3F1SB

Crystal structure of protein z complexed with protein z-dependent inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
259
Chain Sequence
NECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Z-dependent protease inhibitor
publication title Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 66
structure length 259
sequence length 275
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3f1sB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB02
1D9IA 1EZXC 4NG9H 1EATA 5T6GA 5L6NH 2Y82B 1P01A 1O5FH 2C3SA 4XBCA 1LMJA 1ATEA 1MTSA 2O9QA 4TYDA 5IKVA 4CBOA 2JKHL 3BSQA 3RXVA 4Y8ZA 1PTHA 1HAPH 1WU1B 2ZHFH 1GBMA 4NGAH 1O3BA 1EX3A 2PV9B 1NS3A 4K1TA 3SZNA 3T28A 3SOBB 2O8UA 4WH8A 1FI8A 3TBDA 3KGPA 2PUQL 1O2HA 5L2ZH 1MMJN 4WMFA 2GZ9A 2ZHDA 1OOKB 7GCHG 3B23B 1NRRH 1BHXB 3EQ0H 1A2CH 3RXBA 1XVOA 6LPRA 1G3BA 2VWOL 2FO9A 1C9PA 3SJOA 2V3HH 2JH6D 4K8YA 1GBBA 1JXPA 1WUNH 3V13A 3UWJH 2ZECA 1Z8JB 1NFXA 4THNH 3RXQA 1Y59T 3SUFA 3P5BL 3SJIA 1LKBA 4ZMAH 1HJ7A 1RRKA 3SNDA 3V0XA 3BG4B 3PMHB 3MYWA 1KY9A 1S6FA 3ZZ7A 1GHAF 2Y5FA 4U30A 1EPJA 1FQ3A 3ZZBA 2R9PA 3QTOH 3WY8A 1KYNA 1GI2A 2A7HA 5B6OA 1C9TA 4YT6H 3NPSA 2JKHA 1H8DH 1YPMH 4WWYA 1SLWB 1YCPH 4ESTE 1C5LH 5A8XA 1T31A 3DD2H 3HGNA 1EKBB 2TGFA 2TIOA 1GI6A 4BAQB 2BOHB 4OS1A 4GPGA 1C1NA 2OCVB 1ZGVA 2VIDA 5CKMA 3FZZA 1YUGA 2UWPA 1Y5UT 4OTYA 3L33A 5F03A 5C1XA 1ZAQA 2I6SA 3A8AA 1SL3A 1C5VA 2PUQH 1A1RA 2OYEP 3SV2H 2W3IB 4K3JA 2VWOA 4MMXB 2TGDA 2ALVA 3URDA 1SLVB 4TPIZ 3ATMA 4A6LA 4SGAE 2Y7XB 1GHBG 1ELAA 2I6QA 1OS8A 1C4U2 2ZU5A 1C2KA 3A88A 4DG4A 3CENL 2PR3A 1TOCB 3ZYGA 4ABFA 2QF3A 3O8BA 1ZTLA 1TA2A 1JOUB 4ZHLU 1IOEL 1FAKL 2FI5E 1SGEE 1HX2A 3VGCC 2FYRA 4X8SL 3RXHA 1O5GH 1ZSJA 3H7OA 3RXUA 1P04A 3IWMA 1TX7A 1U6QA 4CRBA 3RXCA 2BDIA 1TMUH 2Z7FE 2PSXA 4ZXXL 3AASA 1GBIA 1IQML 1UTLM 2PFEA 1FY3A 4AORA 1ABJH 1HZ8A 1Z6JH 3BIUH 3TK9A 3E91A 4ISIH 4AG1A 4ZKRU 2VIQA 4A7IB 1V2PT 2XYAA 4NA9L 2ILNA 2W86A 1C1PA 3SGBE 1XUKA 1G3DA 1RXPA 1O39A 2B9LA 1GVLA 1WSSH 1ZHPA 1ZTKA 2EI7A 3UREA 1DY9A 1YLDA 1HAVB 4FUHA 3E8LA 2FXRA 4YOIA 2Y82A 2D26C 4O1ZA 3U7UG 4AFUA 2W3KB 3OYPA 4IBLH 2BDBA 3CENA 1S0QA 2Y6TA 5K7RA 2AGGX 2FM2A 1C5UA 1PQAA 2FS8A 1BA8B 1D3TB 5GIBA 3UWIA 1RJXB 3S7KB 1WU1A 1FLEE 5J4SA 2FMJA 3QX5H 4WVPE 1ZRBA 1IOEA 2YGOA 3F9GA 5EW1H 1Z71A 1C5XB 1FN6A 1LHGH 4MNXA 2BQWB 2RDLA 3ZVBA 2SGEE 3GY7A 4X1NU 4CRFA 2A1DB 1VR1H 5TCCA 1FAKH 2ZU2A 4DT7B 4WXIA 4I8KA 2AH4X 3BTDE 3I77A 4X8SH 1CVWL 1VZQH 1IQMA 5FX6A 1OP0A 1P2NA 3RXDA 1OP8A 1QJ7B 1H4WA 1ELTA 1EP6A 1UZKA 4WMDA 2JH5D 4ZXXH 4IS5A 3M35A 2WFTA 2GP9B 1PQ5A 2VJ3A 1O5CB 2ZTXA 2A7JA 2FOFA 5EW2H 7KMEH 3L6PA 3RC5A 1O3MA 3SN8A 1CT2E 1N6YA 3MQEA 2J4IA 2OQUA 2ZDVH 2RNLA 3P8FA 6GCHF 2FLRL 5FCKA 2C90B 1RIWB 4NA9H 3UOUA 1BZXE 2P3UB 5LH8A 1GBHA 2ZC9H 1HAOH 4CREA 4CSYA 5KN5C 3ZZDA 2PKSC 1XKBA 1AN1E 3Q76A 1A5GH 1ELFA 1KXEA 4NSYA 1EZQB 1NTPA 1FXYA 2WYGB 5JBBE 1HCGB 2VVCA 1QQUA 3ZZ6A 1JL9A 5IDKA 3EAJA 2AFQB 5GPIB 1EAUA 1FIWA 4I33A 2ZFFH 2Y5HL 3E3TA 4XOJA 1C2JA 1ACBE 3IITB 1A3PA 1QY6A 2BXUH 3SU6A 3AW0A 1E34B 2FX4A 1YO8A 4UONA 2WUBA 2ZPSA 3OX7U 1UCYE 1AZ8A 4ZKSU 3RXRA 1GMDF 1COUA 1CVUA 2R3YA 4UE7H 4IMZA 1QJ1B 2W3IA 1ZZZA 1EAIC 4H6SB 2ANKH 5CHAC 1KSNB 2QN5T 2BVXH 2ZFQH 5DP8A 2P3TB 2Y7XA 5KIRA 1CVWH 2WYJB 1ZJDA 4MPUA 4NIYA 1AO5A 1A3BH 4CBNA 2BY8X 4U32A 1MU6B 2OLGA 4H4FA 3GY4A 1O3DA 4I8LA 4ZAEB 3SV9A 3A85A 3E16B 1O2TA 2BOUA 3GOVB 3RLWH 1O3LA 2F9NA 2FLRH 4ABDA 2BDYA 2BVRH 1FFMA 1TNIA 2VNTA 1UVSH 1TBZH 3K6YA 3A87A 3MO6A 4K5ZA 3P17H 4MPWA 2A5KA 1O3AA 5FPTA 2PLXA 2EA3A 1APQA 1TMTH 4D0FA 4X2WA 3A80A 4LZ1H 1L4DA 1GJ7B 1EAWA 1TX8A 1W2KH 2F83A 5DK1A 1SGNE 1ANCA 3SV8A 2JETB 1DVAL 1YCPK 1HAFA 2BLVA 2Y5HA 3PMJA 1PRHA 1C5NH 4JK5A 3FP8E 4A7IA 1FDPA 5LPRA 1V2VT 1C2MA 2M74A 1TFXA 1GBTA 1DS2E 1XUHA 1WBGB 5HGGA 1C2GA 1RS0A 1V2KT 3KQEL 1S84A 2Y7ZB 1NZQH 2H9HA 2LNCA 1K37A 4X8TL 2F9PA 1HAVA 4Y6DB 3LJJA 2DE9A 2SGPE 1SBWA 3LGYA 5COXA 1G9IE 2R2WU 1S0RA 2XC4L 2W3KA 1JWTA 1ETRH 3ENSB 4FUDA 1OB1C 4ISOA 2ZHWH 3MFJA 3I29A 2C8XB 4IC6A 1MUEB 1E37B 2P3FN 3LKWA 2MGRA 1LMWB 1TLEA 1IQFL 2PKAB 1URKA 1EQ9A 1EGFA 1V2WT 1O38A 1QL8A 2DUCA 2ESTE 2HWLB 2C8ZB 3A8CA 4DIHH 2ZFPH 5JVZA 3DA9B 1DANH 3NKKA 4NIXA 2W2ME 1P05A 1W0ZU 1F5KU 2W5EA 1CHGA 3FAOA 3BTFE 4E06H 4AN7A 4ZHAB 4RUTA 1TWXB 1CHOF 1GI1A 2BD5A 1K2I1 2PGBB 1V2MT 4NIWA 4VGCC 4AOQA 1NPEB 4BAKB 1ANDA 1ZPCA 5FBEA 3S9AA 3HK6B 1BT7A 5EQRA 5E8EH 1PQ8A 1LDTT 4Z6AL 1DVAH 1LQEA 2ZHQH 3CS0A 2UUFB 3PLBA 1CA0C 1HNEE 3LH1A 2BZ6L 3KQEA 8GCHG 2P3UA 4CR5A 3HK3B 1C5PA 3LGTA 3RLYH 1GMHG 1QHRB 2PWXA 2ALPA 4IGDA 2EI8B 1EJAA 3T26A 3K65B 4M11A 1DE7H 3VB5A 1EZQA 1HCGA 3OU0A 2XC4A 4BTUB 2FZZL 3BV9B 4X8TH 1O3IA 3TLOA 2M5TA 3VPKA 1CX2A 4FUEA 4AG2A 3UFAA 3U9AH 1F92A 1IQFA 4FU9A 3MNBA 2B7DL 3F9FA 4A92A 3BT2A 1ZGIA 1K21H 5T6DA 2FX6A 2GZ7A 1K1NA 2GD4B 3C9AC 1K1IA 2ZGXH 3TH2H 2A4QA 5A2MH 1AZZA 1EPGA 3R0FA 1BTYA 3NTBA 4B74A 4JYUL 1YYY1 1UTPA 1Y3WA 1C5TA 2ZWLH 1HRTH 1KSNA 3GCWE 5AF9H 1GJDB 2P3TA 4BXWA 2SNWA 2ZFRH 2BY7X 3RXKA 5A8YA 2QY0B 3ZVAA 2H1UA 3A89A 2NU2E 3K9XB 2VINA 4FUGA 1IQIL 4WF8A 2P94L 5IKQA 1XMNB 4D9RA 1TLDA 3QGNB 3FBYA 4ZAEA 4D7GA 4CH2B 4Z6AH 1ZHMA 1L2EA 3VGCB 4XDEA 3ATWA 3UNSA 5E8DA 2BZ6H 2VWMK 3H5CB 1C5MD 1DFPA 1K22H 1PPBH 4Q7XA 8LPRA 1ATBA 1AWFH 2AGIX 3M5OA 3HGPA 1UTJA 5DGJA 2AMQA 1TNHA 2ZFSA 1KTSB 1XUFA 2IN2A 1TGSZ 1FMGA 3GYLB 4Q7ZA 4LZ4B 1A0HB 3NT1A 2ODYB 2ODQA 3UTUH 1OP2A 1TPSA 3SU0A 1O2RA 4KTCA 3DT0H 1Z7KA 5C2ZA 1TRYA 1ZMLA 1GMCG 3P92A 2VVCK 4BTTB 3MU4A 5ESBA 1W14U 1AHTH 2B7DH 1QFKL 1UJ1A 3QZRA 3ZYJB 1J16A 2ADXA 1S5SA 1CT4E 3LOXA 1LVYA 2XBVL 2XRCA 2F9VA 2Y7ZA 5GJ4B 4K69A 1H8IH 1Z8RA 3BEFB 1MKWH 1EZSC 1OX1A 4JYUH 1AB9C 3KEEA 2J95B 1C1QA 4Y6DA 1AD8H 1MAYA 3FZDA 5EPYA 2GDDA 4A5TS 2G5VA 1ZLRA 1IQIA 3ZZ3A 2TGTA 2P94A 3ENSA 1V2UT 5DPAA 2PHBB 5JPMH 1QBNA 1LKAA 3DEMA 3GY8A 2AIQA 1C4Y2 3KL6B 1OXGA 3SORA 4NWLA 5EODA 2XC0L 1NPMA 4JMYA 2QC2A 1G2MB 1YM0A 5FAHA 4BOHA 3HATH 1AMHA 4MDSA 1J17T 1DM4B 1T8OA 1TMBH 4X1SU 3RR3A 1XFEA 4R0IA 1M9UA 2J92A 4ZHAA 1SGFA 1GJ5H 2TRMA 1GI3A 3TH4H 1V2OT 2XWAA 3OY5U 1WAYB 2P3FL 3PROA 1P06A 3QUMP 3RMOH 2ODPA 3PV4A 4X1PU 3ESTA 2Y5GL 4DCDA 4LMFA 2VH6A 1O33A 1DY8A 2XBVA 2B8OH 2PKSB 3LC3A 4DIIH 1QFKH 4B73A 2CJIA 4XFQA 2ZHEH 1O3PB 3BTQE 2EI7B 5K0HB 1L1GA 2IPHA 3UY9A 4DURA 2EI8A 1P2KA 5CISA 3MHWU 3RP2A 3QK1A 2HPQH 1BRUP 1NRNH 4FVBA 5HM9A 1DUEA 3BTEE 2XC5L 7ESTE 1TPGA 1GHXH 4BTUA 1DICA 3OLUA 1N6XA 2SGAA 5IKRA 1UHBB 4Y11E 2Q6GA 2FWWA 1BUIA 2BX4A 3O8DA 1TGBA 2O8LA 1V2NT 2BD9A 1QL9A 4MLFB 3A86A 1GK5A 1ELGA 2XC0A 2Z3EA 2GD4A 2TGAA 1MBMA 2ANWA 2FYQA 2A4GA 3EA7A 2Z9GA 3PMBB 5F8XA 5I25A 5CHAB 1NQLB 3B9FH 2UUYA 4UD9H 1NFWB 3A83A 4D7FA 1ORFA 3N7OA 2P8OC 4JK6A 3M7QA 1MQ5L 1MU8B 1G37A 1GJCB 4B76A 1UK4A 2Y80B 1LHFH 4LXBH 1MTVA 1VITH 1EAXA 2H6MA 3NWUA 1CT0E 3ZVDA 1UO6A 1TONA 3K9XA 4JCNA 1AFEH 1C1SA 1OWDA 4X6MA 2J4IB 5JVYA 2NU1E 2P3FH 3RC6A 1GI9B 4D9QA 2PSYA 3PYHA 1EZUC 1ETTH 3K6ZA 1UK2A 1W10U 5EXNA 1BJVA 4Y8XA 4H42U 1NU7B 1FSBA 4GVUA 1PYTD 3ODDA 1GJ4H 1A5HA 1DSTA 1W12U 5A0BA 1C2LA 1P12E 2HVXA 3VXFH 3TH3L 2XC5A 2OC1A 1ARBA 1TQ0B 1T7CA 4ABBA 4Y71A 3TJVA 3LN0A 1TBQH 4ISIL 4ZH8B 1O2LA 3EA8A 1HAGE 3H7TA 1MCVA 1S6HA 1LPZA 1F0TA 3PB1E 3F9HA 3TGFA 4HFPB 4B71A 2VWLL 2ZDKA 3SU5A 3F1SB 3VEQB 3ZYIB 1OPHB 1O30A 2GMTC 2B0FA 4BTTA 2J2UB 3GICB 2XBXL 1LO6A 5DP3A 3PTBA 1O2MA 3LGIA 1Y3XA 4ASHA 3F6UL 2TPIZ 4OGXA 5LGOA 2ZCHP 1EOLA 2QV1A 3VXEH 3T2NA 3N8WB 1AVXA 1MTWA 3URCA 1MOXC 2C8YB 3W95A 3I78A 2CN0H 2Y38A 1HT5A 5JYIA 2J95A 2WPMS 1J15A 3EA9A 5AVDA 1UZQA 1IHTH 3TU7H 2BYAX 1NN6A 5SGAE 3MTYA 2V3OH 2P95L 2QF0A 3SOVA 2QXGA 3RUOA 1B0EA 2PHBA 2HGTH 2YNBA 1X7AC 2ANMH 4AYVB 1O3OA 1YPHE 4KTUA 4WXVA 2GKVE 2SGFE 3KL6A 5EXMA 1SMFE 1LCYA 2PTCE 1FONA 1G2MA 3GY5A 1TB6H 3RXLA 2GCTC 3P8NA 5BRRE 1O3KA 5DP7A 4DVAU 5E0HA 1THSH 1P0SL 2F91A 4VGCB 1D3DB 2G81E 1O2PA 1ANEA 5F8TA 1EXFA 3TH3H 4GUXA 5G4BA 3HKJB 8ESTE 2VWLA 1F0RB 4RN6A 4YLUA 4Y79B 1L1JA 1O0DH 4TY6A 4X1RU 1HV7A 5FHTA 1CA0B 1GCTC 4X8UL 4XSKU 1C5RA 2XBXA 3GCOA 4RKJB 1BQYA 1EB2A 1EASA 1O2JA 1C1TA 4NFFA 4ABJA 4DJZB 1KLIL 3GCTG 4GCHG 2FLGA 1C5OH 2BQ6B 3MNCA 4JYTA 5GCHF 1KXBA 1OWHA 1O5AB 2RA0L 3F6UH 5K0HA 1PFXC 3DUXH 2VWNL 5AHGH 1A0LA 4DW2U 2A2XH 3S0NA 3Q3XA 5JB8S 2BD3A 1MKWK 1ESTA 4O3UA 3RMNH 1J14A 4INLA 1F7EA 2P95A 2GV7A 3LT3A 3VFEA 1UHBA 2GCHF 3BN9A 2BQ7B 3U73A 5ETXA 1JV2B 1O32A 5DP4A 2XBWL 3GISX 2UWLA 1C5ZB 2ZNKH 3SJ8A 5C1UA 3P70B 1HJ8A 2ZPRA 3U1JB 1TGCA 1AWHB 2ZPQA 2FESH 3M3SA 1ZHRA 1Q31A 3U8OH 1EAIA 4RSPA 1MTUA 5A0CA 3AAVA 3MU5A 2K2TA 3EGFA 1NFWA 1DITH 2I9BA 1D3PB 2KAIB 2XCFA 1HXEH 1WYKA 3M61U 1FPCH 1TNLA 1GPZA 2PUXB 1P0SH 1NU9A 2AIPA 2Y80A 1ATAA 2OBOA 5C1YA 2VWMA 1QA7A 1TPAE 3SOSA 4BTIB 2RG3A 3ZYEA 1IQEL 3PTNA 3OY6U 2W2NE 2NPRA 1HXFH 2XXLA 4X8UH 1EMOA 3RM2H 1AE5A 4GSOA 3SGQE 1KXAA 1T4UH 4ISNA 2WPHS 3UQVA 1O36A 1N1LA 1BITA 2QA9E 3W94A 2GGVB 3AVZA 4D90A 1KLIH 4UFEH 2RA0A 4CUEA 1FPHH 2VWNA 3ZZCA 4U01A 1OWIA 1BDAA 3LAQA 3TJOA 1L0ZA 1ETSH 1GHYH 1WHEA 2AMDA 2H2ZA 5JBAS 1H9IE 2OQ5A 1QIXB 1JMOH 1UVPA 1CO7E 2VU8E 4Z0LA 4ZH8A 4MMZB 3E90B 1GHAG 2ZGJA 2BTCE 1FY4A 5HM2A 4YESB 1QL7A 1N8OC 3P8GA 1V2JT 4FU8A 1Y3VA 4J2YB 1HPGA 2IJOB 1TOZA 2J2UA 2BY5X 2TGPZ 2HNTE 1B7XB 2BVSH 1ELCA 2BLWA 1NFUB 4K8BA 1SGRE 1AB9B 1P10A 1AY6H 3R3GB 1DWBH 1SFIA 1JIMA 2V0BA 3N8WA 4H6TA 2Q1JA 3G01A 3ZYDA 1FF7A 3A8DA 1VITF 1GBKA 1YC0A 1IQEA 1W13U 2P93L 1GWAA 2NU4E 3LU9B 1GL0E 1KLTA 1MQ6L 1C1MA 1HIAB 1W0YH 1SR5C 2PGQB 4Q80A 3STJA 3O8CA 2BMGB 1Q4GA 2YGPA 1SGIB 3NXPA 3RXJA 5EQQA 4TGFA 1NZIA 3MNXA 2XBYL 3RXEA 1WQVH 2FOGA 2ZEBA 1BBRK 3PGHA 5CKNA 2A45B 4MPXA 1KLJL 3KQDL 1GCDA 3MH5A 3KNXA 4AGKA 3SNBA 1N7DA 2Q6DA 3P8OA 4A1TA 2OC8A 3SUGA 1GI0A 1DWEH 5ESTE 4COXA 1F0RA 1HBTH 1O2ZA 4Y79A 1WCZA 4Y8YA 2Z3CA 1SQAA 2F9UA 3PWCA 4ZKNU 4JZFL 5PTPA 4MPVA 2VIOA 1O2UA 1O5DL 3GY2A 4JZ1A 4XE4A 1V3XB 3BG8A 1GI4A 1EBVA 2B5TB 3SI3H 2AYLA 1YP9A 2PW8H 1SSXA 3KQCL 1MD7A 1FAXL 6ESTA 1XUJA 1BCUH 1H1BA 5T6FA 2BQ6A 4CRDA 3ELAL 1GBCA 2Z6BD 3ITIA 4CRAA 1T8NA 2FI3E 1KXCA 2XWBI 3N8ZA 2F9BL 1PPGE 1HLTH 2GT8A 3EYDA 1P57B 1E36B 4B75A 2KV4A 1ARCA 1MKXH 2P93A 3JZ2B 4CR9A 2A32A 1MQ6A 1SC8U 3MO3A 3MH6A 1A4WH 1GI5A 2GDEH 1D4PB 2BQ7A 2XCNA 4F4OC 3MU8A 1O3HA 3HPTB 2ZP0H 1C5SA 2CXVA 2XBYA 5A8ZA 4FU7A 2ZZUH 1NO9H 3TIUA 1YUKB 5I46L 2P8OB 5GWZA 1VJAU 3KQDA 2GV6A 4Q2KA 2O8TA 2G00L 3BTWE 3MH4A 5HYOA 1NM6A 1V6DA 5AFYH 2KAIA 2R2MB 4IN1A 1QRXA 2A5IA 1KLJH 1E35B 3VB4A 2TBSA 3SOQA 3T27A 5EU8A 1DWDH 4BTIA 2FTMA 1HJAC 2D8WA 2VH6B 2OD3B 3ATKA 2OBQA 2CGAA 3LH3A 4ABGA 2JH0D 1TNJA 3TVJB 1NT1A 4OS7A 3RDZA 3LC3B 1S82A 4RRWA 1ZMJA 3M5MA 3LGWA 4JZFH 1XXDA 2CJIB 1BJUA 3KQCA 3CFWA 3SGAE 3LTGD 1TYNA 1FAXA 1O5DH 2P59A 1O2OA 4ABHA 3M3TA 4FM5A 2H5CA 1XXFA 1SGFG 1L3YA 2D1JB 1TBRH 6GCHG 3BTHE 4Y76B 4HGCA 1HUTH 1K36A 3KK6A 1K1LA 2BOXA 4AB9A 3SO3A 2C4FH 2Z94A 3ELAH 1D6WA 4ZROA 5FCRA 3AAUA 3DFLA 1ZYOA 3UQOA 2F9BH 1PGEA 3BTME 1LHEH 2GMTB 2QXHA 7LPRA 1YPHC 1RFNB 1PJPA 1SPJA 3A7XA 3BEIB 1SZBA 1P8VC 3GDUA 3N8XA 3NTGA 1S85A 2FODA 1XUGA 3A8BA 5ABWA 1G1TA 1ADXA 2VGCC 1LVMA 3ZVCA 1ZJKA 4WY3A 4YZUB 3E0PB 2BD7A 1P2IA 3SNCA 1KXFA 1NFUA 3A82A 2G00A 7GCHF 1CSOE 1G30B 1K1MA 1A7SA 1P3CA 3HKIB 1NRSH 5I46H 1D6RA 3JZ1B 3DHKH 3LTFB 5AFZH 2Z3DA 1O2IA 2WG4B 3SHAH 1QGFA 4ZHMU 1IQKL 1AVWA 1LPGB 2V35A 1K1JA 1KDQB 1GMDG 1MCTA 3V64C 4AB8A 3T5FH 3RMMH 1MZAA 1CA8B 3SNAA 4ZKOU 2CMYA 4NIVA 1O37A 2P16L 1HJ9A 1GJ8B 1SGTA 2G55A 3R05A 1HIAA 2HALA 5LPEA 1PPZA 2GCTB 4RRYA 2BMGA 1LPKB 1SGYE 1VGCC 1F2SE 2J38B 1C5YB 1MZDA 4CHAC 2C8WB 2QXJA 3V65B 3U69H 4JZDL 1FY1A 1QQ4A 3OTJE 2WPLE 1EPTC 4AYYB 1NFYA 4MG3A 2FZZA 1EPIA 1F5LA 1AKSB 1UTQA 1GJBB 2THFB 1EQGA 4Y71B 4ABIA 1QA0A 1GBFA 3FCSB 1PPHE 1GCTB 1LPZB 3BT1A 2BOKL 4ZUHA 2G8TA 1B0FA 5F8ZA 4O9VA 3ZZAA 2D2DA 3RU4D 2WG3C 4MVNA 2ZDNA 2FOMB 5TCAA 3Q7DA 5DP9A 1NESE 1O31A 2H9EH 3P95A 1QB9A 4E7RG 2EI6B 5H4IB 5FXLA 1WQSA 3VB6A 2SNVA 5FBIA 1WOFA 4ZXYL 3IJEB 2FP7B 2FPZA 1GDUA 5EGMA 5C5OA 1E38B 2Y81B 1UCYH 1V3XA 1ZSLA 2VIWA 3GCHC 2FEQH 4Y0YE 1HAHH 4K1EA 4D8NA 2Z9KA 3MDLA 1MH0A 2WPLS 1O3NA 4UDWH 1C2FA 4PH9A 1HB0B 4K60A 1XKAC 1IQKA 2R3UA 1F0SB 3QO6A 5DG6A 2HPPH 1S83A 1F7ZA 1GHBF 3C27B 1INCA 3TK5B 3A81A 1P9JA 1FUJA 2ZTYA 5HMAA 3TGJE 2P16A 1W3CA 3T25A 3RXGA 3TPIZ 4X6OA 2ZTZA 3MI4A 3HPTA 1K9OE 1VCQA 3Q00A 1RGQA 2WUCA 1ZMNA 4C16A 4O03A 1GHWH 1P3EA 1PPFE 1GVZA 4SGBE 3VB7A 3SU4A 1BTUA 3M36L 5EPNA 3S69A 4JZDH 1SVPA 1FZZA 1O2QA 4KKDA 4J1YA 3A7TA 2BOKA 4I32A 1TPPA 4YM9A 2DE8A 1L1NA 1RD3B 2BZAA 1G1QA 4O3TA 2OUAA 3RM0H 1LQDB 5EOKA 2ZU4A 3ATLA 3UNQA 1X7AL 1SOZA 3POYA 2HNTC 1FNIA 1Z1IA 2P26A 1CHOG 1ZTJA 2AGEX 2XW9A 3ZZ9A 1O5EH 1YF4A 1DX5I 4INHA 3GY6A 5E2PA 2VVUL 4ZXYH 4WJG2 3SJKA 1MAXA 3SU1A 3A7ZA 1EQHA 2STBE 2W2OE 2W7UA 1EMNA 1Y3UA 3E0NB 2G4UA 4XBDA 1FY5A 2WPJS 4X0WU 2D1JA 2W26A 2VH0B 4Y76A 4NSVA 4FUFA 3K2UA 4FUIA 1QB6A 1BTHH 3ZZ4A 1CGJE 1BMMH 2ZDLA 3RXOA 2KL7A 1GJ9B 1CBWC 1N8OB 1U8CB 1BTPA 2I9AA 2RHPA 2MHPA 4AFSA 4X6NA 1Q2WA 1MKXK 1YPKH 2UWLB 2OP9A 1RFNA 1C1VH 3RMLH 3MOCA 1U67A 3QCWA 1GGDC 2SFAA 2Y5FL 1C1OA 3TNSA 3LGVA 2BHGA 1MD8A 3M36A 4D76A 2Z9IA 3NZIA 1E0FD 4YOJA 1CQQA 4YZUA 3QLPH 4KGAA 2XNIA 5JB9S 5F19A 2CHAC 1K1OA 1PFXL 2UWOB 2NU3E 1IQGL 4AGJA 2FS9A 2A7CA 3N8YB 2A4OA 3P6ZB 4IW4E 1AE8H 1KIGL 3SUEA 3ZVEA 4GHTA 4JZIA 1RTKA 1LPGA 1PPEE 2H5DA 1KDQA 2Y5GA 3FANA 1PQ7A 1QJ6B 1DDJA 3C1KA 4INKA 4X2XA 4LORA 1AFQC 1TX6A 1TOMH 3KIDU 2VVUA 1DWCH 1O3JA 3RXPA 1BBRH 1ID5H 1LPKA 1HAYB 3SV7A 2J38A 4MQAA 3RXAA 1SQOA 1GG6C 1W7XL 2FDAA 1UK3A 2CV3A 2ANYA 4F49A 4CH8B 3ZVGA 1HDTH 1GBAA 2QGRA 1GBLA 1TQ7B 4B1TA 2ZQ2A 1AKSA 1B9WA 1UMAH 2WPME 5DJ7A 4ABEA 1O2XA 4YOGA 1GDNA 1IAUA 1MBQA 2FOEA 4X1QU 1XM1A 2VJ1A 4QT8C 3RU4E 1XDTR 2ZU3A 2J94A 3LC5B 3RXFA 3QH0A 2FLBL 2GT7A 1F0UA 1CCVA 1QTFA 1G3EA 3MMGA 3GY3A 4BXSA 1GI8B 2EI6A 3T29A 1N1IA 3BPSE 9ESTA 3KCGH 3GYMA 2Y81A 4BDWA 1NRPH 3PO1C 4OS6A 2WPIE 2BX3A 1G1RA 1IQGA 1MQ5A 2WINI 4BNRA 1CQEA 2Q1JB 2G51A 1GHVH 2AYWA 1F0SA 2A4RA 1O2WA 2BDCA 2QAAA 3LPRA 4O97A 3TK5A 1KIGH 2BLOA 1YCPM 3NUMA 3U8RH 4D0EA 1GI7B 1YPEH 1TA6A 1BIOA 2AEIH 2C93B 3N8VA 5IKTA 2PTNA 2A5AA 2ZFTA 1DDXA 1MTNC 3PWBA 3TK6B 4A1VA 2BDHA 2WPIS 4TWYA 5A09A 1IOXA 4CRGA 1BRBE 1AGJA 3LN1A 1HYLA 1W7XH 3E6PH 1EP5A 5JB8E 2VIPA 1LHCH 2ZI2H 2Z9JA 1OWEA 3TZIA 1P2QA 3FP7E 3PLPA 4BDXA 1DXPA 1FV9A 1KTTB 4MNVA 1IVOC 1HJAB 1GBJA 1LQDA 1H9LB 1GJAB 1T32A 5DP6A 3VB3A 1SB1H 2A0QB 1UVOA 2UUKB 1Y3YA 1P02A 2AERH 1UTKA 1HT8A 1G36A 3MU0A 3CA7A 2ZKSA 1M1XB 3NCLA 1DT2A 2FLBH 2HNTF 1HAXB 2R0LA 2ZDMA 2GVFA 1TALA 3GDVA 5C20A 1O2YA 2NU0E 4MNYA 5HXFA 3T62A 3SUDA 1UCYK 3BTGE 3L3TA 3BTKE 1O2KA 1BOQA 1KXDA 2ZF0H 4UEHH 1J8AA 2O8WA 5JBTA 4Z0KB 3ASIA 1O2VA 2VH0A 3TGKE 2G4TA 1SHYA 1S81A 3BF6H 3FP6E 2ZCKP 1UVTH 1QRZA 4IC5A 1GHZA 2BO2A 4X6PA 1XX9A 2Q6FA 2VGCB 4U2WA 1YGCL 1ABIH 3HO3A 1O3GA 2EC9H 2WPHE 3SJ9A 4XLWA 1EJNA 4BAHB 1AUTL 1DIYA 1ANBA 1HFDA 1VCPA 1Z6CA 3ZV9A 1BB0B 3TITA 2ZIQH 3PM3A 1T4VH 4NZQA 3S9CA 1O2SA 3RXIA 4Y7AB 1RTFB 4UFGH 5DKMA 3D49H 4B2AA 2A31A 2UWOA 1EUFA 5JBAE 5J4QA 3N8YA 3SHCH 1DLKB 4X2VA 2BD8A 4I7YH 5F6MA 2DDUA 1OWJA 4YLQH 2YOLA 2ZDAH 4ABAA 4WH6A 1VGCB 4CHAB 5CE1A 2HLCA 5E0JA 4RRZA 1OKXA 4KP0A 2ZCLP 3SW2B 1EPTB 1T8MA 2AS9A 2QIQA 2UUJB 1FJSL 3CS7L 4RKOB 8GCHF 1TAWA 5F1AA 1QBOA 4JZEL 2ZGHA 4WMEA 1ELEE 1P11E 3M37L 2WFXB 1GBEA 4M7GA 1AIXH 1GMHF 1LTOA 1L5GB 3NJPC 3QWCH 1DSUA 2RA3A 3QGJA 3F68H 5FX5A 1NC6A 3Q3KB 1V2QT 4OGYA 1TIOA 6CHAC 4I8HA 3UNRA 2XBWA 3LIWB 1IQLL 1DX5M 1Y5AT 3M3VA 1A0JA 3LC5A 1DXWA 4XL1A 2J34B 3LGUA 1EPHA 3SV6A 3GCHB 2IOTA 3LDXH 5FPSA 1YGCH 2BY9X 3D65E 3TJNA 4E7NA 1WHFA 2FOCA 1Z1JA 1BMNH 3D62A 4B2CA 1V2TT 1HREA 3RXSA 1SG8B 3IG6B 1EJMA 3MNSA 1ZR0A 2BOHA 1Z6EL 1CGHA 1WTGH 1B5GH 5GXPA 1THPB 1FE2A 4NA8A 1IGZA 1J9CL 3ZV8A 1Q3XA 2QXIA 3B8JA 3FFGL 1VJ9U 3RC4A 1LVOA 4E1GA 1ESBA 2VIVA 3HO5A 3DFJA 1SLUB 1BTZA 1A3EH 1P2JA 1IGXA 2H9TH 1G3CA 1YPLH 1HRFA 3TJUA 3LJOA 3Q77A 5C5NA 4A1XA 1C5QA 1UVUH 2HRVA 4AQTA 3NK8A 2BM2A 5JBBS 1FJSA 1QRWA 3CS7A 1F7MA 4AZ2B 3MH7A 3M37A 6COXA 1OSSA 5E0GA 3TK6A 1NFYB 2FOAA 4NFEA 3M7UA 2J9NA 3GISB 1P2OA 4YT7L 4JZEH 4TWWA 4UFFH 4R8TB 2QCYA 3ZZ8A 2ZG0H 1ESAA 1I0UA 1EOJA 3S9BA 2GZ8A 3KN2A 3HO4A 2FOBA 4I8JA 1IQLA 1JIRA 1QR3E 3QDZB 4XBMA 4G1MB 1V2RT 4MTBA 1O2NA 1DLEA 3ZZ5A 4LOYH 1PPCE 1SGPE 3BG4C 3UR6A 1FN8A 3LONA 3OSYA 4X8VL 1G2LB 4ISHL 1GMCF 1XKBC 5EGMB 2W7SA 1AUTC 4KELA 1DQBA 4B2BA 4NA7A 3U8TH 1LHDH 4RS0A 5JBCE 2SGQE 1GVKB 1Z8IB 3E1XB 1TRMA 1C1UH 4CUFA 4FVDA 1Z6EA 1EB1H 1C5WB 1O3FA 3V12A 1KLOA 2BDAA 5CMXH 5C67A 1CBWB 4Z0KA 1NRQH 4BAOB 2STAE 1RTLA 3FFGA 1GL1A 4OS2A 1LVBA 3V7TA 1AVGH 1FIZA 1UZJA 1J9CH 1BF9A 4OTJA 5GCHG 4JYVL 1SLXB 1GGDB 5DP5A 2EEKA 1C2IA 1CE5A 1SHHB 4X2YA 1ZPBA 2A2QH 1D3QB 1GDQA 1BMLA 2BLQA 4AX9H 4Y0ZE 1WTHD 2CHAB 2P28B 1A5IA 5JBCS 1TNKA 5IYTA 3O8RA 3M7TA 1ELBA 1ZPZA 3Q3YA 2GCHG 1AQ7A 5FPYA 5BPEA 2Z9LA 3A7VA 4Y7AA 1UTNA 2OYUP 1XKAL 1DOJA 1YBWA 1BTXA 1JBUL 4YT7H 3RXMA 1SOTA 3GCNA 3M5NA 4GLYA 2ZQ1A 4YO9A 1AI8H 1IP0A 1ZRKA 3UUZA 2BQWA 1AFQB 3MWIU 2BD2A 1IJQA 4BANB 3SU2A 1A46H 4M10A 1OWKA 3STIA 1ELVA 1GG6B 2OINA 4X8VH 1T8LA 3MO9A 4ISHH 3UPEA 2WPKE 2ZGBH 3SW2A 4MNWA 1EPTA 1C4V2 1NROH 1TPOA 1TABE 1QCPA 2GTBA 2ZO3H 3ODFA 2YNAA 1YPJH 1QBVH 1L4ZA 2ZA5A 2W26B 3BIVH 5FDQA 1IHSH 3A84A 1SGDE 4Y7BB 1CEJA 2WV4A 2WV5A 4FUBA 3HS7A 3ATIA 1AUJA 3FVFB 3Q3KA 3TGIE 1ATDA 2FOHA 1BBRE 1SQTA 2OXSA 3F9EA 2H9EL 3LIWA 4NWKA 3EE0B 4OS5A 3SI4H 5GDSH 3PMAB 2CF9H 5LPFA 2J34A 1TGNA 2FIRH 4JYVH 1P09A 3M5LA 3AW1A 5CKQA 3PO1B 3SQHE 3HS5A 4I31A 3EGKH 1AU8A 2WYGA 4FUCA 2F9OA 2FI4E 4IMQA 2WPKS 3GDSA 1ZSKA 1G32B 2FTLE 1Z8GA 3KF2A 5JW1A 1DUAA 3SBKA 4IN2A 3RXTA 4HZHA 1UTOA 4TY7A 1GJ6A 1GBDA 1C1WH 1UTMA 2R0KA 3SU3A 1P9SA 2O8MA 5DO4H 1YLCA 3KHVA 1SGQE 3KQBL 1O34A 3IITA 1YPGH 1JBUH 1XUIA 2BDGA 3QTVH 3RU4T 2SGDE 4NZLA 1CGIE 1O35A 1P03A 1DPOA 4DGJA 5EQSA 4DOQA 2OTVA 4K2YA 1F5RA 3V3MA 4HTCH 5E2OA 1MTNB 1YKTA 4CUDA 4LK4A 3D23A 2OC0A 4K1SA 1VITG 3KRKA 2CF8H 1W11U 4TPYA 5JDUB 3BEUA 4CRCA 2WYJA 1P2MA 2ZGCA 1BHXF 2VVVL 1NFXB 1OYTH 1W8BL 1P9UA 3QZQA 1TNGA 2ASUB 5L2YL 1SGCA 3OLTA 2BD4A 4XBBA 3BTTE 1IQNL 1IQHL 1K1PA 1V2LT 5A0AE 3TNTA 1THRH 1NT0A 2J94B 1CCFA 4HI3A 1ELDE 1RIWC 3A7YA 1BRAA 2FD6A 1O3CA 2GX4A 1C1RA 1HAZB 4YTAA 3U98H 1C2HA 2W2QE 1G2LA 5L30L 3GCXE 4AFZA 4OS4A 1V2ST 5C3NA 1A61H 1HAIH 1IQJL 1O5BB 3CP7A 1ZOMA 1TGTA 3KQBA 2UWPB 2MGPA 8KME2 1BMAA 5T3HA 1QURH 4NCYA 2BY6X 3UR9A 1H9HE 3HS6A 1XVMA 1WV7H 1K28D 2V6NA 2K1QA 4NG9L 4MMYB 2VB0A 1CU1A 4O02B 1PYTC 2ZU1A 4Y10E 1C2DA 1JRSA 1C5MF 3PLKA 3UIRA 2VVVA 3SQEE 9LPRA 1Y8TA 4FUJA 4GHQA 3EDXB 2F3CE 1BRCE 1C2EA 4NGAL 2K2SB 2PR3B 2WPJE 1HAEA 1TE0A 1W8BH 1SI5H 1IQNA 1VCWA 2XTTB 1YUFA 1IQHA 4I8GA 3QN7A 5L2ZL 2KB9A 2PKAA 2OC7A 2RCEA 5L2YH 2BXTH 4Q7YA 3A7WA 1QNJA 2QYIA 3UOPA 2AMPA 2LPRA 5TJXA 4AFQA 4ISLA 3SNEA 2W2PE 3ZVFA 1SFQB 2HOBA 4GAWA 3QMOA 4PROA 1PXXA 5L30H 1OYQA 1IQJA 2ULLA 2BB4A 5JB9E 4KTSA 3GCTF 3MU1A 1JRTA 1HGTH 4GCHF 1NY22 1O2GH 1FY8E 4DY7B 3S7HB 2NWNA 4RRXA 1O3EA 1UZPA 4E05H 1QB1A 6CHAB 1BTWA 2JETC 4Y7BA 2G5NA 3U1IB 1G1SA 4FXGH 1APOA 4UFDH 2G52A 5EG4A 1W7GH 1Y5BT 1TRNA 5EXLA 4BAMB 3KCGL 4YT6L
chains in the Genus database with same CATH superfamily
1D9IA 1EZXC 4NG9H 1EATA 5T6GA 5L6NH 2Y82B 1P01A 1O5FH 2C3SA 4XBCA 1LMJA 1ATEA 1MTSA 2O9QA 4TYDA 5IKVA 4CBOA 2JKHL 3BSQA 3RXVA 4Y8ZA 1PTHA 1HAPH 1WU1B 2ZHFH 3U28C 1GBMA 4NGAH 1O3BA 1EX3A 2PV9B 1NS3A 4K1TA 3SZNA 3T28A 3SOBB 2O8UA 2V3MA 4WH8A 1FI8A 3TBDA 3KGPA 2PUQL 1O2HA 5L2ZH 1MMJN 4WMFA 2GZ9A 2ZHDA 1OOKB 7GCHG 3B23B 3PV5A 3H09A 1NRRH 1BHXB 3EQ0H 1A2CH 3RXBA 1XVOA 6LPRA 1G3BA 2VWOL 2FO9A 1C9PA 3SJOA 2V3HH 2JH6D 4K8YA 4P00A 1GBBA 1JXPA 1WUNH 3V13A 3UWJH 2ZECA 1Z8JB 1NFXA 4THNH 3RXQA 1Y59T 3SUFA 3P5BL 3SJIA 1LKBA 4ZMAH 1HJ7A 1RRKA 3SNDA 3V0XA 3BG4B 3PMHB 3MYWA 1KY9A 1S6FA 3ZZ7A 3N7EA 1GHAF 2Y5FA 4U30A 1EPJA 1FQ3A 3ZZBA 4AC9A 4B6EA 2R9PA 3QTOH 3WY8A 1KYNA 1GI2A 2A7HA 5B6OA 1C9TA 4YT6H 3NPSA 2JKHA 1H8DH 1YPMH 4WWYA 1SLWB 1YCPH 4ESTE 1C5LH 3N99A 5A8XA 1T31A 3DD2H 3HGNA 1EKBB 2TGFA 2TIOA 1GI6A 2XOKD 2BOHB 4BAQB 4OS1A 4GPGA 1C1NA 2OCVB 1ZGVA 2VIDA 5CKMA 3FZZA 1YUGA 2UWPA 1Y5UT 4OTYA 3L33A 5F03A 5C1XA 1ZAQA 4TSFD 2I6SA 3A8AA 4RT1A 1SL3A 1C5VA 2PUQH 1A1RA 2OYEP 3SV2H 2W3IB 4K3JA 2VWOA 4MMXB 2TGDA 2ALVA 3URDA 1SLVB 4TPIZ 3ATMA 4A6LA 4P02A 4SGAE 2Y7XB 1GHBG 1ELAA 2I6QA 1OS8A 1C4U2 2ZU5A 1C2KA 3A88A 4DG4A 3CENL 2BT7A 2PR3A 1TOCB 3ZYGA 4ABFA 2QF3A 3O8BA 2BT8A 1ZTLA 1TA2A 1JOUB 4ZHLU 1IOEL 1FAKL 4XRNA 1E1QD 2FI5E 1SGEE 1HX2A 3VGCC 2FYRA 4X8SL 3RXHA 1O5GH 1ZSJA 3H7OA 1BMFD 3RXUA 1P04A 3IWMA 1TX7A 1U6QA 4CRBA 3RXCA 2BDIA 1TMUH 2Z7FE 2PSXA 4ZXXL 3AASA 1GBIA 1IQML 1UTLM 1E79D 2PFEA 1FY3A 2YMSC 4AORA 1ABJH 1HZ8A 1Z6JH 3BIUH 3TK9A 3E91A 4ISIH 4AG1A 4ZKRU 2VIQA 4A7IB 1V2PT 2XYAA 4NA9L 1NBME 2ILNA 2W86A 1C1PA 3SGBE 1XUKA 1G3DA 1RXPA 1O39A 2B9LA 1GVLA 1WSSH 1ZHPA 1ZTKA 2EI7A 3UREA 1DY9A 1YLDA 1HAVB 2M2AA 4FUHA 3E8LA 2FXRA 4YOIA 2Y82A 2D26C 4O1ZA 3U7UG 4AFUA 2W3KB 3OYPA 4IBLH 2BDBA 3CENA 2WZPP 1S0QA 2Y6TA 5K7RA 2AGGX 2FM2A 1C5UA 1PQAA 2FS8A 1BA8B 1D3TB 5GIBA 3UWIA 1RJXB 3S7KB 1WU1A 1FLEE 2AHME 2FMJA 3QX5H 5J4SA 4WVPE 1ZRBA 1IOEA 2YGOA 3F9GA 5EW1H 1Z71A 1C5XB 1FN6A 1LHGH 4MNXA 2BQWB 2RDLA 3ZVBA 2SGEE 3GY7A 4X1NU 2L74A 2A1DB 4CRFA 1VR1H 5TCCA 1FAKH 2ZU2A 4DT7B 4WXIA 4I8KA 1KMHB 2AH4X 3BTDE 3I77A 4X8SH 1CVWL 1VZQH 1IQMA 5FX6A 2RDEA 1OP0A 1P2NA 3RXDA 1OP8A 1QJ7B 1H4WA 3OFND 1ELTA 1EP6A 1UZKA 4WMDA 2JH5D 4ZXXH 4IS5A 3M35A 2WFTA 2GP9B 1PQ5A 2VJ3A 1O5CB 2ZTXA 2A7JA 2FOFA 5EW2H 7KMEH 3L6PA 3RC5A 1O3MA 3SN8A 1CT2E 1N6YA 3MQEA 2J4IA 2OQUA 2ZDVH 2RNLA 3P8FA 6GCHF 2FLRL 5FCKA 2C90B 1RIWB 4NA9H 3UOUA 1BZXE 2P3UB 5LH8A 1GBHA 2ZC9H 1HAOH 1E1RD 4CSYA 5KN5C 4CREA 3ZZDA 2PKSC 1XKBA 1AN1E 3Q76A 1A5GH 1ELFA 1KXEA 3N7DA 4NSYA 1EZQB 1NTPA 1FXYA 2WYGB 5JBBE 1HCGB 2VVCA 1QQUA 3ZZ6A 1JL9A 5IDKA 3EAJA 2AFQB 5GPIB 1EAUA 1FIWA 4I33A 2ZFFH 2Y5HL 3FKSD 3E3TA 4XOJA 1C2JA 1ACBE 3IITB 1A3PA 1QY6A 2BXUH 3SU6A 3AW0A 1E34B 2FX4A 1YO8A 4UONA 2WUBA 2ZPSA 3OX7U 1UCYE 1AZ8A 4ZKSU 3RXRA 1GMDF 1COUA 1CVUA 2R3YA 4UE7H 4IMZA 1QJ1B 2W3IA 1ZZZA 1EAIC 4H6SB 2ANKH 5CHAC 1KSNB 2QN5T 2BVXH 2ZFQH 5DP8A 2P3TB 2Y7XA 2LELA 5KIRA 1CVWH 2WYJB 1ZJDA 3PRDA 4MPUA 4NIYA 1AO5A 1A3BH 4CBNA 5KGOA 2BY8X 4U32A 1MU6B 2OLGA 4H4FA 3GY4A 1O3DA 4I8LA 4ZAEB 3SV9A 3A85A 3E16B 1O2TA 2BOUA 3GOVB 3RLWH 1O3LA 3GS9A 2F9NA 2FLRH 4ABDA 2BDYA 2BVRH 1FFMA 1TNIA 2F43B 2VNTA 1UVSH 1TBZH 3K6YA 3A87A 3MO6A 4K5ZA 3P17H 4MPWA 3WW7A 2A5KA 1O3AA 5FPTA 2PLXA 2EA3A 1APQA 1TMTH 4D0FA 4X2WA 3A80A 4LZ1H 1L4DA 1GJ7B 1EAWA 1TX8A 1W2KH 2F83A 5DK1A 1SGNE 1ANCA 3SV8A 2JETB 1DVAL 1YCPK 1HAFA 2BLVA 2Y5HA 3PMJA 4DT4A 1H8HD 1PRHA 1C5NH 4JK5A 1SKYE 3FP8E 4A7IA 1FDPA 5LPRA 1V2VT 1C2MA 2M74A 1TFXA 1GBTA 1DS2E 1XUHA 1WBGB 5HGGA 4F48B 1C2GA 3EE7A 1RS0A 1V2KT 3KQEL 1S84A 2Y7ZB 1NZQH 2H9HA 2LNCA 1K37A 4X8TL 2F9PA 1HAVA 4Y6DB 3LJJA 2DE9A 2SGPE 1SBWA 3LGYA 5COXA 4F55A 1G9IE 2R2WU 1S0RA 2XC4L 2W3KA 1JWTA 1ETRH 3ENSB 4FUDA 1OB1C 4ISOA 2ZHWH 3MFJA 3I29A 2C8XB 4IC6A 1MUEB 1E37B 2P3FN 3LKWA 4GU3A 2MGRA 1LMWB 1TLEA 1IQFL 2PKAB 1URKA 1EQ9A 1EGFA 1V2WT 2KX4A 1O38A 1QL8A 2DUCA 2ESTE 2HWLB 2C8ZB 3A8CA 4DIHH 3DSOA 2ZFPH 1FX0B 5JVZA 3DA9B 1LK9A 1DANH 3NKKA 4NIXA 2W2ME 1P05A 1W0ZU 1F5KU 2W5EA 1CHGA 3FAOA 4TT3D 3BTFE 4E06H 4AN7A 4ZHAB 2W6JD 4RUTA 1TWXB 1CHOF 1GI1A 2BD5A 1K2I1 2PGBB 1V2MT 4NIWA 4VGCC 4AOQA 1NPEB 4BAKB 1ANDA 1ZPCA 5FBEA 3S9AA 3HK6B 1BT7A 5EQRA 5E8EH 1PQ8A 1LDTT 4Z6AL 1DVAH 1LQEA 2ZHQH 3CS0A 2UUFB 2QE7D 3PLBA 1CA0C 1HNEE 3LH1A 2BZ6L 3KQEA 5EIYA 8GCHG 2P3UA 4CR5A 3HK3B 1C5PA 5HIYA 3LGTA 3RLYH 1GMHG 1QHRB 2PWXA 2ALPA 4IGDA 2EI8B 1EJAA 2KM0A 3T26A 4ZCNA 3K65B 4M11A 1DE7H 3VB5A 1EZQA 1HCGA 3OU0A 2XC4A 4BTUB 2FZZL 3BV9B 4X8TH 1O3IA 3TLOA 2M5TA 3VPKA 1CX2A 4FUEA 4AG2A 3UFAA 1YWUA 3U9AH 1F92A 1IQFA 4FU9A 3MNBA 2B7DL 3F9FA 4A92A 3BT2A 1ZGIA 1K21H 5T6DA 2FX6A 2GZ7A 1K1NA 2GD4B 3C9AC 2KCPA 1K1IA 2ZGXH 3TH2H 2A4QA 5A2MH 1AZZA 1EPGA 3R0FA 1BTYA 3NTBA 4B74A 4JYUL 1YYY1 1UTPA 1Y3WA 1C5TA 2ZWLH 1HRTH 1KSNA 3GCWE 5AF9H 1GJDB 2P3TA 4BXWA 2SNWA 3S6XA 2BY7X 2ZFRH 3RXKA 5A8YA 2QY0B 3ZVAA 2H1UA 3A89A 2NU2E 3K9XB 2VINA 4FUGA 1IQIL 4WF8A 2P94L 5IKQA 1XMNB 4D9RA 1TLDA 3QGNB 3FBYA 4ZAEA 2RFKC 4D7GA 4CH2B 4Z6AH 1ZHMA 1L2EA 3VGCB 4XDEA 3ATWA 3UNSA 5E8DA 2BZ6H 2VWMK 3H5CB 1C5MD 1DFPA 1K22H 1PPBH 4Q7XA 8LPRA 1ATBA 1AWFH 2AGIX 3M5OA 3HGPA 1UTJA 5DGJA 2AMQA 1TNHA 2ZFSA 1KTSB 2YMSB 1XUFA 2IN2A 1TGSZ 1FMGA 3GYLB 2HLDD 4Q7ZA 4LZ4B 1A0HB 3NT1A 2ODYB 2ODQA 3UTUH 1OP2A 2HVYB 1TPSA 3SU0A 1O2RA 4KTCA 3DT0H 1Z7KA 5C2ZA 1TRYA 1ZMLA 1GMCG 3P92A 2VVCK 4BTTB 3MU4A 5ESBA 1W14U 1AHTH 2B7DH 1QFKL 1UJ1A 3QZRA 3ZYJB 1J16A 2ADXA 1S5SA 1CT4E 2QF4A 3LOXA 1LVYA 2XBVL 2XRCA 2F9VA 2Y7ZA 5GJ4B 4K69A 1H8IH 1Z8RA 3BEFB 1MKWH 1EZSC 1OX1A 4JYUH 1AB9C 3OE7D 3KEEA 2J95B 1C1QA 4Y6DA 1AD8H 1MAYA 3FZDA 5EPYA 2GDDA 4A5TS 2G5VA 3FO8D 1ZLRA 1IQIA 3ZZ3A 2TGTA 2P94A 3ENSA 1V2UT 5DPAA 2PHBB 5JPMH 1QBNA 1LKAA 3DEMA 3GY8A 2AIQA 1C4Y2 2WHXA 3KL6B 1OXGA 3SORA 4NWLA 5EODA 2XC0L 1NPMA 4JMYA 2QC2A 1G2MB 1YM0A 5FAHA 4BOHA 3HATH 1AMHA 4MDSA 1J17T 1DM4B 1T8OA 1TMBH 4X1SU 1WXRA 3RR3A 1XFEA 4R0IA 1M9UA 4I86A 3DSGA 2J92A 4ZHAA 5F53A 1SGFA 1GJ5H 2TRMA 1GI3A 3TH4H 1V2OT 2XWAA 3OY5U 1WAYB 2P3FL 3PROA 1P06A 3QUMP 3RMOH 2ODPA 3PV4A 4X1PU 3ESTA 2Y5GL 1YY3A 4DCDA 4LMFA 2VH6A 1O33A 1DY8A 2XBVA 2B8OH 2PKSB 3LC3A 4DIIH 1QFKH 4B73A 2CJIA 4XFQA 2ZHEH 1O3PB 3BTQE 2EI7B 5K0HB 1L1GA 2IPHA 1OHHD 3UY9A 4DURA 2EI8A 1P2KA 5CISA 3MHWU 3RP2A 3QK1A 2HPQH 4FETA 1BRUP 1NRNH 4FVBA 5HM9A 1DUEA 3BTEE 2XC5L 7ESTE 1TPGA 1GHXH 4BTUA 1DICA 3OLUA 1N6XA 2SGAA 5IKRA 1UHBB 4Y11E 2Q6GA 2FWWA 1BUIA 2BX4A 3O8DA 1TGBA 2O8LA 1V2NT 2BD9A 1QL9A 4MLFB 3A86A 1GK5A 1ELGA 2XC0A 3VG8A 2Z3EA 2GD4A 2TGAA 1MBMA 2ANWA 2FYQA 2A4GA 3EA7A 2Z9GA 3PMBB 5F8XA 3SYJA 5I25A 5CHAB 1NQLB 3B9FH 2UUYA 4UD9H 1NFWB 3A83A 4D7FA 1ORFA 3N7OA 2P8OC 4JK6A 3M7QA 1MQ5L 1MU8B 1G37A 1GJCB 4M9FA 4B76A 1UK4A 2Y80B 1LHFH 4LXBH 1MTVA 1VITH 1EAXA 2H6MA 3NWUA 1CT0E 3ZVDA 1UO6A 1TONA 3K9XA 4JCNA 1AFEH 1C1SA 1OWDA 4X6MA 2J4IB 5JVYA 2NU1E 2P3FH 3RC6A 1GI9B 4D9QA 2PSYA 3PYHA 1EZUC 1ETTH 3K6ZA 1UK2A 1W10U 5EXNA 1BJVA 4Y8XA 4H42U 1NU7B 1FSBA 4GVUA 1PYTD 3ODDA 1GJ4H 1A5HA 1DSTA 1W12U 5A0BA 3PV2A 1C2LA 1P12E 5CHBA 2HVXA 3VXFH 3TH3L 2KCYA 2XC5A 4A94C 2OC1A 1ARBA 1TQ0B 1T7CA 4RT0A 4ABBA 4Y71A 3TJVA 3LN0A 1TBQH 4ISIL 4ZH8B 1O2LA 3EA8A 1HAGE 3H7TA 1MCVA 1S6HA 1LPZA 1F0TA 3PB1E 3F9HA 3TGFA 4HFPB 4B71A 2VWLL 2ZDKA 3SU5A 3F1SB 1S6LA 2J98B 3VEQB 3ZYIB 1OPHB 1O30A 2GMTC 2B0FA 4BTTA 2J2UB 3GICB 2XBXL 1LO6A 3OEED 5DP3A 2PP6A 3PTBA 1O2MA 3LGIA 1Y3XA 4ASHA 3F6UL 2TPIZ 4OGXA 5LGOA 2ZCHP 1EOLA 2QV1A 3F2FA 3VXEH 3T2NA 3N8WB 1AVXA 1MTWA 3URCA 1MOXC 2C8YB 3KQ5A 3W95A 3I78A 2CN0H 2Y38A 1HT5A 2EQNA 5JYIA 2J95A 2WPMS 1J15A 3EA9A 5AVDA 1UZQA 1IHTH 3TU7H 2BYAX 1NN6A 5SGAE 3MTYA 2V3OH 2P95L 2QF0A 3SOVA 2QXGA 3RUOA 1B0EA 2PHBA 2HGTH 2YNBA 1X7AC 2ANMH 4AYVB 1O3OA 1YPHE 4KTUA 4WXVA 2GKVE 2SGFE 3KL6A 5EXMA 1V1HA 1SMFE 1LCYA 2PTCE 1FONA 1G2MA 3GY5A 1TB6H 3RXLA 2GCTC 3P8NA 5BRRE 1O3KA 5DP7A 4DVAU 5E0HA 1THSH 1P0SL 2F91A 4VGCB 1D3DB 2G81E 1O2PA 1ANEA 5F8TA 1EXFA 3TH3H 4GUXA 5G4BA 3HKJB 2KFWA 8ESTE 2VWLA 1F0RB 4RN6A 4YLUA 4Y79B 1L1JA 1O0DH 4TY6A 4X1RU 1HV7A 5FHTA 1CA0B 1GCTC 4X8UL 4XSKU 5EJLA 1C5RA 2XBXA 3GCOA 4RKJB 1BQYA 1EB2A 1EASA 1O2JA 1C1TA 4NFFA 4ABJA 4DJZB 1KLIL 3GCTG 4GCHG 2FLGA 1C5OH 2BQ6B 3MNCA 4JYTA 5GCHF 1KXBA 1OWHA 1O5AB 2RA0L 3F6UH 5K0HA 1PFXC 3DUXH 2VWNL 5AHGH 1A0LA 4DW2U 2A2XH 3S0NA 3Q3XA 5JB8S 2BD3A 1MKWK 1ESTA 4O3UA 3RMNH 1J14A 4INLA 1F7EA 2P95A 2GV7A 3LT3A 3VFEA 1UHBA 2GCHF 3BN9A 2JIZD 2BQ7B 3U73A 5ETXA 1JV2B 1O32A 5DP4A 2XBWL 3GISX 2UWLA 1C5ZB 2ZNKH 3SJ8A 5C1UA 3P70B 1HJ8A 2ZPRA 3U1JB 1TGCA 3PRBA 1AWHB 2ZPQA 2FESH 3M3SA 1ZHRA 1Q31A 3U8OH 1EAIA 4RSPA 1MTUA 5A0CA 3AAVA 3MU5A 2K2TA 3EGFA 1NFWA 3FN8A 1DITH 2I9BA 1D3PB 2KAIB 2XCFA 5C0TA 1HXEH 1WYKA 3M61U 1FPCH 1TNLA 1GPZA 2PUXB 1P0SH 1NU9A 2AIPA 5DN6D 2Y80A 1ATAA 2OBOA 5C1YA 2VWMA 1QA7A 1TPAE 3SOSA 4BTIB 2RG3A 3ZYEA 5KECA 1IQEL 3PTNA 3OY6U 2W2NE 2NPRA 1HXFH 2XXLA 4X8UH 1EMOA 3RM2H 1AE5A 4GSOA 3SGQE 1KXAA 1T4UH 4ISNA 2WPHS 3UQVA 1O36A 4Z1MD 1N1LA 1BITA 2KNIA 2QA9E 2GGVB 3AVZA 4D90A 1KLIH 4UFEH 3W94A 2RA0A 4CUEA 1FPHH 2VWNA 3ZZCA 4U01A 1OWIA 1BDAA 3LAQA 3TJOA 1L0ZA 1ETSH 2WZQA 1GHYH 1WHEA 2AMDA 2H2ZA 5JBAS 1H9IE 2OQ5A 1QIXB 1JMOH 1UVPA 1CO7E 2VU8E 2YGQA 4Z0LA 4ZH8A 4Q4LA 4MMZB 3E90B 1GHAG 2ZGJA 2BTCE 1FY4A 2J98A 4YESB 1QL7A 5HM2A 1N8OC 3P8GA 1V2JT 4FU8A 1Y3VA 1W0KD 1HPGA 4J2YB 2IJOB 1TOZA 2J2UA 2BY5X 2TGPZ 2HNTE 1B7XB 2BVSH 1ELCA 2BLWA 1NFUB 4K8BA 1SGRE 2HORA 1AB9B 3F3BA 1P10A 1AY6H 3R3GB 1DWBH 1SFIA 1JIMA 2V0BA 3N8WA 4H6TA 2YMSD 2Q1JA 3G01A 2OK5A 3ZYDA 1FF7A 3A8DA 1VITF 1GBKA 1YC0A 1IQEA 1W13U 2P93L 1GWAA 2NU4E 3LU9B 1GL0E 1KLTA 1MQ6L 1C1MA 1HIAB 1W0YH 1SR5C 2PGQB 3KYFA 4Q80A 3STJA 3O8CA 2BMGB 1Q4GA 1V1IA 2YGPA 1SGIB 3NXPA 3RXJA 5EQQA 4TGFA 1NZIA 3MNXA 2XBYL 3RXEA 1WQVH 2FOGA 2ZEBA 1BBRK 3PGHA 5CKNA 2A45B 4MPXA 1KLJL 3KQDL 1GCDA 1LMMA 3MH5A 3KNXA 4AGKA 3SNBA 1N7DA 2Q6DA 3P8OA 4A1TA 2OC8A 3SUGA 1GI0A 1DWEH 5ESTE 4COXA 1F0RA 1HBTH 1O2ZA 4Y79A 1WCZA 4Y8YA 2LP6A 2Z3CA 1SQAA 2F9UA 3PWCA 4ZKNU 4JZFL 5PTPA 4MPVA 2VIOA 1O2UA 3OEHD 1O5DL 3GY2A 4JZ1A 4XE4A 1V3XB 3BG8A 1GI4A 1EBVA 2B5TB 3SI3H 2AYLA 1YP9A 2PW8H 1SSXA 3KQCL 1MD7A 1FAXL 6ESTA 1XUJA 1BCUH 1H1BA 5T6FA 2BQ6A 4CRDA 4B6FA 3ELAL 1GBCA 2Z6BD 3ITIA 4CRAA 1T8NA 2FI3E 1KXCA 2XWBI 3N8ZA 2F9BL 1PPGE 1HLTH 2GT8A 3EYDA 1H8ED 1E36B 1P57B 4B75A 2KV4A 1ARCA 1MKXH 2P93A 3JZ2B 4CR9A 2A32A 1MQ6A 1SC8U 3MO3A 3MH6A 1A4WH 1GI5A 2GDEH 1D4PB 2EY4C 2BQ7A 2XCNA 4F4OC 3MU8A 1O3HA 3HPTB 2ZP0H 1C5SA 1SQRA 2CXVA 2XBYA 5A8ZA 4FU7A 2ZZUH 1NO9H 3TIUA 1YUKB 5I46L 2P8OB 5GWZA 1VJAU 3KQDA 1WDIA 2GV6A 4Q2KA 2O8TA 2G00L 3BTWE 3MH4A 5HYOA 1NM6A 3F2HA 1V6DA 5AFYH 2KAIA 2R2MB 4IN1A 1QRXA 2A5IA 3AK5A 1KLJH 1E35B 3VB4A 2TBSA 3SOQA 2VBCA 3T27A 5EU8A 1DWDH 4BTIA 2FTMA 1HJAC 2D8WA 2VH6B 2OD3B 3ATKA 2OBQA 2CGAA 3LH3A 4ABGA 2JH0D 1COWD 1TNJA 3TVJB 1NT1A 4OS7A 3RDZA 3LC3B 1S82A 4RRWA 1ZMJA 3M5MA 2IJD1 3LGWA 1XXDA 4JZFH 2CJIB 1BJUA 3KQCA 3CFWA 3SGAE 3LTGD 1TYNA 1FAXA 1O5DH 2P59A 1O2OA 4ABHA 3M3TA 4FM5A 4ACAA 2H5CA 1XXFA 1SGFG 2J5UA 1L3YA 5C0UA 2D1JB 1TBRH 2IPQX 6GCHG 3BTHE 4Y76B 4HGCA 1HUTH 1K36A 3KK6A 1K1LA 2BOXA 4AB9A 3SO3A 2C4FH 2Z94A 3ELAH 1D6WA 4ZROA 5FCRA 3AAUA 3DFLA 1ZYOA 3UQOA 2F9BH 1PGEA 3BTME 1LHEH 2GMTB 2QXHA 7LPRA 1YPHC 1RFNB 1PJPA 1SPJA 3A7XA 3BEIB 1SZBA 1P8VC 3GDUA 3N8XA 3NTGA 1S85A 2FODA 1XUGA 2XNDD 3A8BA 5ABWA 1G1TA 1ADXA 2VGCC 1LVMA 3ZVCA 1ZJKA 4WY3A 4YZUB 3E0PB 2BD7A 1P2IA 3SNCA 1KXFA 1NFUA 3A82A 2G00A 7GCHF 1CSOE 1G30B 1K1MA 1A7SA 1P3CA 3HKIB 1NRSH 5I46H 1D6RA 3JZ1B 3DHKH 3LTFB 5AFZH 2Z3DA 1O2IA 2WG4B 3SHAH 1QGFA 4ZHMU 1IQKL 1AVWA 1LPGB 2V35A 1K1JA 1KDQB 1GMDG 1MCTA 3V64C 4AB8A 3T5FH 3RMMH 1MZAA 1CA8B 3SNAA 4ZKOU 2CMYA 3UB0A 4NIVA 1O37A 2P16L 1HJ9A 1GJ8B 1SGTA 2G55A 3R05A 1HIAA 2HALA 5LPEA 1PPZA 2GCTB 4RRYA 2BMGA 1LPKB 1SGYE 1VGCC 1F2SE 2J38B 1C5YB 1MZDA 4CHAC 2C8WB 2QXJA 3V65B 3U69H 4JZDL 1FY1A 1QQ4A 4FOUC 3OTPA 3OTJE 2WPLE 1EPTC 4AYYB 1NFYA 4MG3A 2FZZA 1EPIA 1F5LA 1AKSB 1UTQA 1GJBB 2THFB 1EQGA 4Y71B 4ABIA 1QA0A 1GBFA 3FCSB 1PPHE 1GCTB 1LPZB 3BT1A 2BOKL 4ZUHA 2G8TA 1B0FA 5F8ZA 5HIZA 4O9VA 3ZZAA 2D2DA 3RU4D 2WG3C 4MVNA 2ZDNA 2FOMB 5TCAA 3Q7DA 4HG6A 5DP9A 1NESE 1O31A 2H9EH 3P95A 1QB9A 4E7RG 2EI6B 5FL7D 5H4IB 5FXLA 1WQSA 3VB6A 2SNVA 5FBIA 1WOFA 4ZXYL 3IJEB 2FP7B 2FPZA 1GDUA 5EGMA 5C5OA 1E38B 2Y81B 1UCYH 1V3XA 1ZSLA 2VIWA 3GCHC 2FEQH 4Y0YE 1HAHH 4K1EA 4D8NA 2Z9KA 3MDLA 1MH0A 2WPLS 1O3NA 4UDWH 1C2FA 4PH9A 1HB0B 4K60A 1XKAC 1IQKA 2R3UA 1F0SB 3QO6A 5DG6A 2HPPH 1S83A 1F7ZA 1GHBF 3C27B 1INCA 3TK5B 3A81A 1P9JA 1FUJA 2ZTYA 5HMAA 3TGJE 2P16A 1W3CA 3T25A 3RXGA 3TPIZ 2CK3D 4X6OA 2ZTZA 3MI4A 3HPTA 1K9OE 1VCQA 3Q00A 1RGQA 2WUCA 1ZMNA 4C16A 4O03A 1GHWH 5T1VA 1P3EA 1PPFE 3FOAA 1GVZA 4SGBE 3VB7A 3SU4A 1BTUA 3M36L 5EPNA 3S69A 4JZDH 1SVPA 2V7QD 1FZZA 1O2QA 4KKDA 4J1YA 3A7TA 2BOKA 4I32A 1TPPA 4YM9A 2DE8A 1L1NA 1RD3B 2BZAA 1G1QA 4O3TA 2OUAA 3RM0H 1LQDB 5EOKA 2ZU4A 2H9EC 3ATLA 3UNQA 1X7AL 1SOZA 3POYA 2HNTC 1FNIA 1Z1IA 2P26A 1CHOG 1ZTJA 2AGEX 2XW9A 3KYGA 3ZZ9A 1O5EH 1YF4A 1DX5I 4INHA 3GY6A 5E2PA 2VVUL 4ZXYH 4WJG2 3SJKA 1MAXA 3SU1A 3A7ZA 1EQHA 2STBE 2W2OE 2W7UA 3F0OA 1EMNA 1Y3UA 3E0NB 2G4UA 4XBDA 1FY5A 2WPJS 4X0WU 1UW7A 2D1JA 2VH0B 2W26A 3NRLA 4Y76A 4NSVA 4FUFA 5GNDA 3K2UA 4FUIA 1QB6A 5DSFA 1BTHH 3ZZ4A 1CGJE 1BMMH 2ZDLA 3RXOA 2KL7A 1GJ9B 1CBWC 1N8OB 1U8CB 3W1EA 1BTPA 2I9AA 2RHPA 2MHPA 4AFSA 4X6NA 1Q2WA 1MKXK 1YPKH 2UWLB 2OP9A 1RFNA 1C1VH 3RMLH 3MOCA 2HOXA 5C17A 1U67A 3QCWA 1GGDC 2SFAA 2Y5FL 1C1OA 3TNSA 3LGVA 2BHGA 1MD8A 3M36A 4D76A 2Z9IA 3NZIA 1E0FD 4YOJA 2J97A 1CQQA 4YZUA 3QLPH 4KGAA 2XNIA 5JB9S 5F19A 2CHAC 5C94A 1K1OA 1PFXL 2UWOB 1KKEA 2NU3E 1IQGL 4AGJA 2FS9A 4YXWD 2A7CA 3N8YB 2A4OA 3P6ZB 4IW4E 1AE8H 1KIGL 3SUEA 3ZVEA 4GHTA 4JZIA 1RTKA 4ASUD 1LPGA 1PPEE 2H5DA 1KDQA 2Y5GA 3FANA 1PQ7A 1QJ6B 1DDJA 2JDID 3C1KA 4INKA 4X2XA 4LORA 1AFQC 1TX6A 1TOMH 3KIDU 2VVUA 1DWCH 1O3JA 3RXPA 2JJLA 1BBRH 1ID5H 1LPKA 1HAYB 3SV7A 2J38A 4MQAA 3RXAA 2KZ4A 1SQOA 1GG6C 1W7XL 2FDAA 1UK3A 2CV3A 2ANYA 4F49A 4CH8B 3ZVGA 1HDTH 1GBAA 2QGRA 1GBLA 1TQ7B 4B1TA 2ZQ2A 1AKSA 1B9WA 1UMAH 2WPME 5DJ7A 4ABEA 1O2XA 4YOGA 1GDNA 1IAUA 1MBQA 2FOEA 4X1QU 1XM1A 2VJ1A 4QT8C 3RU4E 1XDTR 2ZU3A 2J94A 3LC5B 3RXFA 3QH0A 1MABB 2FLBL 2GT7A 1F0UA 1CCVA 1QTFA 1G3EA 3MMGA 3GY3A 4BXSA 1GI8B 2EI6A 3T29A 1N1IA 3BPSE 9ESTA 3KCGH 3GYMA 2Y81A 4BDWA 1NRPH 3PO1C 4OS6A 2WPIE 3MQKC 2BX3A 1G1RA 1IQGA 1MQ5A 2WINI 4BNRA 1CQEA 2Q1JB 2G51A 1GHVH 2AYWA 1F0SA 2A4RA 1O2WA 2BDCA 2QAAA 3LPRA 4O97A 3TK5A 1KIGH 2BLOA 2JJ1D 1YCPM 3NUMA 3U8RH 4D0EA 1GI7B 1YPEH 1TA6A 1BIOA 2AEIH 2C93B 3N8VA 5IKTA 2PTNA 2A5AA 3UAIC 2ZFTA 1DDXA 1MTNC 3PWBA 3TK6B 4A1VA 2BDHA 2WPIS 4TWYA 2KCAA 1IOXA 3F0PA 4CRGA 5A09A 1BRBE 1AGJA 3LN1A 1HYLA 1W7XH 3E6PH 1EP5A 5JB8E 2VIPA 1LHCH 2ZI2H 2Z9JA 1OWEA 3TZIA 1P2QA 3FP7E 3PLPA 4BDXA 1DXPA 1FV9A 1KTTB 4MNVA 1IVOC 1HJAB 1GBJA 1LQDA 1H9LB 1GJAB 1T32A 5DP6A 3VB3A 1SB1H 2A0QB 1UVOA 2UUKB 1Y3YA 1P02A 2AERH 1UTKA 1HT8A 1G36A 3MU0A 3CA7A 2ZKSA 1M1XB 3NCLA 1DT2A 2FLBH 2HNTF 1HAXB 2R0LA 2ZDMA 2GVFA 1TALA 3GDVA 5C20A 1O2YA 2NU0E 4MNYA 5HXFA 3T62A 3SUDA 1UCYK 3BTGE 3L3TA 3BTKE 1O2KA 1BOQA 1KXDA 2ZF0H 4UEHH 1J8AA 2K0QA 2O8WA 5JBTA 4Z0KB 3ASIA 1O2VA 2VH0A 3TGKE 2G4TA 1SHYA 1S81A 3BF6H 3FP6E 2ZCKP 1VKYA 1UVTH 1QRZA 4IC5A 1QIUA 1GHZA 2BO2A 4X6PA 1XX9A 2Q6FA 2BSFA 1YLNA 2VGCB 4U2WA 1YGCL 1ABIH 3HO3A 1O3GA 2EC9H 2WPHE 3SJ9A 4XLWA 1EJNA 4BAHB 1AUTL 1DIYA 1ANBA 1HFDA 1VCPA 1Z6CA 3ZV9A 1BB0B 2KR7A 2WV9A 2ZIQH 3PM3A 2JJ2D 1T4VH 4NZQA 3TITA 5IK2D 3S9CA 1O2SA 3RXIA 4Y7AB 1RTFB 4UFGH 5DKMA 3D49H 4B2AA 2A31A 2UWOA 1EUFA 5JBAE 5J4QA 3N8YA 3ZIAD 3SHCH 1DLKB 3CNRA 4X2VA 2BD8A 5EJ1A 5F6MA 2DDUA 4I7YH 1OWJA 4YLQH 2YOLA 2ZDAH 4ABAA 4WH6A 1VGCB 4CHAB 5CE1A 2HLCA 5E0JA 4RRZA 1OKXA 4KP0A 2ZCLP 3SW2B 1EPTB 1T8MA 2AS9A 2QIQA 2UUJB 1FJSL 3CS7L 4RKOB 8GCHF 1TAWA 5F1AA 1QBOA 4JZEL 2ZGHA 4WMEA 1ELEE 1P11E 3M37L 2WFXB 1GBEA 4M7GA 1AIXH 1GMHF 1LTOA 1L5GB 3NJPC 3QWCH 1DSUA 2RA3A 3QGJA 3F68H 5FX5A 3WWBA 1NC6A 3Q3KB 1V2QT 4OGYA 1TIOA 6CHAC 4I8HA 3UNRA 1K0HA 2XBWA 3LIWB 1IQLL 1DX5M 1Y5AT 3M3VA 1A0JA 3LC5A 1DXWA 4XL1A 2J34B 3LGUA 1EPHA 3SV6A 3GCHB 2IOTA 3LDXH 5FPSA 1YGCH 2BY9X 3D65E 3TJNA 4E7NA 1WHFA 2FOCA 1Z1JA 1BMNH 3D62A 4B2CA 1V2TT 1HREA 3RXSA 1SG8B 3IG6B 1EJMA 3MNSA 1ZR0A 2BOHA 1Z6EL 1CGHA 1WTGH 1B5GH 5GXPA 1THPB 1FE2A 4NA8A 1IGZA 1J9CL 3ZV8A 1Q3XA 2QXIA 3B8JA 3FFGL 1VJ9U 3RC4A 1LVOA 4E1GA 1ESBA 2VIVA 3HO5A 3DFJA 1SLUB 1BTZA 1A3EH 1P2JA 1IGXA 2H9TH 1G3CA 1YPLH 1HRFA 3TJUA 3LJOA 3Q77A 5C5NA 4A1XA 1C5QA 1UVUH 2W6ID 2VRSA 2HRVA 4AQTA 3NK8A 2BM2A 5JBBS 1FJSA 1QRWA 3CS7A 1F7MA 4AZ2B 3MH7A 3M37A 6COXA 1OSSA 5E0GA 3TK6A 1NFYB 2FOAA 4NFEA 3M7UA 2J9NA 3GISB 1P2OA 4YT7L 4JZEH 4TWWA 2KCOA 4UFFH 4R8TB 2QCYA 3ZZ8A 2ZG0H 1ESAA 1I0UA 1EOJA 3S9BA 3WWFA 2GZ8A 3KN2A 3HO4A 2FOBA 4I8JA 1IQLA 1JIRA 1QR3E 3QDZB 4XBMA 4G1MB 1V2RT 4MTBA 1O2NA 1DLEA 3ZZ5A 4LOYH 1PPCE 1SGPE 3BG4C 3UR6A 1FN8A 3LONA 3OSYA 4X8VL 1G2LB 4ISHL 1GMCF 1XKBC 5EGMB 2W7SA 1AUTC 4KELA 1DQBA 3DSPA 4NA7A 3U8TH 1LHDH 4RS0A 4B2BA 5JBCE 2SGQE 1GVKB 1Z8IB 3E1XB 1TRMA 1C1UH 4CUFA 4FVDA 1Z6EA 1EB1H 1C5WB 1O3FA 3V12A 1KLOA 2BDAA 5CMXH 5C67A 1CBWB 4Z0KA 1NRQH 4BAOB 2STAE 1RTLA 3FFGA 1GL1A 4OS2A 1LVBA 3V7TA 1AVGH 1FIZA 1UZJA 1J9CH 1BF9A 4OTJA 5GCHG 4JYVL 3F2GA 1SLXB 1GGDB 5DP5A 2EEKA 1C2IA 1CE5A 1SHHB 4X2YA 1ZPBA 2A2QH 1D3QB 1GDQA 1BMLA 2BLQA 4AX9H 5CDFE 4Y0ZE 1WTHD 2CHAB 2P28B 1A5IA 5JBCS 1TNKA 5IYTA 3O8RA 3M7TA 1ELBA 1ZPZA 3Q3YA 2GCHG 1AQ7A 5FPYA 5BPEA 2Z9LA 3A7VA 4Y7AA 1UTNA 2OYUP 1XKAL 1DOJA 1YBWA 1BTXA 1JBUL 4YT7H 3RXMA 1SOTA 3GCNA 3M5NA 4GLYA 2ZQ1A 4YO9A 1AI8H 1IP0A 1ZRKA 3UUZA 2BQWA 1AFQB 3MWIU 2BD2A 1IJQA 4BANB 3SU2A 1A46H 4M10A 1OWKA 3STIA 1ELVA 1GG6B 2OINA 4X8VH 1T8LA 3MO9A 4ISHH 3UPEA 2WPKE 2ZGBH 3SW2A 4MNWA 1EPTA 1C4V2 1NROH 1TPOA 1TABE 1QCPA 2GTBA 2ZO3H 3ODFA 2YNAA 1YPJH 1QBVH 1L4ZA 2ZA5A 2W26B 3BIVH 5FDQA 1IHSH 3A84A 4RI0A 1SGDE 4Y7BB 1CEJA 2WV4A 2WV5A 4FUBA 3HS7A 5EJZA 3ATIA 1AUJA 3FVFB 3Q3KA 3TGIE 1ATDA 2FOHA 1BBRE 1SQTA 2OXSA 3F9EA 2H9EL 3LIWA 4NWKA 3EE0B 4OS5A 3SI4H 5GDSH 3PMAB 2CF9H 2K8IA 5LPFA 3OAAD 2J34A 1TGNA 2FIRH 4JYVH 1P09A 3M5LA 3AW1A 5CKQA 3PO1B 3SQHE 3HS5A 4I31A 3EGKH 1AU8A 2WYGA 4FUCA 2F9OA 2FI4E 4IMQA 2WPKS 3GDSA 1ZSKA 1G32B 2FTLE 1Z8GA 3KF2A 5B6LA 5JW1A 1DUAA 3SBKA 4IN2A 3RXTA 4HZHA 1UTOA 4TY7A 1GJ6A 1GBDA 5KEDA 1C1WH 1UTMA 2R0KA 3SU3A 1P9SA 2O8MA 5DO4H 1YLCA 3KHVA 1SGQE 3KQBL 1O34A 3IITA 1YPGH 1JBUH 1XUIA 2BDGA 3QTVH 3RU4T 2SGDE 4NZLA 1CGIE 1O35A 1P03A 1DPOA 2WSSD 4DGJA 2WPDD 5EQSA 4DOQA 2OTVA 4K2YA 1F5RA 3V3MA 4HTCH 5E2OA 1MTNB 1YKTA 4CUDA 4LK4A 3D23A 2OC0A 4K1SA 1VITG 3KRKA 2CF8H 1W11U 4TPYA 5JDUB 3BEUA 4CRCA 2WYJA 1P2MA 2ZGCA 1BHXF 4XD7D 2VVVL 1NFXB 1OYTH 1W8BL 1P9UA 3QZQA 1TNGA 2ASUB 5L2YL 1SGCA 3OLTA 2BD4A 4XBBA 3BTTE 1IQNL 1IQHL 1K1PA 1V2LT 5A0AE 3TNTA 1THRH 1NT0A 2J94B 1CCFA 4HI3A 1ELDE 1RIWC 3A7YA 1BRAA 1EFRD 2FD6A 4GU4A 1O3CA 1C1RA 2GX4A 4OM9A 1HAZB 4YTAA 3U98H 1C2HA 2W2QE 1G2LA 5L30L 3GCXE 4AFZA 4OS4A 1V2ST 5C3NA 3SZEA 1A61H 1HAIH 1IQJL 1O5BB 2L6OA 3CP7A 1ZOMA 1TGTA 3KQBA 2UWPB 2MGPA 8KME2 1BMAA 5T3HA 1QURH 4NCYA 2BY6X 3UR9A 1H9HE 3HS6A 1XVMA 1WV7H 1K28D 2V6NA 2K1QA 4NG9L 4MMYB 2VB0A 1CU1A 4O02B 1PYTC 2ZU1A 4Y10E 1C2DA 1JRSA 1C5MF 1W0JD 3PLKA 3UIRA 2VVVA 3SQEE 9LPRA 1Y8TA 4FUJA 4GHQA 3EDXB 2F3CE 1BRCE 1C2EA 4NGAL 2K2SB 2PR3B 2WPJE 1HAEA 1TE0A 1W8BH 1SI5H 1IQNA 1VCWA 2XTTB 1YUFA 1IQHA 4I8GA 3QN7A 5L2ZL 2KB9A 2PKAA 2OC7A 2RCEA 5L2YH 2BXTH 4ACBA 4Q7YA 3A7WA 1QNJA 3DCLA 2QYIA 3UOPA 2AMPA 2LPRA 2F4LA 5TJXA 4AFQA 4ISLA 2QF5A 3SNEA 2W2PE 3ZVFA 1SFQB 2HOBA 4GAWA 3QMOA 4PROA 1PXXA 5L30H 1OYQA 1IQJA 2ULLA 2BB4A 5JB9E 4KTSA 3GCTF 3MU1A 1JRTA 1HGTH 4GCHF 1NY22 1O2GH 1FY8E 4DY7B 3S7HB 2NWNA 2GJGA 4RRXA 1O3EA 1UZPA 4E05H 1QB1A 6CHAB 1BTWA 2JETC 4Q63A 4Y7BA 2G5NA 3U1IB 1NBMD 1G1SA 1QZ8A 4FXGH 1APOA 4UFDH 2G52A 5EG4A 1W7GH 5HKKD 1Y5BT 1TRNA 5EXLA 4BAMB 3KCGL 4YT6L
chains in the Genus database with same CATH topology
1D9IA 1EZXC 4NG9H 1EATA 5T6GA 5L6NH 2Y82B 1P01A 1O5FH 2C3SA 4XBCA 1LMJA 1ATEA 1MTSA 2O9QA 4TYDA 5IKVA 4CBOA 2JKHL 3BSQA 3RXVA 4Y8ZA 1PTHA 1HAPH 1WU1B 2ZHFH 1GBMA 4NGAH 1O3BA 1EX3A 2PV9B 1NS3A 4K1TA 3SZNA 3T28A 3SOBB 2O8UA 4WH8A 1FI8A 3TBDA 3KGPA 2PUQL 1O2HA 5L2ZH 1MMJN 4WMFA 2GZ9A 2ZHDA 1OOKB 7GCHG 3B23B 1NRRH 1BHXB 3EQ0H 1A2CH 3RXBA 1XVOA 6LPRA 1G3BA 2VWOL 2FO9A 1C9PA 3SJOA 2V3HH 2JH6D 4K8YA 1GBBA 1JXPA 1WUNH 3V13A 3UWJH 2ZECA 1Z8JB 1NFXA 4THNH 3RXQA 1Y59T 3SUFA 3P5BL 3SJIA 1LKBA 4ZMAH 1HJ7A 1RRKA 3SNDA 3V0XA 3BG4B 3PMHB 3MYWA 1KY9A 1S6FA 3ZZ7A 1GHAF 2Y5FA 4U30A 1EPJA 1FQ3A 3ZZBA 2R9PA 3QTOH 3WY8A 1KYNA 1GI2A 2A7HA 5B6OA 1C9TA 4YT6H 3NPSA 2JKHA 1H8DH 1YPMH 4WWYA 1SLWB 1YCPH 4ESTE 1C5LH 5A8XA 1T31A 3DD2H 3HGNA 1EKBB 2TGFA 2TIOA 1GI6A 4BAQB 2BOHB 4OS1A 4GPGA 1C1NA 2OCVB 1ZGVA 2VIDA 5CKMA 3FZZA 1YUGA 2UWPA 1Y5UT 4OTYA 3L33A 5F03A 5C1XA 1ZAQA 2I6SA 3A8AA 1SL3A 1C5VA 2PUQH 1A1RA 2OYEP 3SV2H 2W3IB 4K3JA 2VWOA 4MMXB 2TGDA 2ALVA 3URDA 1SLVB 4TPIZ 3ATMA 4A6LA 4SGAE 2Y7XB 1GHBG 1ELAA 2I6QA 1OS8A 1C4U2 2ZU5A 1C2KA 3A88A 4DG4A 3CENL 2PR3A 1TOCB 3ZYGA 4ABFA 2QF3A 3O8BA 1ZTLA 1TA2A 1JOUB 4ZHLU 1IOEL 1FAKL 2FI5E 1SGEE 1HX2A 3VGCC 2FYRA 4X8SL 3RXHA 1O5GH 1ZSJA 3H7OA 3RXUA 1P04A 3IWMA 1TX7A 1U6QA 4CRBA 3RXCA 2BDIA 1TMUH 2Z7FE 2PSXA 4ZXXL 3AASA 1GBIA 1IQML 1UTLM 2PFEA 1FY3A 4AORA 1ABJH 1HZ8A 1Z6JH 3BIUH 3TK9A 3E91A 4ISIH 4AG1A 4ZKRU 2VIQA 4A7IB 1V2PT 2XYAA 4NA9L 2ILNA 2W86A 1C1PA 3SGBE 1XUKA 1G3DA 1RXPA 1O39A 2B9LA 1GVLA 1WSSH 1ZHPA 1ZTKA 2EI7A 3UREA 1DY9A 1YLDA 1HAVB 4FUHA 3E8LA 2FXRA 4YOIA 2Y82A 2D26C 4O1ZA 3U7UG 4AFUA 2W3KB 3OYPA 4IBLH 2BDBA 3CENA 2WZPP 1S0QA 2Y6TA 5K7RA 2AGGX 2FM2A 1C5UA 1PQAA 2FS8A 1BA8B 1D3TB 5GIBA 3UWIA 1RJXB 3S7KB 1WU1A 1FLEE 5J4SA 2FMJA 3QX5H 4WVPE 1ZRBA 1IOEA 2YGOA 3F9GA 5EW1H 1Z71A 1C5XB 1FN6A 1LHG