAUA 1WDIA 1JL9A 3OFND 2J94B 1C2HA 3UY9A 1JV2B 2QYIA 3MI4A 3RMOH 1SQAA 1HAFA 1AD8H 1TALA 1IQLA 2XWBI 3TU7H 1MQ6A 4DY7B 1ZGIA 1UTLM 1GCTB 1AE5A 3SQEE 4ZHMU 4AQTA 1VGCB 2Y81B 3ZYJB 1RS0A 2QC2A 3KQDA 3P6ZB 1Q3XA 1RFNB 1Z8IB 2ZC9H 3SZEA 4OS2A 3SOBB 4NSVA 1SKYE 2KNIA 2FYQA 1H9HE 3HO5A 3UWJH 4FUHA 1Y3XA 1AZ8A 1SL3A 1UZPA 2ZU5A 4X2YA 2AGIX 1FX0B 1SMFE 2VJ3A 3TLOA 3Q3KA 2G55A 1MQ6L 3BTHE 4ABHA 1NFWB 1YBWA 1Z1JA 3DA9B 2AERH 4Y79B 2L74A 3M7QA 4LZ4B 2NU0E 6GCHF 4ZKRU 1FY4A 2I6QA 2F3CE 4BAOB 3RXFA 3S69A 3OY6U 1F0SA 1JRTA 2K2TA 5FDQA 3N8XA 1DT2A 2A4QA 3KNXA 1XX9A 2BDIA 2HLDD 3OEHD 1SGEE 3SU1A 1C5VA 3B8JA 3M7UA 2GV7A 3RXCA 4Z6AH 1P9SA 2ANWA 3AK5A 3F6UH 2KB9A 1GI3A 3UOUA 8GCHG 1THPB 5DN6D 1D9IA 2BQWB 1FAXL 3QMOA 4NA9H 4CRCA 3ESTA 3Q3XA 3SJIA 1PQ5A 1H8DH 4MDSA 3GYLB 1IQHL 4NG9L 1CU1A 5F1AA 1Y8TA 5JB9E 4DW2U 3KCGH 1A0HB 4PH9A 1C5MD 1DY8A 1C4V2 2J97A 2ZFTA 3GYMA 2BY5X 3BTTE 2VVCK 1AKSA 1K1LA 1O32A 1WQSA 1YPKH 5GDSH 3SOVA 1TGNA 3GCTF 3N8ZA 4BTTA 3A7ZA 3PRDA 2P94A 1GCTC 3OTPA 3OYPA 3FVFB 3EE7A 3IITB 4X2WA 5F8TA 1VGCC 1Z8RA 1BQYA 3BG4B 1OHHD 4WWYA 1LO6A 1GBTA 1P10A 1N1IA 1C9PA 2ZCKP 2H1UA 2ZPSA 1JIMA 4XFQA 2FX6A 2J9NA 1C1RA 4JYTA 4D9QA 1HREA 1LKAA 1EPTA 2EQNA 1FONA 4Z0KB 2G4UA 1FF7A 1GL1A 1KIGL 2ZDLA 4OS6A 2XXLA 2P94L 2TGFA 3LIWB 3P70B 4DIIH 2PKSB 2TGPZ 2XC4A 2IJOB 3EA7A 4NWKA 1T7CA 2CGAA 1CEJA 3P92A 1ZMLA 1RGQA 2EI8A 4H4FA 1WSSH 1T8NA 3T26A 2ZQ1A 3QH0A 5DP6A 1U8CB 2A7JA 3VGCB 5HGGA 1GHBF 1TFXA 2ANKH 1O2GH 3M5OA 3ODFA 4I33A 2WHXA 3SHCH 2EA3A 8LPRA 1UTOA 1URKA 1O0DH 4UFEH 2BLVA 3P8OA 3MU4A 1C5MF 1W8BH 2XC4L 5FBEA 1GL0E 2R9PA 1GBCA 1VJ9U 1IQNA 1S81A 3FCSB 5DK1A 4U32A 2PTCE 3DUXH 1C9TA 1YLCA 1DOJA 1EZUC 1W2KH 1AGJA 2DE8A 2FLGA 1ZRKA 4UFDH 1RD3B 4Z0LA 2H2ZA 2HRVA 2XNDD 1F0RB 4Y8ZA 3U69H 3LC5B 3LJOA 1Y5UT 1NFUB 1OP0A 1IQMA 2ALPA 2D26C 1PPHE 2W5EA 2PHBB 2SGPE 1IQNL 2H6MA 1TBQH 2ZZUH 1NTPA 4E7NA 2BMGB 3F2FA 4ZKOU 5C20A 1D3QB 2J38B 1O3FA 2WPDD 1G3EA 1HCGB 1MUEB 4AGKA 2PUXB 3DEMA 3BG4C 4WJG2 2XC0A 3ZYDA 3UNQA 4DT7B 2ASUB 3IJEB 1MTUA 3M7TA 1AHTH 2HORA 4IMQA 2FLRL 1MU8B 1TIOA 1C1PA 6COXA 4MNVA 1HB0B 2OBOA 2ZU1A 3PMAB 1AMHA 1EGFA 4D7FA 1EP6A 1V6DA 2OCVB 1ZMNA 1NT0A 5JBAS 5LPFA 2GZ7A 1QFKL 1ELGA 1G1SA 3SV7A 1C5YB 2WG4B 4COXA 3TJOA 4XL1A 1Z71A 2QF0A 1CX2A 2WFTA 1ZJKA 2XBYA 3LC3A 1Z6JH 3A8DA 3CENL 2W2NE 3KIDU 2XBXL 4GAWA 3BTQE 4VGCB 1OKXA 1V2TT 2AYWA 3P17H 2NU3E 4ZHLU 2FS8A 5EJZA 2JH6D 1N6YA 3V12A 4AYYB 1QRWA 3PM3A 3N8YB 2L6OA 4ZHAA 4H42U 1YGCH 4KTSA 3D65E 2A7CA 3RC4A 1TRNA 3QTVH 4ZXYH 2H5DA 1EB1H 2P16A 5KECA 2GZ8A 1O3KA 2XBYL 2J98B 3VB6A 2UUJB 3HO3A 1ARCA 1QTFA 3T2NA 5I46H 2FWWA 1S6HA 3F2GA 4JZ1A 5BPEA 4TY6A 3RU4D 2XBVA 1E37B 4XBDA 1N6XA 4F49A 2P26A 1GMHG 1TRMA 2VIOA 4UD9H 5CKMA 2F91A 1QRXA 1FIWA 3SU6A 1QJ7B 4AOQA 5FAHA 1BBRE 1AN1E 1GJ8B 3T27A 3MH4A 3ZZ6A 1M9UA 1UCYE 1TNGA 1KMHB 1C5ZB 2BO2A 2ZIQH 1LPGA 2BB4A 3S0NA 1O5DH 1GBMA 1O5CB 3MHWU 4RRZA 1TBZH 1IQGA 2PKAB 2J95A 3A88A 4Y8YA 5CKNA 1OWKA 2Y5FA 2ZU3A 1L1JA 1UVSH 3SU3A 1ID5H 1MKXK 3Q3KB 1WCZA 1BTZA 3SYJA 1MZDA 2AYLA 3U1JB 8ESTE 3M36A 1EOJA 4A5TS 4TWYA 4I86A 2XBWL 1MTWA 3U98H 3R3GB 1HXFH 1HAPH 2TIOA 4X8VH 2K8IA 4Y11E 1XVMA 2VVVA 5LPRA 1F0SB 2Y5FL 3RC5A 1KXAA 3FP7E 4E1GA 5CHBA 1QA0A 3BPSE 1NU9A 1GJDB 1C5NH 1LQEA 4JK5A 4U2WA 3EYDA 5GCHF 3OLTA 3M36L 1L1NA 1XUJA 2A45B 4K69A 3ZV9A 1UZKA 4NCYA 2C8ZB 5DO4H 1U6QA 4U01A 2ZDAH 5K0HA 2VWOA 4Y10E 2VVVL 1GBLA 1BB0B 4FVDA 5A09A 1O3LA 2F9BH 2VVCA 2Z9IA 4BAQB 1GGDB 1DVAL 3QCWA 1CT0E 1MMJN 1Y3VA 3KN2A 4I8LA 1TGCA 2AIQA 1BJUA 1ZMJA 4ISHH 1AKSB 1TNJA 1SLUB 5ETXA 3RU4T 1ZHPA 3RXUA 5C94A 4BTTB 1BA8B 3EAJA 4CRBA 3UQVA 1GHAF 2Y6TA 2GCHG 1MKWH 3PV2A 3PRBA 5GXPA 4AYVB 1QURH 1C5SA 4Y0YE 3DSOA 4YM9A 2VVUA 5EU8A 3MNCA 1K1MA 1O2HA 1BMAA 3DFLA 4D76A 2UWPA 1VKYA 3CNRA 3Q77A 4INKA 3U8TH 4D9RA 5C0TA 9LPRA 1J14A 1TNKA 3K65B 2JJ2D 1W10U 2EI6A 1SGDE 1G36A 1F7ZA 3H09A 1TMUH 2AMQA 4JMYA 2B9LA 2VIVA 3OY5U 3RR3A 2H9TH 2OC8A 5E0GA 4DIHH 3E91A 1GVZA 1O36A 3LKWA 2W7SA 1IQIA 1O2ZA 1XUHA 2M2AA 3F9HA 2EI8B 1FNIA 5CKQA 4X8TL 5JVYA 3MU0A 2Z3DA 1EZXC 1MTSA 1W12U 1CHOG 1EX3A 2H9HA 5CHAC 3FN8A 2XYAA 5FPYA 4FUEA 2GZ9A 1IQIL 3PMHB 2KCPA 2D1JA 2V6NA 1YO8A 1NBME 3T28A 4A6LA 4GSOA 5HMAA 2BY8X 1CT2E 5CMXH 1DWBH 1SPJA 1BRAA 2A7HA 1HJ9A 4YLUA 1V2NT 1QB6A 2WPJS 2BM2A 1MABB 1DSUA 1JBUH 2F9VA 2FI4E 3O8BA 2R0KA 2G5NA 2R3YA 4O9VA 4OS1A 1Y3YA 5EXMA 2WPLE 2P3FH 1GBIA 3W1EA 3GY4A 3ZVFA 4TSFD 2ZHDA 4ZUHA 3ZZ9A 3PV4A 4M10A 1YKTA 2WZQA 5FX5A 1ELCA 1QL8A 1O2PA 1DLKB 1C1OA 1TOZA 1O35A 1QNJA 1A5GH 1OYQA 3V7TA 3PO1B 1GI4A 1LVMA 3ATLA 4K5ZA 3SU5A 2W2QE 3SOSA 4FUCA 1EPTC 4ABJA 5PTPA 1QBNA 2ZF0H 3F9EA 4MMXB 2MHPA 1CQQA 3AVZA 4WH6A 1SGRE 1GI7B 1Q31A 1KIGH 5GPIB 1ORFA 1BJVA 1V2RT 1F2SE 5DJ7A 4AZ2B 2GMTB 3Q00A 5FBIA 2QXHA 3LC3B 1DWEH 1G37A 2H9EL 1GBHA 1JOUB 3VB4A 4ESTE 4BXWA 2G52A 1UTPA 4AG1A 3NK8A 3ZVDA 5B6OA 1NBMD 5KGOA 4HGCA 1O3HA 2P3TA 1E0FD 2KFWA 2C8WB 1L0ZA 2P8OB 4BDWA 4YOJA 3KYGA 1QGFA 4ZHAB 4BANB 3BIVH 1DM4B 1ANEA 5J4QA 4JYVH 1GHXH 1BTYA 3ZYIB 2ZGCA 1QCPA 1P12E 4OS7A 1UTJA 5GJ4B 4JZDL 1O3JA 5DP3A 1GBDA 3BTWE 1FSBA 3H5CB 5F19A 3N99A 2BQ6A 2JJLA 2OC0A 1BBRH 3MH5A 1ADXA 5AF9H 1UCYH 2ZDKA 1SLVB 5C17A 3TH3L 2W3KA 4AB9A 1MBQA 3MTYA 1YUFA 1X7AL 1LPGB 4FUBA 1NO9H 2G81E 2VIDA 2WPJE 2JH5D 4RKJB 5DGJA 3ZZBA 1L1GA 5SGAE 3M61U 2J95B 5CE1A 3C9AC 1DY9A 1P11E 3HKJB 1QB1A 3UAIC 5L2YL 7ESTE 1AFEH 1GG6B 2HVYB 4OM9A 4ZAEA 1GJ9B 1CT4E 2BX3A 2ZPRA 1TPOA 3LGIA 2Y80A 4IBLH 3URDA 3N8VA 1S0RA 4A1VA 4ASUD 3SUDA 3BT2A 2GMTC 1Y5BT 3RXGA 3U28C 1OWIA 1FN8A 3SQHE 4BTIA 3JZ1B 3A7WA 1MU6B 1YPJH 4K1SA 2FLBH 1NPMA 2P8OC 2WUBA 1LVOA 1BBRK 3V3MA 1KSNB 2BD4A 4CUEA 3BTKE 4FU7A 1FN6A 4YT6H 3SJ8A 6CHAC 3RMNH 4B73A 2BLQA 5K0HB 3OSYA 1W14U 2PSYA 1NZIA 3K6YA 2ZFFH 1P3EA 2SGEE 1OWDA 1UZQA 1BRBE 2OD3B 3ZZAA 4FU8A 1MH0A 2ALVA 3F9FA 2ZGHA 3LT3A 5F53A 4P00A 2Q6GA 1MQ5L 1THRH 2XOKD 1CCFA 1VR1H 3UTUH 1HPGA 2OC1A 1W11U 1Z8JB 4JZFH 4MPWA 5C3NA 1TNHA 2BVXH 2GP9B 3KF2A 2F9PA 2ZG0H 1XUKA 4TPYA 1A2CH 3SGAE 1EUFA 4UFFH 2FEQH 1TPGA 1BMMH 4HFPB 1NU7B 3H7TA 1D3PB 1G32B 1VITH 1ESTA 3M3VA 1O2MA 2C4FH 2JKHA 4CSYA 2UWPB 1AU8A 2BOKA 1ELVA 1EOLA 2EI6B 1ABJH 2VJ1A 2BD7A 4B2BA 1K28D 1NPEB 3UIRA 1EAXA 3A84A 3MOCA 5A0BA 2WV5A 1S0QA 3U73A 3OAAD 4MQAA 3RXSA 1S84A 2HOXA 1UZJA 2RCEA 1LHCH 1O5BB 3BSQA 3UNSA 1V2KT 4B1TA 2FDAA 5A0CA 1ZR0A 1Y5AT 1LQDA 2W7UA 1F7EA 4YT7H 1SGIB 3O8DA 1HIAA 1E79D 2QV1A 3WWBA 1BMLA 1SVPA 1ELFA 1UK4A 1XDTR 2LELA 2W2PE 1LHFH 1EQGA 3QLPH 3RMMH 1YP9A 1O2QA 4X6PA 1E1RD 2Z6BD 4LOYH 1GDUA 2D1JB 3GICB 1B0EA 2F9UA 1AI8H 4B2AA 3UWIA 1ZRBA 1GHZA 2C3SA 1V2VT 1LHGH 2WV4A 2GGVB 2R2MB 1SC8U 3SO3A 7GCHF 1AUTL 3QX5H 1O2LA 5A0AE 1P2MA 1HV7A 1HBTH 3P5BL 4F4OC 2RA3A 4AX9H 2PSXA 1TB6H 1PYTD 2BD3A 3E16B 4KTUA 4ABAA 4TPIZ 2VNTA 1C2KA 3RUOA 3NT1A 2GT7A 2J2UA 2ZQ2A 5DP5A 2K2SB 1A46H 1NT1A 1SSXA 4ZKNU 1C5WB 1O33A 2ZGJA 4ZKSU 1AWHB 2FI3E 2BOXA 2ZTYA 1V2JT 1WXRA 5FPTA 1OYTH 4ZXXH 4NGAL 4CH2B 3A80A 1ZTJA 5HYOA 1P9JA 1SBWA 1KTSB 1TNLA 2FOGA 4Q4LA 3NKKA 3D49H 3L6PA 2V3OH 2MGRA 1FAXA 1E38B 3GY2A 3ZZ5A 4XBMA 1A3PA 3PWBA 3ZZ7A 1ELTA 3FANA 5EQSA 1QR3E 3BEFB 1IQHA 1WOFA 3DSPA 1HAOH 3ODDA 3URCA 1U67A 3EA9A 2ZA5A 1SFIA 3M5NA 4IN2A 1HAZB 2P3TB 2XTTB 3NPSA 1W7XL 1LPZA 4X8TH 1LVYA 1Y3UA 1IQKL 3TITA 4JZIA 3I78A 1KLIH 2I6SA 1DPOA 1V3XA 4UFGH 3QTOH 2P3FN 2RDLA 4O3TA 3GCWE 2A32A 2OQ5A 4ACAA 2ZTXA 3ELAL 1EAIC 1TONA 4K1EA 2FD6A 1BT7A 2CF8H 1TABE 3NTBA 1WU1A 3L33A 3ZVGA 3A7XA 3AW1A 3GCHB 2J4IA 3CS7A 1IGXA 5TJXA 6LPRA 1UK3A 2ZDVH 2EI7A 2VWNA 3S9AA 2BQ6B 1ESAA 3ENSA 1INCA 2KM0A 1A1RA 2ODYB 2WPKS 5EODA 5JDUB 2B7DH 3IWMA 1TX8A 2W3KB 4YO9A 2VIWA 7LPRA 3B23B 3GOVB 1H9IE 4FUGA 4Q7ZA 5FHTA 4ACBA 3CS7L 2A2XH 1SZBA 1GMDF 2JJ1D 4Y0ZE 2KAIA 3NWUA 4XE4A 1C2LA 3LH3A 5B6LA 1SQRA 2VWNL 2PUQL 3GCTG 1P09A 3ZZ3A 5KEDA 2BZ6L 2FP7B 1T4VH 3NZIA 2QA9E 4I8HA 1ZPCA 1AUJA 4ZAEB 4YOGA 2Y5GL 1JIRA 5A8ZA 1BIOA 2AGGX 1GWAA 2Y80B 4MMZB 3RLYH 5IK2D 2G8TA 2CK3D 4A1TA 3SOQA 2UWOA 4BTIB 1HAVA 1NRPH 2HNTC 1P3CA 1ZSLA 3GS9A 3BTME 2R3UA 1ZPBA 1TOCB 1GVKB 3RMLH 1QZ8A 2Z7FE 1P8VC 1WUNH 3M3SA 3N7DA 2CHAB 2AS9A 5EW1H 2AMDA 1CCVA 1BITA 3GCHC 1P2JA 4FU9A 2FTMA 1CVUA 1SI5H 1ZSJA 1DANH 2UWLA 4YLQH 3GY7A 3QGJA 1EPIA 1SLWB 2OC7A 2RNLA 2HPPH 1KLJL 3N7OA 3U1IB 1K1IA 4FUFA 1RXPA 1YM0A 2Q6DA 5EXNA 1TWXB 5LPEA 2Z9LA 2AGEX 2C90B 5EW2H 1SGYE 1CHGA 4FETA 1CO7E 2M5TA 3HS7A 5L6NH 1EAWA 1O3IA 5L2ZH 3CENA 1EPGA 2VIQA 2XBXA 3NUMA 1VCPA 5C0UA 3FP8E 1F7MA 1D6RA 1NN6A 5EQRA 4MLFB 1TOMH 4B75A 5DSFA 5JBCS 3S9BA 3FFGL 1HAIH 3RXTA 1GVLA 1LHDH 1WTGH 1KKEA 1EB2A 1H4WA 3DHKH 4OGYA 2BVRH 1GI2A 2ADXA 2WPKE 1PPZA 1OWJA 1EFRD 2BT8A 2FS9A 4ISIL 3HS5A 3SW2A 1FZZA 4X1QU 2RG3A 2LPRA 1AB9B 3SI4H 4JYUL 1NRNH 3LGWA 2SNVA 1AVXA 4I8KA 4NZLA 1MKXH 1KXDA 1LQDB 1HYLA 3RXIA 1NRQH 3F68H 1HIAB 1TLEA 2IOTA 1IQEA 3ZVBA 3ZVEA 1J9CL 3POYA 2FMJA 2BOUA 5ESTE 3S9CA 3FP6E 2RA0A 4KP0A 4Y76B 3I77A 1COUA 1G1TA 5COXA 3SV2H 3TIUA 3LU9B 1V2WT 1FY3A 4NA7A 1XFEA 4MG3A 2Z9JA 1PTHA 4BAHB 3TVJB 1K1PA 2V35A 2CHAC 1DICA 1YCPK 4Q7YA 4FUIA 1VJAU 2WV9A 5IKRA 1TE0A 1CBWB 2CN0H 1IQEL 3HGPA 1ATAA 3SNCA 5LGOA 3TPIZ 4ABEA 2RA0L 1GBKA 5FCRA 4Y6DA 1PQ8A 1NROH 1O5EH 1S82A 1D6WA 3ZZ8A 2XBWA 2BOHA 2VINA 1TGBA 2O8UA 2J2UB 3K2UA 2ANMH 5E0HA 3HPTA 1TAWA 3SHAH 2Z3CA 3F1SB 2WPIS 3BTEE 2ODQA 2OBQA 1CVWH 5GIBA 3NCLA 1L2EA 3TK6A 5FCKA 1H8IH 3BN9A 4WMDA 1XKBA 4DGJA 3QZRA 1HAYB 4WH8A 3SNDA 2FYRA 3QO6A 3JZ2B 2ZCHP 3A89A 1LDTT 1KDQA 1MD7A 2ZHFH 3WW7A 1B9WA 2GVFA 4MPUA 1LHEH 1G9IE 5JBBS 1YPLH 3ZV8A 2V7QD 2QGRA 4X1NU 1BMFD 5EPNA 2YNAA 1AB9C 3STJA 5CHAB 1SHYA 3LGVA 5JB8S 1W0ZU 1GBBA 1FDPA 1DUEA 5T6DA 5JBAE 1PJPA 3MFJA 1S85A 5AHGH 1HAEA 3TGJE 2OINA 1BMNH 3GISB 1LPZB 3V65B 1XM1A 1KLOA 3PLBA 1AQ7A 3DSGA 7KMEH 1IVOC 4I7YH 1DUAA 3AAVA 2FODA 1FY5A 1O2UA 1GDNA 4KELA 1V3XB 3MWIU 1D3TB 1XKAL 3RC6A 4JZEH 4WF8A 4B74A 1WU1B 1V2UT 3KGPA 3MU5A 1GMCG 1CBWC 2I9BA 2GCHF 1T32A 1K2I1 2VBCA 2J4IB 4R0IA 4OGXA 2KV4A 1E1QD 1ZPZA 2CJIA 4X1RU 5GCHG 4K8YA
chains in the Genus database with same CATH topology
2EI7B 1T8LA 2A5KA 1GJ5H 3BTGE 3OX7U 1FI8A 3ENSB 1EPJA 2NWNA 1XXDA 4ABGA 1NZQH 1QQUA 4SGAE 4E7RG 1P57B 1FV9A 4MPVA 1C1SA 4UEHH 1P2IA 3TNSA 1EPTB 3LGUA 1NFYA 3BEIB 1SR5C 3RXBA 2VWLL 2KAIB 3E6PH 5K7RA 1OP2A 3A8CA 3C27B 1ATEA 1MCVA 2GT8A 1N8OC 2WZPP 1YPGH 4K8BA 4AG2A 4LZ1H 3RXQA 1KXCA 3TJVA 1GHAG 4X8UL 1P0SL 5DP9A 2VU8E 4K3JA 1YCPM 5ABWA 1HNEE 1WHEA 2G5VA 1OPHB 1Q2WA 3FZZA 4LK4A 2UWOB 1EZQA 1HAVB 3TNTA 2HLCA 4A94C 4NA8A 2SGFE 5EG4A 2CMYA 4AORA 2Q1JA 2UUKB 3F6UL 1C2EA 2A5IA 1W7GH 2A0QB 4CRAA 4R8TB 5KIRA 1FIZA 1GI8B 1NESE 1EAIA 1K21H 4FM5A 1ZAQA 1DWCH 1EZSC 5DG6A 1L3YA 1W7XH 5JB8E 2WPHS 1OSSA 4I8GA 1P2KA 1YUKB 1IQFL 4XOJA 1SOTA 4D0EA 3KCGL 3AW0A 4NG9H 1AVWA 1V2PT 2TGAA 2UWLB 1RJXB 5JVZA 3BV9B 2ULLA 1O2SA 3L3TA 2ZFPH 1L4ZA 5HM9A 1KLTA 1BDAA 4TY7A 1O3AA 3Q3YA 1HJ7A 3A7VA 1FY1A 1PQAA 2FTLE 3SN8A 1KXFA 1ETTH 1SGQE 4M11A 3EA8A 4X1SU 1HZ8A 2A5AA 2V0BA 1LCYA 5JBTA 1S83A 3HK3B 5A8XA 5F03A 1ETSH 2M74A 2YGQA 2VH0A 1O3PB 3A83A 5BRRE 2P93A 2XC5A 4ABIA 4JK6A 2P3UA 1DQBA 1OWEA 3M3TA 5H4IB 1EMOA 3QZQA 1ELBA 2BDHA 3GCOA 4CRFA 2W26A 2QN5T 3SW2B 1TPSA 1IHSH 1NFWA 2XRCA 1BCUH 2BZ6H 5GWZA 2P93L 3TK9A 2XC5L 1THSH 3A86A 5CISA 4TGFA 4WXVA 5L30L 5C1UA 1N7DA 5C67A 2BDYA 3HK6B 4CUDA 2GDDA 1UVUH 4J1YA 1W8BL 1ELEE 6CHAB 3VXEH 1BTXA 1VITF 1BHXB 1UHBA 2AEIH 4WY3A 3T25A 2GCTC 1DE7H 1O2IA 1NRRH 1C1WH 2PW8H 2ZECA 4ISLA 1UVPA 1FMGA 2MGPA 3S7KB 2WFXB 3S6XA 1QQ4A 4IW4E 1AVGH 1CSOE 3KQCA 1MCTA 3MU1A 2A1DB 1GPZA 4PROA 1O3GA 3LTGD 1NFXA 4FUJA 5I25A 4K2YA 2FESH 1C4U2 3GY3A 3LONA 3SZNA 1ACBE 4J2YB 1GBAA 1HFDA 1E36B 3SU2A 1ZTLA 4GLYA 3PLPA 3GY5A 3B9FH 1O3CA 4Y6DB 3LN0A 1AE8H 2FOAA 2O9QA 3UR9A 3KQCL 1YC0A 1Q4GA 4CREA 1ZZZA 2BOHB 3GY8A 3ATWA 1HXEH 1A4WH 4NIWA 1EJMA 5A8YA 3HPTB 5T6GA 1PQ7A 3EE0B 3SUFA 4ZMAH 2P95L 1IOXA 8KME2 2BQ7A 1HRTH 3UPEA 1MTVA 3BEUA