3F1SB

Crystal structure of protein z complexed with protein z-dependent inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
259
Chain Sequence
NECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Z-dependent protease inhibitor
publication title Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 66
structure length 259
sequence length 275
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3f1sB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB02
1YUGA 1DT2A 1ZSJA 2TBSA 5GDSH 2D1JB 2BDAA 1LQEA 4UFEH 1PPCE 2ZZUH 1C2LA 1C5MF 3GDUA 2SNWA 4BDWA 2ZKSA 1YPLH 2PV9B 4VGCC 5T6DA 5A8XA 2VWMK 4ISOA 3LDXH 1F7MA 2UUFB 5K0HB 4WH6A 3V65B 2BD5A 2V35A 1E38B 1TB6H 4ZKRU 4ISLA 2AH4X 4AYVB 1HT8A 3TPIZ 2GDEH 5C5OA 2AFQB 4CH2B 2C93B 2ZPQA 3PMJA 2FX4A 3LGTA 5ETXA 3E1XB 3Q3YA 1QFKH 3SNCA 4YLUA 2J34A 4XL1A 2UWPB 1M9UA 4CHAB 2BD7A 1HAXB 3MU0A 2WPJS 1HBTH 3RU4D 1CX2A 1O2WA 5CKMA 2OINA 1SGEE 4WY3A 2LPRA 4UFGH 1DLKB 1KLJH 4NG9L 1B0EA 1RFNB 2RDLA 3KN2A 3T25A 1NS3A 1IQJA 2EI7A 2FM2A 2Y7XA 3MO3A 1GJ6A 2W3KB 1WUNH 3ZVEA 2BMGA 1ZGIA 3TK9A 3RXHA 1ANCA 2GZ8A 5HMAA 1C9PA 2ZGBH 8ESTE 4DY7B 3PMBB 4NCYA 3ODDA 4CRGA 3DD2H 1JWTA 5LH8A 3GCNA 1C5PA 1Y5AT 2J4IA 1NFYB 3PGHA 1DS2E 4I31A 2TGFA 1O39A 2Y5FL 1GI1A 2HNTC 4AB8A 2VWMA 1YCPK 5JBAS 1UVSH 2D2DA 2R2MB 4B71A 1D3DB 1ELCA 4UEHH 5DG6A 1O3DA 5EOKA 1EOJA 1KTSB 3SU4A 1IQNL 3DEMA 1O31A 3FFGL 4JYUL 2J38B 1FXYA 3A83A 4HFPB 3UQVA 3ZZAA 1P11E 1HYLA 1KIGH 1SHYA 1L3YA 3VB6A 2BOXA 1SFIA 2C8YB 4X0WU 1D6WA 1K1MA 3S69A 3HS5A 2H5DA 1UMAH 1GHVH 5A0BA 1OWEA 1G1TA 3ATKA 4ABIA 4Z0KA 3HO4A 1C9TA 1MKXK 4X2WA 2EA3A 3T27A 4A7IB 1PGEA 5T6FA 4XSKU 3S0NA 1GPZA 1ACBE 1SGFA 3RXQA 2IOTA 4NIWA 5J4QA 1AO5A 3ELAL 4IW4E 4OS5A 3STIA 4AFZA 1FJSL 4ZKOU 3RLWH 2XBXA 4COXA 2W26B 3PWBA 4ZHAA 2H9TH 1EAIA 1EAUA 1GG6C 1O36A 3RC4A 3TH3L 2I6SA 3VXFH 2XC5L 3MH7A 5DP9A 1AVWA 1O2XA 4CR5A 2JETC 1T8MA 2IN2A 5A0CA 5JDUB 3UPEA 1W7GH 2R2WU 1BBRH 1QJ6B 3MNSA 1BRAA 2P3FN 2NPRA 3OY6U 4Y8XA 2FODA 1WAYB 1LPZA 3S9CA 3TZIA 1TNLA 1KDQB 1ESTA 1BHXF 1P09A 1TNKA 2A5KA 4KTSA 3ZZ3A 3U8TH 3C27B 1GJ4H 4ISIL 1O3JA 3GY2A 2PTNA 2ALVA 1H9IE 2PKSC 1OWHA 2XBVA 5LGOA 3KHVA 2AMQA 1H9HE 3GY7A 5FCRA 1A0LA 1FY1A 4ZMAH 2GD4B 1QCPA 1PPEE 3GY5A 4K1TA 1L1GA 1OWIA 1G2LA 3UNSA 6CHAC 3A81A 2WYJB 1S0QA 5J4SA 3LU9B 3SOBB 4C16A 1BIOA 2FZZA 3OLUA 1NT0A 1J8AA 2FDAA 4Y6DA 3SQEE 2P8OB 4K1SA 2G4TA 4TGFA 4YZUA 2W2NE 1AFEH 2G51A 2ANWA 1T7CA 2HALA 5C5NA 1D9IA 1RS0A 1O5AB 2ZQ1A 3DT0H 1NM6A 4CH8B 3TK6A 1B5GH 1NRNH 1N8OC 3RXAA 2F9NA 3QCWA 1TRYA 3LH1A 2ANMH 1OB1C 3LGWA 1B9WA 1T4UH 1F0UA 2BM2A 3TU7H 1TGTA 1CU1A 1YP9A 3RXIA 2YNBA 1A4WH 2VH6A 1GJ8B 1UHBB 1SOTA 2Y81A 1HREA 3TK5A 3M7UA 4K8BA 1CA8B 1A0JA 1AKSA 4OTYA 3LOXA 4MNYA 1MTNB 3M37L 4AQTA 4LORA 1Y5BT 3C9AC 1MCVA 1COUA 2ZQ2A 1C2FA 2WPME 1WBGB 2BZ6H 4A1XA 1EMNA 1P2QA 1VR1H 1V2OT 4X2XA 1L4ZA 3M5NA 3PM3A 1O2OA 5I46L 4Y76A 1C2GA 2HPQH 4KTCA 4ISNA 1DQBA 2QV1A 7GCHF 2FWWA 3BG4B 5HM9A 1ATDA 4X6OA 1HNEE 2VVVL 2ZGJA 4IMZA 4OTJA 1U8CB 1OWDA 1S81A 2FLBL 5CE1A 2UWOA 1UTMA 3I29A 1JOUB 4DCDA 4BTUA 3P5BL 1VGCC 1TWXB 2FOBA 1SLXB 3RDZA 3SNAA 3DFLA 1O3NA 1S5SA 2PFEA 1CO7E 1BBRE 1NRSH 1Z8JB 1PXXA 4NSVA 1KXEA 1MQ6L 3BN9A 1EATA 5DP6A 1A5IA 2HPPH 1YPMH 4Y10E 4XLWA 4CRBA 1SQAA 3BTGE 4D0FA 2AGEX 2O8LA 3NPSA 1IQNA 3FFGA 1Z6EL 1F0RB 1HJ7A 1GI3A 2FLRL 3NTGA 4ZXYL 3M5MA 1C1OA 1QIXB 1SSXA 3CA7A 7GCHG 2P95L 1K1NA 2OC1A 1W0YH 4ZHMU 3RP2A 4JK6A 3RXUA 8KME2 1GL0E 1C2MA 2BX4A 2WPHS 2BD8A 3GYMA 1H8DH 1L5GB 2H9EH 1NFWA 2OQUA 1EZQA 1LQDB 3Q76A 1XKBA 3SUEA 2OXSA 1XUFA 2ILNA 5JBCS 2BYAX 4PROA 2ADXA 1MKWH 3K9XB 2RNLA 5F19A 4AFUA 4E06H 1TOCB 4DW2U 1C5QA 2UWLA 1TLEA 1PQAA 3LJJA 1FJSA 2AGGX 3RUOA 1SC8U 3SU6A 4JK5A 4GLYA 1IQGL 3TNTA 4JZEH 3SV9A 4BNRA 3RM0H 1EP6A 2Z3DA 2XC5A 1W13U 1O3LA 3MMGA 1SQTA 1LHEH 5E0HA 2AYLA 5GCHF 1AQ7A 1QJ1B 4X8TH 2WV4A 2FEQH 2OC0A 4MVNA 1LMJA 1GDQA 5GPIB 1WYKA 3ZVFA 1C5RA 3BTME 2ZG0H 2Y80B 2BXUH 2M5TA 3PWCA 3A7VA 1NQLB 4THNH 5G4BA 2AMDA 2NU4E 5DKMA 2PKAA 3LJOA 4XE4A 1THPB 1DUEA 5AFZH 2P93A 1OWJA 3T5FH 3QDZB 2XC4L 2W3IA 3SUFA 3SV2H 1GCDA 3GY3A 1TPGA 1WQVH 3K6YA 2BD3A 1RIWB 2H5CA 3KQBL 2FOMB 1O38A 4OGXA 3F68H 5GCHG 1YO8A 1EZXC 2ZCLP 1C4Y2 2EI8A 2ZFRH 1P01A 4NA9L 3ASIA 2R0KA 2D8WA 3SU1A 3HO5A 1QJ7B 1W3CA 2J95A 1P02A 3KIDU 3PV4A 2Y38A 5TCCA 1MU6B 1SLWB 1J15A 3RMOH 1GHBF 2ZECA 2ZHDA 2FOHA 1TABE 2ZA5A 1TONA 2CN0H 4X6PA 1APOA 1TRNA 2O8WA 3NZIA 1XXFA 1NU7B 1HAYB 3DUXH 3U1IB 2FTLE 1BUIA 3LC5A 4INHA 4LXBH 4BXWA 1GHZA 4O97A 4K2YA 3A89A 4XBDA 2PUQH 2ZU3A 2Z6BD 1V3XB 1O3CA 3GCHC 1DANH 1K9OE 2A7HA 3A7WA 2TGTA 1MCTA 2BY5X 2ODQA 2BD4A 3FZDA 1VITF 1DVAL 3QMOA 5L30L 1OKXA 1TPPA 5AHGH 4Z6AL 3TGJE 4MPUA 1ZTLA 2QYIA 4BTIB 4FUBA 4IBLH 3MQEA 1CBWB 1UZJA 3SI3H 2OP9A 4MLFB 4YO9A 1F92A 1GHBG 3SUDA 3PO1C 3K2UA 1XFEA 1CA0C 3VGCB 1N1LA 4A1TA 3M3VA 1EQ9A 2ZP0H 4ZAEB 2F9PA 1BB0B 1YLDA 1V2NT 3TJVA 4A6LA 1LVMA 2VVVA 2Z9JA 1T8OA 2P28B 2FLGA 2MGRA 1EUFA 2ANKH 2FESH 3P70B 2KAIA 4K5ZA 1KXBA 1NESE 2VH0A 4GCHF 1TPAE 1VITG 1CCVA 4GVUA 2H6MA 3QN7A 1EAXA 4Y7AA 3OSYA 4YT7H 4JYVL 1QR3E 4FUCA 1J9CH 1YCPM 5A8ZA 1MQ6A 1UCYH 1KLIH 2WYGA 1GBJA 3ZVAA 3RXOA 1SGIB 4Y7BB 2AERH 4B2CA 1A3EH 1LPKB 5JB9E 2VJ1A 4TYDA 3RXEA 4WWYA 2ESTE 2J94A 2BOUA 1C1VH 5EW2H 2A5AA 1FAKL 1TNGA 1SHHB 4JZFH 3ENSB 1DWDH 1RTFB 4NIXA 1HDTH 3OU0A 1ID5H 3GCXE 3F9FA 2P3UA 3Q7DA 1ETSH 3ATMA 1OYQA 1XUHA 4NZLA 4AN7A 3MYWA 5L2YL 5GWZA 2W2ME 4GCHG 4X1SU 1TMTH 1YPHC 1S84A 4AGKA 2ZGCA 3BTDE 3ZVDA 4OS6A 3BTTE 4H6SB 1FY8E 3EAJA 1CQEA 3EGKH 3SU5A 3QWCH 3N8YB 3IITA 2FXRA 2RA3A 4O02B 2W86A 1IQGA 1GGDC 1JBUH 5EGMA 1OPHB 3RXDA 4DG4A 2SGQE 1JIMA 1FY5A 1O2UA 1C5LH 3LONA 1W8BH 2G8TA 4NIVA 2BOKA 1O5CB 3A7YA 2PR3A 3HGPA 4I8GA 2ZGXH 3Q3XA 4FUFA 1C5OH 1J17T 3ITIA 2A0QB 1NN6A 5GIBA 2CJIB 3QZRA 1KLOA 2XC4A 3T26A 2K2SB 1EPTA 1Q4GA 1C2JA 2GDDA 9ESTA 1HB0B 1EPGA 1K1PA 3MH6A 4Q7XA 2GMTB 3BEUA 1BTPA 1IHSH 3PMAB 1P2NA 4RKOB 4O9VA 1ELTA 1ZSKA 3KQBA 2B8OH 4YOJA 1NC6A 5FX6A 4I32A 4DOQA 4FVBA 2ZCKP 4BAHB 5I25A 1SL3A 3A88A 2K1QA 4AFSA 5A09A 5TJXA 4D0EA 5JYIA 2BD2A 3AAUA 1SGQE 3F6UH 1A5GH 4NA8A 2J2UA 2ZWLH 1GJCB 3GICB 1JMOH 1GI6A 1HAVA 1AI8H 1PPGE 3A8BA 5DGJA 5A2MH 6ESTA 3SW2A 1BMNH 2BDCA 4GUXA 1HUTH 1IP0A 1XUGA 1LPGA 1Y5UT 2CHAB 1FMGA 1EAIC 1DY8A 1MD8A 1O5GH 2BDBA 5KIRA 1GBDA 1JRSA 3N8XA 4ZH8B 1CHOF 1P9UA 2A1DB 3RXLA 1TMUH 4TWYA 3TH4H 1E37B 6LPRA 3ZZCA 1NTPA 5HYOA 1IQLA 4GHTA 3F9GA 1GDUA 3LC3A 1QBOA 2XW9A 4F49A 1KSNA 1BTUA 2TGDA 2Z7FE 3M3TA 2NU0E 5C1XA 1K2I1 1ZR0A 1P0SH 2BQWB 1GI0A 2C90B 2YNAA 3UY9A 2SGEE 4X8UH 2QIQA 3P95A 3NWUA 1TYNA 2B9LA 2SFAA 3KGPA 5JVZA 1ESBA 1HRTH 1F7ZA 4BAMB 2PSYA 1FY4A 1SZBA 1X7AL 1GBTA 1NZQH 2CMYA 3URDA 4HI3A 2WFXB 4KTUA 2CV3A 1O32A 4OS7A 3L6PA 3SI4H 2HOBA 3W94A 2P3TA 3VB7A 3K65B 3KL6B 1CHOG 2BQ7A 1V2TT 2C8WB 4K3JA 3RXTA 5EU8A 4U2WA 1B0FA 5IKVA 1YPKH 2BB4A 4YT6H 5DP5A 1VJ9U 4TPYA 5K7RA 1GI5A 4DVAU 1TMBH 5C20A 4X8SH 1URKA 2EI7B 3PLPA 1MBQA 4LK4A 4MDSA 3ZYEA 3L33A 2Y7ZA 2QXJA 1HAGE 1WQSA 3A8DA 2BY7X 1ZOMA 1O3KA 1OP2A 1S83A 1O2YA 1O2MA 2VWOL 1X7AC 1FY3A 2I9AA 5A8YA 4ABEA 2ZDLA 3UNQA 3P17H 4CRCA 4XFQA 3BTFE 4JYTA 4X8VL 2BOHA 1ZHRA 4WMFA 4AYYB 1EASA 4ABBA 1AFQB 5LPFA 5IKQA 1ETRH 3LN1A 1C1NA 2D1JA 1BOQA 1NT1A 3DFJA 1QTFA 1C2EA 2HWLB 4U32A 4XOJA 2GV7A 1GL1A 3SU3A 2WPKE 1ABIH 2Z9LA 1RXPA 5F1AA 1ZHMA 1CT2E 2GCTB 1DDJA 1K1JA 5GXPA 1ZPBA 2FD6A 5K0HA 5FPTA 1YC0A 1DWCH 5DPAA 5EQRA 2Y5GL 1P9SA 2VIDA 1C1SA 1TNJA 1SVPA 5C3NA 2D26C 4NGAL 3TGKE 2WUCA 4RKJB 4ZROA 1UVTH 3R05A 1FZZA 2BD9A 2PW8H 2W5EA 3RXKA 2V3HH 3RMMH 4UONA 2XCFA 4MG3A 4K69A 2QXGA 3TNSA 1TA2A 1UZPA 3MTYA 3RXFA 4CREA 1RFNA 1ANBA 1AVXA 1GJ9B 1OYTH 3VB3A 1KXFA 1P2MA 2W3KA 3E3TA 4ZXXL 2GT8A 4NG9H 1CCFA 2Z9KA 1GVLA 1XDTR 4X1QU 2JKHL 3A84A 1MTNC 1NFYA 2FOCA 3GCWE 1BTWA 1QQ4A 5EXMA 4BTTB 1GCTC 2Z9IA 3P8OA 1V2QT 1BQYA 3AVZA 1O0DH 1GBMA 4YTAA 1U6QA 2VGCC 1TOZA 1O2QA 1ZJDA 1O3EA 1GMDF 2J38A 2HRVA 1QRZA 1HPGA 1A2CH 3BTEE 3M7QA 3TGFA 1O2HA 2O8MA 2CXVA 4JYUH 2KB9A 1XKBC 2ZU2A 3SV8A 3RXPA 4Y6DB 1NRRH 2FX6A 4CRFA 1HT5A 1Y8TA 2RHPA 3DHKH 1MTWA 1XXDA 2ALPA 2VWLL 2P93L 4X2YA 5FPYA 1GHWH 3AASA 1XKAL 8LPRA 1UO6A 1Z7KA 2SGDE 5L2ZL 4BAKB 3BT2A 3ATWA 4A7IA 3F9EA 4NZQA 3KRKA 2RA0L 3EA8A 3TJUA 1K36A 1UTNA 1UK2A 1PRHA 3LGYA 3ODFA 1O37A 1A3BH 3RU4T 2B5TB 1O2SA 4AZ2B 4OGYA 3Q77A 2OLGA 2BXTH 5CHAC 1YYY1 3LTGD 2W26A 2JH6D 2DE8A 1VCPA 5FAHA 1LVYA 1ZGVA 3O8DA 3ELAH 1WOFA 2IPHA 1RTKA 1GMDG 4RN6A 1HIAB 2ODYB 1C5TA 5HXFA 1PPFE 3TH3H 3MH4A 5EXLA 1FE2A 3LIWB 1HRFA 3W95A 5JB8S 1A7SA 5EQSA 1ADXA 1XKAC 3ZYIB 3E0NB 4AGJA 1KDQA 3MNBA 3GY6A 1K37A 2BVXH 2QF0A 2XWAA 2PHBB 3SJ9A 1MQ5A 1P8VC 1EZSC 1TGBA 3HKIB 3VFEA 3LKWA 1L1JA 3ZZ7A 3BIVH 4ISIH 2EEKA 1HXFH 2A32A 4UE7H 4JZDL 1F5KU 3Q3KB 1Z1JA 1THSH 2AYWA 3F1SB 3N7OA 1EMOA 2GKVE 2GD4A 1F0SB 3H7OA 2Z3EA 2I6QA 3STJA 4WF8A 1AZZA 2HNTE 3SJKA 5JBBS 2K2TA 2WYJA 1FIWA 1OP0A 4RRZA 1FNIA 1OOKB 1HXEH 1ZMLA 1ZSLA 3T28A 1QL7A 2VWOA 4Y8YA 1NU9A 1P2KA 1MZDA 1BBRK 1QA7A 1BTYA 1UVUH 1AUJA 1T8NA 2BVSH 1IGZA 1NPEB 2VVCK 1AWFH 2ZGHA 4YLQH 1GMCF 3TVJB 1HJAC 2G55A 3UR9A 4Z0LA 4WJG2 3NT1A 1O3BA 1W7XL 2JETB 1O3AA 2HLCA 5FPSA 2F9BL 1RIWC 3HPTB 2QY0B 1FAXA 3MDLA 1Y3VA 1YPJH 3V13A 3UQOA 1V2WT 1UHBA 1G37A 5FBIA 1YBWA 3CFWA 1T32A 2RCEA 2QAAA 5F8XA 2GCHF 4G1MB 3RMNH 4AB9A 4K1EA 4NIYA 2Y5GA 3ZZ9A 1P2OA 5ESBA 1RJXB 1UTKA 3HS7A 3KK6A 2PKSB 1D3QB 1N6XA 4TWWA 5H4IB 2C8ZB 1MTVA 4MNXA 2JH5D 1L1NA 3RC5A 3LTFB 4ZKNU 3M7TA 3PTBA 2H1UA 1ELGA 2ZC9H 3S7HB 1E0FD 5I46H 2J9NA 6CHAB 3KQEL 1GMCG 3U73A 1TGCA 3M5OA 5LPRA 3UOPA 1S82A 1BCUH 3MWIU 3GY8A 4MMYB 2VVCA 1FDPA 3RXVA 1JXPA 1C5WB 1GVKB 3BIUH 1GMHF 2FLBH 1SI5H 1G3CA 3EA9A 1C2HA 1CT4E 4CUEA 5CKNA 1UTOA 3TLOA 2JKHA 2PSXA 1TQ7B 3SJ8A 2GCHG 1OXGA 1C5VA 4DURA 4OS4A 1CVUA 1WCZA 2MGPA 1CGIE 3GCTF 1SGYE 1CQQA 1NFXB 2P59A 1XUIA 4YOGA 1F0RA 3L3TA 2BOKL 5HGGA 3SGQE 3VGCC 3NUMA 1AGJA 5C67A 1XUKA 1EOLA 1GBHA 1DX5M 2WG3C 2XNIA 2FLRH 4ZXYH 1FLEE 3EE0B 2WPJE 1AUTL 3EA7A 4UFDH 2I9BA 4DT7B 3ZVCA 1F7EA 2VWLA 4QT8C 1HAZB 5FDQA 3QO6A 1GMHG 1ORFA 2G52A 1LQDA 3MI4A 2RA0A 1GDNA 1PPHE 2NWNA 4KP0A 4AG2A 1TBZH 3K9XA 2GZ9A 1HCGB 4RRWA 1V2ST 1ELEE 3RXMA 4FUHA 1DE7H 3GCTG 1QURH 3LAQA 3KQCA 4FVDA 5EPYA 1Q2WA 3MU1A 3MU8A 2WV5A 1V2PT 2TGAA 2R3YA 1TRMA 3C1KA 3LGVA 1XM1A 3KCGL 4OS2A 2VVUL 3SJIA 1G36A 1PPZA 3ESTA 1G3EA 2ZTZA 1VGCB 2Q6DA 3SBKA 1SLUB 1AUTC 4ASHA 3M3SA 1FONA 4MNVA 4Y79A 1H9LB 2TPIZ 1ZAQA 5F8ZA 5BPEA 2BY8X 1GHXH 2Y80A 2SGPE 3N8WB 3KEEA 1ABJH 1EPTC 2UUKB 3BPSE 4A5TS 3RXBA 4TY6A 1GBEA 5IDKA 1LDTT 1K1IA 2VB0A 1EPHA 4NFFA 3B8JA 5DO4H 2NU1E 1V6DA 4IC6A 2JH0D 3SHCH 1AMHA 1BMLA 5E8EH 2ZDVH 4NA7A 4Y0YE 1IQLL 1QGFA 2GTBA 2BVRH 1ELFA 1MKWK 3A7TA 5JVYA 1NO9H 1FPHH 2PLXA 4I7YH 4U01A 1G3BA 3QTVH 1V2MT 1C5XB 1SLVB 2QCYA 3QTOH 3S9BA 4D8NA 2P94L 1DY9A 2QGRA 1PFXL 1A0HB 1AN1E 1C5SA 4Y71B 2VINA 4E1GA 1TNHA 1DWEH 2B7DL 1D3PB 3GDSA 1AE5A 1EQGA 2DUCA 1O5DL 2TIOA 4NA9H 1BJUA 1EQHA 1P10A 1SGRE 4ZHLU 1F0TA 1HAHH 3BTKE 3E91A 1O3GA 3GCOA 2ZIQH 1T4VH 3BG8A 3QX5H 2ZDMA 4IS5A 1TX6A 3SGBE 3RM2H 4K60A 1THRH 1G2MB 1GJ7B 4X6NA 2J92A 3FCSB 4ISHL 1UTPA 1BRBE 1FN6A 4RUTA 1BTHH 1V3XA 1W10U 2NU3E 1O2RA 1PFXC 1BJVA 1SGPE 3BEFB 2VU8E 3GISB 4DIIH 3SV6A 1IQML 4LMFA 1BHXB 4BTIA 5ESTE 4E7RG 1DVAH 1MUEB 2Y6TA 3IG6B 5L30H 1O35A 1GJAB 3MU4A 4BXSA 1AVGH 4Q2KA 4Z6AH 4INLA 1DOJA 2WPLE 4X6MA 2ZHWH 5EXNA 2Q6GA 3LT3A 1ATAA 2YOLA 3PB1E 2FIRH 1IQFL 1HFDA 1VCWA 4LOYH 3NJPC 4ZAEA 3KQEA 1W12U 2OC8A 5AF9H 2FYQA 2P3FL 1FSBA 2DE9A 5E0JA 1QL9A 2Y82B 1BTXA 1SGNE 4JMYA 1S6HA 1BRUP 4AORA 3ZV8A 1ZHPA 2ULLA 3JZ2B 3FVFB 4YOIA 3N8VA 1GBKA 1V2VT 1ZRBA 1WU1B 4JYVH 1IHTH 1EJMA 3G01A 2IJOB 3NXPA 4Y7BA 3SOSA 3VPKA 1EJAA 1G1SA 2GGVB 3SGAE 2EC9H 3A82A 4GHQA 4LZ1H 1HX2A 3GCHB 1CSOE 4KELA 5JBTA 1UK3A 1YGCL 3ENSA 1LO6A 1FAKH 2M74A 1NFUB 1DLEA 1JIRA 1INCA 1GBLA 2BX3A 2BLQA 4UD9H 3SQHE 1F5RA 4CUDA 1NY22 3T29A 2ZU5A 1P12E 1BF9A 5E8DA 4ABAA 7ESTE 3U98H 2A5IA 1QB9A 5L2YH 1A3PA 4F4OC 5AVDA 2A2QH 2NU2E 2AMPA 3I78A 3SW2B 1FI8A 1O2KA 3I77A 1Y59T 1L0ZA 4FU9A 3N8YA 1CA0B 2Q6FA 1QB1A 2AIQA 1V2UT 2G00L 1AY6H 1GI4A 2ANYA 2BQ6A 3AW1A 2A45B 5PTPA 4B2BA 3KF2A 2BDGA 4CHAC 3ZYGA 1CVWL 1BRCE 3EQ0H 4E7NA 1K22H 3V3MA 3P8GA 2VVUA 3LC3B 4O3UA 3GISX 1KSNB 5L6NH 5LPEA 1GHAF 1K21H 1MU8B 2WPMS 2EI6B 1XVOA 1UCYE 2VWNL 4Q7YA 1UTQA 2WPHE 3FANA 1FV9A 2UUJB 1W0ZU 1Z1IA 1KY9A 1AHTH 1O33A 1C1PA 2CJIA 1O5BB 1TPSA 2GCTC 2Q1JB 1B7XB 1LVOA 5JBCE 1MZAA 4MNWA 1Y3YA 1ELBA 3EDXB 2A4OA 1QNJA 2XTTB 3SNEA 1HZ8A 1OX1A 1DXPA 1PQ7A 2P94A 5F8TA 1ARBA 3O8BA 2KL7A 1YCPH 4CRDA 3ZZ6A 4E05H 1C4U2 5DP8A 1JL9A 1GHAG 2ZFSA 1ANEA 1PQ8A 2BLWA 1AB9B 1VITH 3B9FH 3PTNA 1QFKL 1XUJA 1EPJA 1P57B 2FMJA 1MQ5L 1OP8A 3U7UG 2O9QA 4HTCH 3RXCA 1GGDB 2FI4E 1BDAA 3EYDA 2J34B 3QK1A 4M7GA 1KLJL 1YPHE 3CENL 3VB5A 1IQHL 1A1RA 1MKXH 1P06A 2Z3CA 2STAE 2OTVA 4ZH8A 1TALA 5T3HA 2ODPA 2Y7XB 5SGAE 1O3IA 1IOEL 1BA8B 1QRXA 4B75A 1NROH 2BMGB 2SGAA 1IAUA 1SPJA 2QXIA 1H8IH 3RXJA 1IQMA 3GOVB 1T31A 1C1TA 2OBOA 1V2KT 2J4IB 1KXAA 4IMQA 2BQWA 4H6TA 4CRAA 3BV9B 4D76A 1CHGA 1LVBA 1ZPCA 3PMHB 5B6OA 1C1WH 1IQFA 1TGSZ 1KIGL 5ABWA 2THFB 3HS6A 3A87A 1GHYH 2YGPA 3RMLH 3MOCA 1EAWA 4CSYA 2A4QA 4YM9A 2PGQB 3UREA 3ZV9A 1PJPA 4X1NU 3A85A 3HGNA 4NWKA 2YGOA 1CGJE 4RRYA 1O3MA 2AGIX 2FP7B 3IWMA 1V2LT 1FAXL 1PYTD 3KL6A 1CGHA 2W7SA 4I8HA 2XCNA 3ZYJB 2OBQA 4Z0KB 3ATIA 3BTHE 3LGIA 4NSYA 1VCQA 2P8OC 3LGUA 3T2NA 3A8AA 2WPIE 5E0GA 1MBMA 1EX3A 5TCAA 2OCVB 1TPOA 1Y3UA 1G3DA 1C1UH 2P26A 1O2JA 1G9IE 2OYEP 2R9PA 4ZHAB 1EZUC 1QBNA 1PYTC 2XBYL 2FYRA 3CS7L 2TGPZ 3DA9B 2UWPA 3PLBA 1DFPA 1LMWB 2ZTXA 1GJ5H 5A0AE 3UWIA 3FP7E 3TJOA 1OWKA 3UR6A 4X8VH 4O03A 2F9OA 1LPZB 3OYPA 3NK8A 1UVOA 1NRPH 2A4RA 4B1TA 1ZRKA 1LHFH 3TBDA 2GZ7A 1P2IA 4CR9A 2F9UA 4WXVA 1ZZZA 5FXLA 1EJNA 2H9HA 4D90A 1O2ZA 1VZQH 2B0FA 3ATLA 4YESB 1TX8A 2FS8A 2ZCHP 1N6YA 1SGCA 4MPVA 5FBEA 1IQKL 2HGTH 2A31A 3BSQA 2G00A 1G30B 2FOEA 1CT0E 2FTMA 5EG4A 1GI9B 2BO2A 1GJBB 3SORA 3CP7A 4DGJA 3M36A 3P92A 1G2LB 3BG4C 4BDXA 1O3PB 2STBE 2ZEBA 3OX7U 3OY5U 1C1QA 1LTOA 4VGCB 4I8JA 1ZMNA 1ATBA 3SU2A 3A80A 1OS8A 3ZZ4A 1EBVA 1DIYA 4BANB 3ZYDA 4NGAH 1LKAA 5DP4A 2BDIA 1ANDA 3K6ZA 3HO3A 2F3CE 2QA9E 4YZUB 1G32B 2P16L 2VWNA 5COXA 3A86A 4KKDA 1TIOA 1RGQA 1IVOC 3U8OH 3SOQA 5AFYH 3ZVGA 1TBQH 3TK6B 3E8LA 4B74A 1MMJN 2W7UA 1G1RA 2W2PE 1CEJA 1FUJA 5KN5C 1IQEA 1Q3XA 3KQCL 2OUAA 4ZXXH 1QBVH 2W2QE 4BTTA 2VIWA 2VH6B 1P3EA 1KXDA 1BTZA 4HZHA 2Y81B 3OLTA 2ZU1A 2C8XB 3TK5B 2WG4B 4GSOA 2ZO3H 4KGAA 5DP7A 3U69H 4BAOB 1AD8H 5FCKA 1C5YB 1AKSB 1RD3B 2BZ6L 3VXEH 4I8KA 3OTJE 1GWAA 1M1XB 2G5VA 5JB9S 3E16B 4X1RU 2ZI2H 3GY4A 2WPLS 5F6MA 7LPRA 4Y76B 4AFQA 1C4V2 1MOXC 1PTHA 3SNDA 1HAFA 1C5MD 3UTUH 2WINI 3V12A 1MD7A 3CENA 4LZ4B 1GBFA 1IQHA 1D3TB 1TGNA 5L2ZH 1EB1H 1G1QA 4WMDA 2UWOB 4FUIA 1F2SE 1W14U 9LPRA 3D23A 3RU4E 4BTUB 1IOEA 4IGDA 4JCNA 1TFXA 2G4UA 4M10A 1GK5A 2VIOA 4FU7A 1QQUA 1O2NA 1WSSH 5C1UA 2GV6A 1HIAA 1C5UA 1ELDE 5CKQA 1QL8A 1HAEA 3LIWA 5FHTA 1TQ0B 4FUGA 3O8CA 2UUYA 4XDEA 1TNIA 1H1BA 1XX9A 1EGFA 3UWJH 2OQ5A 1GG6B 2BY9X 3BTQE 2HVXA 1GCTB 1GI8B 2PHBA 4WH8A 3SU0A 4Q80A 3JZ1B 3QGJA 2BTCE 4MMXB 3MFJA 1WTGH 2H9EL 4AOQA 6COXA 2VGCB 1YUFA 1O3HA 5DJ7A 3NTBA 1C2IA 3QGNB 2AEIH 1S85A 3BTWE 1ATEA 3Q3KA 4GPGA 1NFWB 3RC6A 1XVMA 1TLDA 1TA6A 1EXFA 3SHAH 1EZQB 1F0SA 1LHGH 1UTJA 3A7ZA 4JZDH 2G5NA 3HK6B 5DP3A 3NKKA 1GBBA 3U1JB 4O1ZA 1DPOA 1DM4B 1UZKA 1A46H 2V3OH 4A92A 4JZEL 1O3FA 2UWLB 1P04A 3MHWU 2GVFA 1P03A 1P3CA 2C4FH 1IOXA 1A61H 8GCHF 3V64C 5IKTA 2XBYA 3GDVA 1L2EA 3CS7A 4X8TL 1UK4A 1P9JA 2F9VA 1MAXA 2Y5FA 1MAYA 3D65E 3P8NA 1SOZA 1DX5I 1BZXE 5CHAB 1C1MA 1O2VA 1O3OA 7KMEH 1KXCA 4AX9H 3MO9A 4IN2A 4BOHA 3TIUA 4MTBA 4OS1A 5C2ZA 1SGTA 2ZDAH 1LKBA 1PPBH 1F5LA 2ZNKH 1V2RT 3WY8A 2PKAB 3AAVA 3QH0A 1GBIA 3HPTA 1K1LA 1FPCH 1E34B 3R3GB 1W7XH 1CBWC 5IKRA 2F9BH 4SGBE 3KQDL 2W3IB 3FBYA 4BAQB 2G81E 5JW1A 5HM2A 1N8OB 1C1RA 1IQKA 1Q31A 2VIQA 2FO9A 4FUEA 8GCHG 5EW1H 4NWLA 4HGCA 1E35B 2ZF0H 1S6FA 2ASUB 1OSSA 4B73A 1GVZA 5EODA 4ABHA 3S7KB 2TRMA 3O8RA 3FP6E 4WMEA 4SGAE 2BDYA 3SN8A 1FF7A 1JRTA 2EI8B 4WVPE 1H4WA 1IQIL 1YM0A 3UFAA 4MPXA 1YUKB 1Z8RA 1TBRH 2J95B 2P16A 2BLVA 2PUXB 4GAWA 3E6PH 3LPRA 3TJNA 2WFTA 4WXIA 3IJEB 1YLCA 1ZTJA 2R3UA 3FZZA 4Y79B 4CUFA 1W11U 3ZZBA 5JPMH 3MU5A 1KLTA 2BLOA 1FN8A 1K1OA 2GX4A 1YKTA 2V6NA 1DWBH 1SMFE 2O8UA 2PWXA 3LC5B 2PUQL 1O2TA 1ESAA 3RXGA 1O30A 3QUMP 3ZZ8A 4Y8ZA 5JBAE 1QHRB 4MPWA 2CF9H 5EPNA 1T8LA 2VNTA 3U9AH 1UVPA 3TGIE 1DSUA 1HJAB 1TE0A 1NFXA 4A1VA 3Q00A 4Y0ZE 2ZDNA 4ABGA 1O2GH 1BT7A 1XMNB 2Z94A 3V0XA 2A7CA 1EP5A 4AG1A 1HJ8A 2GT7A 1GI7B 3MH5A 1NZIA 3ZZDA 4D7GA 4U30A 3UOUA 2BY6X 1SQOA 3CS0A 2Y5HL 1DICA 4X1PU 3U8RH 4XBCA 1DDXA 1Y3XA 1Z71A 2QXHA 1MH0A 1WTHD 2QF3A 4FU8A 3A8CA 2ZHQH 2XWBI 1LHCH 3FP8E 1J16A 1HCGA 4FM5A 2KAIB 1O34A 1ELAA 2PGBB 2XC0L 4YT7L 3D62A 3SNBA 1E36B 3SZNA 1J9CL 2VH0B 2WPKS 4D9RA 4Y7AB 1U67A 1KLIL 1APQA 4R0IA 1P2JA 2F91A 2V0BA 2WYGB 2WPIS 2FI5E 3RXRA 4FUDA 4TY7A 2MHPA 3KCGH 4FUJA 1FFMA 1GI2A 1PQ5A 3N8WA 1C5ZB 1LCYA 1AU8A 2J94B 1HJ9A 3M37A 4UFFH 3PROA 1NPMA 2VJ3A 4JZFL 2FS9A 4ABDA 3SUGA 1J14A 1IJQA 3HATH 3TITA 4H42U 2ZFTA 2GMTC 1GBCA 4RRXA 2CF8H 3E90B 1W2KH 1SR5C 1SGFG 2QN5T 1KTTB 1C5NH 3AW0A 2XBWL 2PTCE 1HAPH 2P3UB 1QA0A 1WHFA 2ZFQH 3HKJB 3S9AA 3NCLA 1LHDH 1ZLRA 3M35A 4XBMA 3QLPH 3M5LA 4M11A 1TOMH 4INKA 3MNCA 1RTLA 5T6GA 1AZ8A 1EB2A 1UJ1A 4JZIA 1JBUL 4RSPA 3IITB 1TAWA 2ZFPH 3A7XA 4Y71A 1A5HA 1O2PA 4CBNA 1BITA 5EGMB 5E2PA 5JB8E 3H5CB 2QC2A 2CHAC 1W8BL 4IC5A 2A2XH 3URCA 2B7DH 4MMZB 3D49H 3T62A 1O5DH 2A4GA 2OYUP 1Z6EA 1N1IA 1EKBB 1G2MA 2PR3B 2P95A 4O3TA 1YPEH 1NRQH 2AIPA 1AIXH 1HLTH 1SFQB 4MQAA 1BMMH 1ZJKA 1IQJL 3UUZA 4ISHH 3V7TA 3KQDA 1Z6CA 4NFEA 1EPTB 2OC7A 4ABJA 4ABFA 5JBBE 3VB4A 4H4FA 4J2YB 1LPKA 2KV4A 1ZMJA 1AB9C 1EPIA 1HV7A 3LN0A 2XXLA 3ZVBA 2HNTF 4CBOA 3H7TA 4K8YA 2O8TA 5F03A 1TX7A 1DITH 3BF6H 3PLKA 2ZDKA 1C2DA 1QY6A 1MTUA 4JZ1A 1ZPZA 1IQIA 1KYNA 2BQ6B 1ETTH 1SGDE 2FOFA 3R0FA 1VJAU 4D9QA 3F6UL 2BDHA 1JV2B 2VIVA 2XYAA 2DDUA 1O2IA 2BHGA 3BT1A 4ZKSU 2ZHFH 2OD3B 1V2JT 2J2UB 3BEIB 4ESTE 1ZYOA 4D7FA 1C2KA 1HAVB 2Y82A 2P3FH 2Z9GA 3RR3A 1LPGB 1O2LA 2SGFE 3PO1B 1MTSA 1AWHB 4PH9A 3N8ZA 3ZZ5A 2H2ZA 1GJDB 4FXGH 1AE8H 1ARCA 1I0UA 3VEQB 1UCYK 4IN1A 1UZQA 2FPZA 3M36L 1WU1A 1Z6JH 1RRKA 3SV7A 1ELVA 2CGAA 2C3SA 2VIPA 1FIZA 5FX5A 2GP9B 2XBXL 1WV7H 2BZAA 1SG8B 1SBWA 1WHEA 1AFQC 2AS9A 1HAOH 1P0SL 1UTLM 4Y11E 4B2AA 1YF4A 4X8UL 3SJOA 1Y3WA 1YPGH 1Z8GA 1QRWA 2A7JA 1O5FH 1D4PB 1NFUA 3MNXA 1YGCH 3EGFA 5GJ4B 2ZFFH 2Y5HA 3TH2H 4Q7ZA 4B76A 4DIHH 1CE5A 2FI3E 1BMAA 3HK3B 1Z8IB 4I33A 4J1YA 4UDWH 6GCHF 4R8TB 1QB6A 3PYHA 1IQEL 1IGXA 3KNXA 5EQQA 1DUAA 2WUBA 2W2OE 1DSTA 3QZQA 2P3TB 4DJZB 2XBVL 4YT6L 2BQ7B 4I8LA 3POYA 3P6ZB 2XC0A 3RXSA 4TPIZ 1DXWA 4XBBA 4X8SL 1ZTKA 2RG3A 1D6RA 5CMXH 1L4DA 3E0PB 5BRRE 3LH3A 3FAOA 2XRCA 3GYLB 2LNCA 2Y7ZB 5CISA 3MO6A 4X2VA 3F9HA 2ZTYA 2FOAA 1CVWH 3UNRA 2FZZL 1GBAA 3RLYH 3P8FA 3UIRA 2ZU4A 5C1YA 2ZPRA 2SNVA 2EI6A 1SB1H 1HGTH 1HAIH 5E2OA 3SO3A 2ZHEH 4ZUHA 1N7DA 1K28D 4RS0A 3M61U 5DK1A 6GCHG 1P05A 1S0RA 1O5EH 2BOHB 3B23B 2ZPSA 2FOGA 5IYTA 2Q1JA 2XBWA 3SOVA 2F83A 1FQ3A 2R0LA
chains in the Genus database with same CATH superfamily
1YUGA 1DT2A 1ZSJA 2TBSA 5GDSH 2D1JB 5EJ1A 2BDAA 1LQEA 4UFEH 1PPCE 2ZZUH 1C2LA 1C5MF 3GDUA 2SNWA 4BDWA 2ZKSA 1YPLH 2PV9B 4VGCC 5T6DA 5A8XA 2VWMK 4ISOA 3LDXH 1F7MA 2UUFB 5K0HB 4WH6A 3V65B 2BD5A 2V35A 1E38B 1TB6H 4ZKRU 4ISLA 2AH4X 4AYVB 1HT8A 3TPIZ 2GDEH 5C5OA 2XNDD 2AFQB 4CH2B 2C93B 2ZPQA 3PMJA 2FX4A 3LGTA 5ETXA 3E1XB 3Q3YA 1QFKH 3SNCA 4YLUA 2J34A 4XL1A 2UWPB 1M9UA 4CHAB 2BD7A 1HAXB 3MU0A 2WPJS 1HBTH 3RU4D 1CX2A 1O2WA 5CKMA 2OINA 1SGEE 4WY3A 2LPRA 4UFGH 1DLKB 1KLJH 4NG9L 1B0EA 1RFNB 2RDLA 3KN2A 3T25A 1NS3A 1IQJA 2EI7A 2FM2A 2Y7XA 3MO3A 1GJ6A 2W3KB 1WUNH 3ZVEA 5C17A 2BMGA 1ZGIA 3TK9A 3RXHA 1ANCA 2GZ8A 2WPDD 1C9PA 2ZGBH 5HMAA 8ESTE 4DY7B 3PMBB 4NCYA 3ODDA 4CRGA 3DD2H 1JWTA 5LH8A 3GCNA 1C5PA 1Y5AT 2J4IA 1NFYB 3PGHA 1DS2E 4I31A 2TGFA 1O39A 2Y5FL 1KKEA 1GI1A 2HNTC 4AB8A 2VWMA 1YCPK 5JBAS 1UVSH 2D2DA 2R2MB 4B71A 1D3DB 1ELCA 4UEHH 5DG6A 1O3DA 5EOKA 1EOJA 1KTSB 3SU4A 1IQNL 3DEMA 1O31A 3FFGL 4JYUL 2J38B 1FXYA 3A83A 4HFPB 3UQVA 3ZZAA 1P11E 1HYLA 1KIGH 1SHYA 1L3YA 3VB6A 2JIZD 2BOXA 1SFIA 2C8YB 4X0WU 2F4LA 1D6WA 1K1MA 3S69A 3HS5A 2H5DA 1UMAH 1GHVH 5A0BA 1OWEA 1G1TA 3ATKA 4ABIA 2KCAA 4Z0KA 3HO4A 1C9TA 1MKXK 4X2WA 2EA3A 3T27A 4A7IB 1PGEA 5F53A 5T6FA 2YMSB 4XSKU 3S0NA 1GPZA 1ACBE 1SGFA 3RXQA 2IOTA 4NIWA 5J4QA 1AO5A 3ELAL 4IW4E 4OS5A 3STIA 4AFZA 1FJSL 4ZKOU 3RLWH 2XBXA 4COXA 2W26B 3PWBA 4ZHAA 2H9TH 1EAIA 1EAUA 1GG6C 1O36A 3RC4A 3TH3L 2I6SA 3VXFH 2XC5L 3MH7A 5DP9A 1AVWA 1O2XA 4CR5A 2JETC 1T8MA 2IN2A 5A0CA 5JDUB 3UPEA 1W7GH 2R2WU 1BBRH 1QJ6B 3MNSA 1BRAA 2P3FN 2NPRA 3OY6U 4Y8XA 2FODA 1WAYB 1LPZA 3S9CA 3TZIA 2W6JD 1TNLA 1KDQB 1ESTA 1BHXF 1P09A 1TNKA 2A5KA 4KTSA 1S6LA 3ZZ3A 1YY3A 3U8TH 3C27B 1GJ4H 4ISIL 1O3JA 3GY2A 2PTNA 2ALVA 1H9IE 2PKSC 1OWHA 2XBVA 5LGOA 3KHVA 2AMQA 1H9HE 3GY7A 5FCRA 1A0LA 1FY1A 4ZMAH 2GD4B 1QCPA 1PPEE 3GY5A 4K1TA 1L1GA 1OWIA 1G2LA 3UNSA 6CHAC 3A81A 2WYJB 1S0QA 5J4SA 3LU9B 3SOBB 4C16A 1BIOA 2FZZA 3OLUA 1NT0A 1J8AA 2FDAA 4Y6DA 3SQEE 2P8OB 4K1SA 2HVYB 2G4TA 4TGFA 4YZUA 2W2NE 1AFEH 2G51A 2ANWA 1T7CA 2HALA 5C5NA 1D9IA 1RS0A 1O5AB 2ZQ1A 3DT0H 1NM6A 4CH8B 3TK6A 3FN8A 1B5GH 3N99A 1NRNH 1N8OC 3RXAA 2F9NA 3QCWA 1TRYA 3LH1A 2ANMH 2KCYA 1OB1C 3LGWA 1B9WA 1T4UH 1F0UA 2BM2A 3TU7H 1TGTA 1CU1A 2BT7A 1YP9A 3RXIA 2YNBA 1A4WH 2VH6A 1GJ8B 1UHBB 1SOTA 2Y81A 1HREA 3TK5A 2WZQA 3M7UA 4K8BA 1CA8B 1A0JA 1AKSA 5HIYA 4OTYA 3LOXA 4I86A 4MNYA 1MTNB 3M37L 4AQTA 2HLDD 4LORA 1Y5BT 3C9AC 1MCVA 1COUA 2ZQ2A 1C2FA 2WPME 1WBGB 2BZ6H 4A1XA 1EMNA 1P2QA 1VR1H 1V2OT 4X2XA 1L4ZA 3M5NA 3PM3A 1O2OA 5I46L 4Y76A 1C2GA 2HPQH 4KTCA 4ISNA 1DQBA 2QV1A 7GCHF 2FWWA 3BG4B 5HM9A 1ATDA 4X6OA 3F2FA 1HNEE 2VVVL 2ZGJA 4IMZA 4OTJA 1U8CB 1OWDA 1S81A 2FLBL 5CE1A 2LP6A 2UWOA 1UTMA 3I29A 1JOUB 4DCDA 4BTUA 3P5BL 1VGCC 1TWXB 2FOBA 1SLXB 3RDZA 3SNAA 3DFLA 1O3NA 1S5SA 2PFEA 1CO7E 1BBRE 1NRSH 4GU4A 1Z8JB 1PXXA 4NSVA 1KXEA 1MQ6L 3BN9A 1EATA 5DP6A 1A5IA 2HPPH 1YPMH 4Y10E 4XLWA 4CRBA 1SQAA 3BTGE 4D0FA 2AGEX 2O8LA 3NPSA 2H9EC 1IQNA 1COWD 3FFGA 1Z6EL 1F0RB 1HJ7A 1GI3A 2FLRL 3NTGA 4ZXYL 3M5MA 1C1OA 1QIXB 1SSXA 3CA7A 7GCHG 1H8ED 2P95L 1K1NA 2OC1A 1W0YH 4ZHMU 3RP2A 4JK6A 3RXUA 8KME2 1GL0E 1C2MA 2BX4A 5C0UA 5EJLA 2WPHS 2BD8A 3GYMA 1H8DH 1L5GB 2H9EH 1NFWA 2OQUA 1EZQA 1LQDB 3Q76A 1XKBA 3SUEA 2OXSA 3FO8D 1XUFA 2ILNA 5JBCS 2BYAX 4PROA 2ADXA 1MKWH 3K9XB 2RNLA 5F19A 4AFUA 4E06H 1TOCB 4DW2U 1C5QA 2UWLA 1TLEA 1PQAA 3LJJA 1FJSA 2AGGX 3RUOA 1SC8U 3SU6A 4JK5A 4GLYA 1IQGL 3TNTA 4JZEH 3SV9A 4BNRA 3RM0H 1EP6A 2Z3DA 2XC5A 1W13U 1O3LA 3MMGA 1SQTA 1LHEH 5E0HA 2AYLA 5GCHF 4A94C 1AQ7A 1QJ1B 4X8TH 2WV4A 2FEQH 1SKYE 2OC0A 4MVNA 1LMJA 1GDQA 5GPIB 1WYKA 3ZVFA 1C5RA 3BTME 2ZG0H 2Y80B 2BXUH 2M5TA 3PWCA 2F43B 3A7VA 1NQLB 4THNH 4RT1A 4XRNA 5G4BA 2AMDA 2NU4E 5DKMA 2PKAA 3LJOA 4XE4A 1THPB 1DUEA 5AFZH 2P93A 1OWJA 3T5FH 3QDZB 2XC4L 2W3IA 3SUFA 3SV2H 1GCDA 3GY3A 1TPGA 1WQVH 3K6YA 2BD3A 1RIWB 4ASUD 2H5CA 3KQBL 2FOMB 2JJLA 1O38A 3F68H 4OGXA 5GCHG 1YO8A 1EZXC 2YGQA 2ZCLP 1C4Y2 2EI8A 2ZFRH 1P01A 4OM9A 4NA9L 3DSPA 3ASIA 2R0KA 1E1QD 2D8WA 3SU1A 3HO5A 1QJ7B 1W3CA 2J95A 1P02A 3KIDU 3PV4A 2Y38A 5TCCA 1MU6B 1SLWB 1J15A 3RMOH 1GHBF 2ZECA 2ZHDA 2FOHA 1TABE 2ZA5A 1TONA 2CN0H 4X6PA 1APOA 1TRNA 2O8WA 3NZIA 1XXFA 1NU7B 3PV2A 1HAYB 3DUXH 3U1IB 2FTLE 1BUIA 3LC5A 4INHA 4LXBH 4BXWA 1GHZA 4O97A 4K2YA 3A89A 4XBDA 2PUQH 2ZU3A 2Z6BD 1V3XB 1O3CA 3GCHC 1DANH 1K9OE 2V3MA 2A7HA 3A7WA 2TGTA 1MCTA 2BY5X 2ODQA 2BD4A 3FZDA 1VITF 1DVAL 3QMOA 5L30L 1OKXA 2J5UA 1TPPA 5HIZA 5AHGH 4Z6AL 3TGJE 4MPUA 1ZTLA 2QYIA 4BTIB 5IK2D 4FUBA 4IBLH 3MQEA 1CBWB 1UZJA 3SI3H 4F48B 2OP9A 3AK5A 4MLFB 4YO9A 3S6XA 1F92A 1GHBG 3SUDA 3PO1C 3K2UA 1XFEA 1CA0C 4M9FA 1N1LA 3VGCB 3M3VA 4A1TA 1EQ9A 2ZP0H 4ZAEB 2F9PA 1BB0B 1YLDA 1V2NT 3TJVA 4A6LA 1LVMA 2VVVA 2Z9JA 1T8OA 2P28B 2FLGA 2MGRA 1EUFA 2ANKH 2FESH 3P70B 2KAIA 4K5ZA 1KXBA 1NESE 2VH0A 4GCHF 1TPAE 1VITG 1CCVA 4GVUA 2H6MA 3QN7A 1EAXA 4Y7AA 3OSYA 4YT7H 4JYVL 1QR3E 4FUCA 1J9CH 1YCPM 4ACBA 5A8ZA 1MQ6A 1UCYH 1KLIH 2WYGA 2JDID 1GBJA 3ZVAA 3RXOA 1SGIB 4Y7BB 2AERH 4B2CA 1A3EH 1LPKB 5JB9E 2VJ1A 4TYDA 3RXEA 4WWYA 2ESTE 2XOKD 2J94A 2BOUA 1C1VH 5EW2H 2A5AA 1FAKL 1TNGA 1SHHB 4JZFH 3ENSB 1DWDH 1RTFB 4NIXA 1HDTH 3OU0A 1ID5H 3GCXE 3F9FA 2P3UA 1K0HA 3Q7DA 1ETSH 3ATMA 1OYQA 1XUHA 4NZLA 4AN7A 3MYWA 5L2YL 5GWZA 2W2ME 4GCHG 4X1SU 1TMTH 1YPHC 1S84A 4AGKA 2ZGCA 3BTDE 3ZVDA 4OS6A 3BTTE 4H6SB 1FY8E 3EAJA 1CQEA 5KECA 3EGKH 3SU5A 2HORA 3N8YB 3QWCH 3IITA 2FXRA 2RA3A 4O02B 2W86A 1IQGA 1GGDC 1JBUH 5EGMA 2LELA 1OPHB 3RXDA 4DG4A 2SGQE 1JIMA 1FY5A 2IJD1 1O2UA 1C5LH 3LONA 1W8BH 2CK3D 2G8TA 4NIVA 2BOKA 1O5CB 3A7YA 3F0OA 2PR3A 3HGPA 4I8GA 2ZGXH 3Q3XA 4FUFA 1C5OH 1J17T 3ITIA 2A0QB 1NN6A 5GIBA 2CJIB 3QZRA 1KLOA 2XC4A 3T26A 2K2SB 1EPTA 1Q4GA 1C2JA 2GDDA 9ESTA 1HB0B 1EPGA 1K1PA 3MH6A 4Q7XA 2GMTB 3BEUA 1BTPA 1IHSH 3PMAB 1P2NA 4RKOB 3GS9A 4O9VA 1ELTA 1ZSKA 3KQBA 2B8OH 5DN6D 4YOJA 1NC6A 5FX6A 4I32A 4DOQA 4FVBA 2ZCKP 4BAHB 2EQNA 5I25A 1SL3A 3A88A 2K1QA 4AFSA 5A09A 5TJXA 4D0EA 5JYIA 2BD2A 3AAUA 1SGQE 3F6UH 1A5GH 4NA8A 2J2UA 3WWFA 2ZWLH 1GJCB 3GICB 1JMOH 1GI6A 1HAVA 1AI8H 1PPGE 3A8BA 5DGJA 5A2MH 6ESTA 3SW2A 1BMNH 2BDCA 4GUXA 4P02A 1HUTH 1IP0A 3FOAA 1XUGA 1LPGA 1Y5UT 2CHAB 1FMGA 1EAIC 1DY8A 1MD8A 1O5GH 2BDBA 5KIRA 1GBDA 1JRSA 3N8XA 2RFKC 4ZH8B 1CHOF 1P9UA 2A1DB 3RXLA 1TMUH 4TWYA 3TH4H 1E37B 6LPRA 3ZZCA 1NTPA 5HYOA 4B6EA 1IQLA 4GHTA 1V1HA 3F9GA 1GDUA 3LC3A 1QBOA 2XW9A 4F49A 1KSNA 1BTUA 2TGDA 2KX4A 2Z7FE 4FETA 3M3TA 2NU0E 5C1XA 1K2I1 1ZR0A 1P0SH 2BQWB 1GI0A 2C90B 2YNAA 3UY9A 2SGEE 4X8UH 2QIQA 3P95A 3NWUA 1TYNA 2B9LA 2SFAA 3KGPA 5JVZA 1ESBA 1HRTH 1F7ZA 4BAMB 2PSYA 1FY4A 1SZBA 1X7AL 1GBTA 1NZQH 2CMYA 3URDA 2WSSD 3EE7A 4HI3A 2WFXB 4KTUA 2CV3A 1O32A 4OS7A 3L6PA 3SI4H 2HOBA 3W94A 2P3TA 3VB7A 2J98A 3K65B 3KL6B 1CHOG 2BQ7A 1V2TT 2C8WB 4K3JA 3RXTA 5EU8A 4U2WA 1B0FA 5IKVA 1YPKH 2BB4A 4YT6H 5DP5A 1VJ9U 4TPYA 5K7RA 1GI5A 4DVAU 1TMBH 5C20A 4X8SH 1URKA 2EI7B 3PLPA 1MBQA 4LK4A 4MDSA 3ZYEA 3L33A 2Y7ZA 2QXJA 1HAGE 1WQSA 3A8DA 2BY7X 3WWBA 1ZOMA 1O3KA 1OP2A 1S83A 4HG6A 1O2YA 1O2MA 2VWOL 1X7AC 1FY3A 2I9AA 5A8YA 4ABEA 2ZDLA 3F0PA 3UNQA 3P17H 4CRCA 4XFQA 3BTFE 4JYTA 4X8VL 2BOHA 1ZHRA 4WMFA 4AYYB 3U28C 1EASA 4ABBA 1AFQB 5LPFA 5IKQA 1ETRH 3LN1A 1C1NA 2D1JA 4F55A 1BOQA 1NT1A 3DFJA 1QTFA 1C2EA 2HWLB 4U32A 4XOJA 2GV7A 1GL1A 3SU3A 2WPKE 1ABIH 2Z9LA 1RXPA 5F1AA 1ZHMA 1CT2E 2KNIA 2GCTB 1DDJA 1K1JA 5GXPA 1ZPBA 2FD6A 5K0HA 5FPTA 1YC0A 1DWCH 5DPAA 5EQRA 2Y5GL 1P9SA 2VIDA 1C1SA 1TNJA 1SVPA 5C3NA 2D26C 4NGAL 3TGKE 2WUCA 1NBMD 2V7QD 4RKJB 4ZROA 1UVTH 3R05A 1FZZA 2BD9A 2PW8H 2W5EA 3RXKA 2V3HH 3RMMH 4UONA 5C94A 2XCFA 4MG3A 4K69A 2QXGA 3TNSA 1TA2A 1UZPA 3MTYA 3RXFA 4CREA 1RFNA 1OYTH 1ANBA 1AVXA 1GJ9B 3VB3A 1KXFA 1P2MA 2KM0A 3OEHD 2W3KA 3E3TA 4ZXXL 2GT8A 4NG9H 1CCFA 2Z9KA 1GVLA 1XDTR 4X1QU 2JKHL 3A84A 1MTNC 1NFYA 2FOCA 3GCWE 1BTWA 1QQ4A 5EXMA 4BTTB 1GCTC 2Z9IA 3P8OA 1V2QT 1BQYA 3AVZA 1O0DH 1GBMA 4YTAA 1U6QA 2VGCC 1TOZA 1O2QA 1ZJDA 1O3EA 1GMDF 2J38A 2HRVA 5T1VA 1QRZA 1HPGA 1A2CH 3BTEE 3M7QA 3TGFA 1O2HA 2O8MA 2CXVA 4JYUH 2KB9A 1XKBC 2ZU2A 3SV8A 3RXPA 4Y6DB 1NRRH 2FX6A 4CRFA 1HT5A 1Y8TA 2RHPA 3DHKH 1MTWA 1XXDA 2ALPA 2VWLL 2P93L 4X2YA 5FPYA 1GHWH 3AASA 1XKAL 8LPRA 1UO6A 1Z7KA 2SGDE 5L2ZL 4BAKB 3BT2A 3ATWA 4A7IA 3F9EA 4NZQA 3KRKA 2RA0L 3EA8A 3TJUA 1K36A 1UTNA 4Q4LA 1UK2A 1PRHA 3LGYA 5KEDA 3ODFA 3OE7D 1O37A 1A3BH 3RU4T 2B5TB 1O2SA 4AZ2B 4OGYA 3Q77A 2OLGA 2BXTH 5CHAC 1YYY1 3LTGD 2W26A 2JH6D 2DE8A 1VCPA 5FAHA 1LVYA 1ZGVA 3O8DA 3ELAH 1WOFA 2IPHA 1RTKA 2QF5A 1GMDG 4RN6A 1HIAB 2ODYB 1C5TA 5HXFA 1PPFE 3TH3H 3MH4A 5EXLA 1FE2A 3LIWB 1HRFA 3W95A 5JB8S 3MQKC 1A7SA 5EQSA 1ADXA 1XKAC 3ZYIB 1MABB 3E0NB 4AGJA 1KDQA 3MNBA 3GY6A 1K37A 2BVXH 2QF0A 2XWAA 2PHBB 3SJ9A 1MQ5A 1P8VC 1EZSC 1TGBA 3HKIB 3VFEA 3LKWA 1L1JA 3ZZ7A 3BIVH 4ISIH 2EEKA 3F2GA 1HXFH 2A32A 4UE7H 4JZDL 1F5KU 3Q3KB 1Z1JA 1THSH 2AYWA 3F1SB 3N7OA 1EMOA 2GKVE 2GD4A 1F0SB 3H7OA 2Z3EA 2I6QA 2W6ID 3STJA 4WF8A 1AZZA 2HNTE 3SJKA 5JBBS 2K2TA 2WYJA 1FIWA 1OP0A 1W0KD 4RRZA 1FNIA 1OOKB 1HXEH 1ZMLA 1ZSLA 3T28A 1QL7A 2VWOA 4Y8YA 1NU9A 1P2KA 2GJGA 1MZDA 1LK9A 1BBRK 3DSOA 1QA7A 1BTYA 1UVUH 1AUJA 1T8NA 2BVSH 1IGZA 1NPEB 2VVCK 1AWFH 2ZGHA 1VKYA 4YLQH 1GMCF 3TVJB 1HJAC 2G55A 3UR9A 4Z0LA 4WJG2 3NT1A 2OK5A 1O3BA 1W7XL 2JETB 1QIUA 1O3AA 2HLCA 5FPSA 2F9BL 1RIWC 3HPTB 2QY0B 1FAXA 3MDLA 1Y3VA 1YPJH 3V13A 3UQOA 1V2WT 1UHBA 1G37A 5FBIA 1YBWA 3CFWA 1T32A 2RCEA 2QAAA 5F8XA 2GCHF 4G1MB 3RMNH 4AB9A 4K1EA 4NIYA 2Y5GA 3ZZ9A 1P2OA 5ESBA 1RJXB 1UTKA 3F3BA 3HS7A 3KK6A 2PKSB 1D3QB 1N6XA 4TWWA 5H4IB 2C8ZB 3KYFA 1MTVA 2J97A 2JH5D 1L1NA 4MNXA 3RC5A 3LTFB 4ZKNU 3M7TA 3PTBA 2H1UA 4GU3A 1ELGA 2ZC9H 3S7HB 1E0FD 5I46H 2J9NA 6CHAB 3KQEL 1GMCG 3U73A 1TGCA 3M5OA 5LPRA 3KQ5A 3UOPA 3OAAD 1S82A 1BCUH 3MWIU 3GY8A 4MMYB 2VVCA 1FDPA 3RXVA 1JXPA 1C5WB 1GVKB 3BIUH 1GMHF 2FLBH 1SI5H 1G3CA 3EA9A 1C2HA 1CT4E 2KZ4A 4CUEA 5CKNA 4TSFD 1UTOA 3TLOA 2JKHA 2PSXA 1TQ7B 3SJ8A 2GCHG 1OXGA 1C5VA 4DURA 4OS4A 1CVUA 5EIYA 1WCZA 2MGPA 1CGIE 1WDIA 3GCTF 1SGYE 1CQQA 1NFXB 2P59A 3W1EA 1XUIA 4YOGA 1F0RA 3L3TA 2BOKL 5HGGA 3SGQE 3VGCC 3NUMA 1AGJA 3SZEA 5C67A 1XUKA 1EOLA 1GBHA 1DX5M 2WG3C 2XNIA 2FLRH 4ZXYH 1FLEE 3EE0B 5B6LA 2WPJE 1AUTL 3EA7A 4UFDH 2I9BA 4DT7B 3ZVCA 1F7EA 2VWLA 4QT8C 1HAZB 5FDQA 3QO6A 1GMHG 1ORFA 2G52A 1LQDA 3MI4A 2RA0A 1H8HD 1GDNA 1PPHE 2NWNA 4KP0A 4AG2A 1TBZH 3K9XA 2GZ9A 1HCGB 4RRWA 1V2ST 1ELEE 3RXMA 4FUHA 1DE7H 3GCTG 1QURH 3LAQA 3KQCA 4FVDA 5EPYA 1Q2WA 3MU1A 3MU8A 2WV5A 1V2PT 2TGAA 2R3YA 1TRMA 3C1KA 3LGVA 1XM1A 3KCGL 4OS2A 2VVUL 3SJIA 1G36A 1PPZA 3ESTA 1G3EA 2ZTZA 1VGCB 2AHME 2Q6DA 1SLUB 1AUTC 3SBKA 3M3SA 1FONA 4MNVA 4Y79A 4ASHA 1H9LB 2TPIZ 1ZAQA 5F8ZA 5BPEA 2BY8X 1GHXH 2Y80A 2SGPE 3N8WB 3KEEA 1ABJH 1EPTC 2UUKB 3BPSE 4A5TS 3RXBA 4TY6A 1GBEA 5IDKA 1LDTT 1K1IA 1LMMA 2VB0A 1EPHA 4NFFA 3B8JA 5DO4H 2NU1E 1V6DA 4IC6A 2JH0D 3SHCH 1AMHA 1BMLA 5E8EH 2ZDVH 4NA7A 4Y0YE 1IQLL 1QGFA 2GTBA 2BVRH 1ELFA 1MKWK 3A7TA 5JVYA 1NO9H 1FPHH 2PLXA 2BSFA 4U01A 1G3BA 3QTVH 4I7YH 1V2MT 1C5XB 1SLVB 2QCYA 3QTOH 3S9BA 4D8NA 2P94L 1DY9A 2QGRA 1PFXL 1A0HB 1AN1E 1C5SA 4RT0A 4Y71B 2VINA 4E1GA 1TNHA 1DWEH 2B7DL 1D3PB 3GDSA 1AE5A 1EQGA 2DUCA 1O5DL 2TIOA 1WXRA 4NA9H 1BJUA 1EQHA 1P10A 1SGRE 4ZHLU 1F0TA 1HAHH 3BTKE 3E91A 1O3GA 3GCOA 2ZIQH 1T4VH 3BG8A 2K8IA 2ZDMA 3QX5H 4IS5A 1TX6A 3SGBE 3RM2H 4K60A 2BT8A 1THRH 1G2MB 3PRBA 1GJ7B 4X6NA 2J92A 3FCSB 3NRLA 3DSGA 5CHBA 4ISHL 1UTPA 1BRBE 1FN6A 4RUTA 1BTHH 1V3XA 5KGOA 1W10U 2NU3E 1O2RA 1PFXC 1BJVA 1SGPE 3BEFB 2VU8E 3GISB 4DIIH 3SV6A 1IQML 4LMFA 1BHXB 4BTIA 5ESTE 4E7RG 1DVAH 1MUEB 2Y6TA 3IG6B 5L30H 1O35A 1GJAB 3MU4A 4BXSA 1AVGH 4Q2KA 4Z6AH 4INLA 1DOJA 2WPLE 2IPQX 2ZHWH 4X6MA 5EXNA 2Q6GA 3LT3A 1ATAA 2YOLA 3PB1E 2HOXA 2FIRH 1IQFL 1HFDA 1VCWA 4LOYH 3DCLA 3NJPC 1W0JD 4ZAEA 3KQEA 1W12U 2OC8A 5AF9H 2FYQA 2P3FL 1FSBA 4Q63A 2DE9A 5E0JA 1QL9A 2Y82B 1BTXA 1SGNE 2JJ2D 1YLNA 4JMYA 1S6HA 2JJ1D 1BRUP 4AORA 3ZV8A 1ZHPA 2ULLA 3JZ2B 3FVFB 4YOIA 3N8VA 1GBKA 1V2VT 1ZRBA 3N7EA 1WU1B 4JYVH 1IHTH 1EJMA 3G01A 2IJOB 3NXPA 4Y7BA 3SOSA 3VPKA 1EJAA 1G1SA 2VBCA 2GGVB 3SGAE 2EC9H 3A82A 4GHQA 4LZ1H 1HX2A 3GCHB 1CSOE 4KELA 5JBTA 1UK3A 1YGCL 3ENSA 1LO6A 1FAKH 2M74A 1NFUB 1DLEA 1JIRA 1INCA 1GBLA 2BX3A 2BLQA 5FL7D 4UD9H 3SQHE 1F5RA 2KCOA 4CUDA 1NY22 3T29A 2ZU5A 1P12E 1BF9A 5E8DA 4ABAA 7ESTE 3U98H 2A5IA 1QB9A 4XD7D 5L2YH 1A3PA 4F4OC 5AVDA 2A2QH 2NU2E 2AMPA 3I78A 3SW2B 1FI8A 1O2KA 3I77A 1Y59T 1L0ZA 4FU9A 3N8YA 1CA0B 2Q6FA 1QB1A 2AIQA 1V2UT 2G00L 1AY6H 1GI4A 2ANYA 2BQ6A 3AW1A 2A45B 5PTPA 4B2BA 3KF2A 2BDGA 4CHAC 3ZYGA 1CVWL 1BRCE 3EQ0H 4E7NA 1K22H 3V3MA 3P8GA 2VVUA 3LC3B 4O3UA 3GISX 1KSNB 5L6NH 5LPEA 1GHAF 1K21H 1MU8B 2WPMS 2EI6B 1XVOA 1UCYE 2VWNL 4Q7YA 1UTQA 2WPHE 3FANA 1FV9A 2UUJB 1W0ZU 1Z1IA 1KY9A 1AHTH 1O33A 1C1PA 2CJIA 1O5BB 1TPSA 2GCTC 2Q1JB 1B7XB 1LVOA 1QZ8A 5JBCE 2PP6A 1MZAA 4MNWA 1Y3YA 1ELBA 3EDXB 4ZCNA 2A4OA 1QNJA 2XTTB 2YMSD 1HZ8A 3SNEA 1OX1A 1DXPA 1PQ7A 2P94A 5F8TA 1ARBA 3O8BA 2KL7A 1YCPH 4CRDA 3ZZ6A 4E05H 1C4U2 5DP8A 1JL9A 1GHAG 2ZFSA 1ANEA 1PQ8A 2BLWA 1AB9B 1VITH 3B9FH 3PTNA 1QFKL 1XUJA 1EPJA 1P57B 2FMJA 1MQ5L 2YMSC 1OP8A 3U7UG 2O9QA 4HTCH 3RXCA 1GGDB 2FI4E 2QE7D 1BDAA 3EYDA 2J34B 3QK1A 4M7GA 5DSFA 1KLJL 1YPHE 5GNDA 3CENL 3VB5A 1IQHL 1A1RA 1MKXH 1P06A 2Z3CA 2STAE 2OTVA 4ZH8A 5C0TA 1TALA 5T3HA 2ODPA 2Y7XB 5SGAE 1O3IA 1IOEL 1BA8B 1QRXA 4B75A 1NROH 2BMGB 2SGAA 1IAUA 1SPJA 2QXIA 1H8IH 3RXJA 1IQMA 3GOVB 1T31A 1C1TA 2OBOA 1V2KT 2J4IB 1KXAA 4IMQA 2BQWA 4H6TA 4CRAA 5CDFE 3BV9B 4D76A 1CHGA 3KYGA 1LVBA 1ZPCA 3PMHB 5B6OA 1C1WH 1IQFA 1TGSZ 1KIGL 5ABWA 2THFB 3HS6A 3A87A 1GHYH 2YGPA 3RMLH 3MOCA 1EAWA 4CSYA 2A4QA 4YM9A 2PGQB 3UREA 3ZV9A 1PJPA 4X1NU 3A85A 3HGNA 4NWKA 2YGOA 1CGJE 4RRYA 1O3MA 2AGIX 2FP7B 3IWMA 1V2LT 1FAXL 1PYTD 3KL6A 1CGHA 2W7SA 4I8HA 2XCNA 3ZYJB 2OBQA 4Z0KB 3ATIA 3BTHE 3LGIA 4NSYA 1VCQA 2P8OC 3LGUA 3T2NA 3A8AA 2WPIE 5E0GA 1MBMA 1EX3A 5TCAA 2OCVB 1TPOA 1Y3UA 1G3DA 1C1UH 2P26A 1O2JA 1G9IE 2OYEP 2R9PA 5EJZA 4ZHAB 1EZUC 1QBNA 1PYTC 2XBYL 2FYRA 4Z1MD 3CS7L 2TGPZ 3DA9B 2UWPA 3PLBA 1DFPA 1LMWB 2ZTXA 3H09A 1GJ5H 5A0AE 3UWIA 3FP7E 3TJOA 1OWKA 3UR6A 4X8VH 4O03A 2F9OA 1LPZB 3OYPA 3NK8A 1UVOA 1NRPH 2A4RA 4B1TA 1ZRKA 1LHFH 3TBDA 2K0QA 2GZ7A 1P2IA 4CR9A 2F9UA 4WXVA 1ZZZA 5FXLA 1EJNA 2H9HA 4D90A 1O2ZA 1VZQH 2B0FA 3ATLA 4YESB 1TX8A 2FS8A 2ZCHP 1N6YA 1SGCA 4MPVA 3VG8A 5FBEA 1IQKL 2HGTH 1FX0B 2A31A 3BSQA 2G00A 1G30B 2FOEA 1CT0E 2FTMA 5EG4A 1GI9B 2BO2A 1GJBB 3SORA 3CP7A 4DGJA 3M36A 3P92A 1G2LB 3BG4C 4BDXA 1O3PB 2STBE 2ZEBA 3OX7U 3OY5U 1C1QA 1LTOA 4VGCB 4I8JA 1ZMNA 1ATBA 3SU2A 3A80A 1OS8A 3ZZ4A 1EBVA 1DIYA 4BANB 3ZYDA 4NGAH 1LKAA 5DP4A 2BDIA 1ANDA 3K6ZA 3HO3A 2F3CE 2QA9E 4YZUB 1G32B 2P16L 2VWNA 5COXA 3A86A 4KKDA 1TIOA 1RGQA 1IVOC 3U8OH 3SOQA 5AFYH 3ZVGA 1TBQH 4ACAA 3TK6B 3E8LA 4B74A 1MMJN 4FOUC 2W7UA 1G1RA 2WHXA 2W2PE 1CEJA 1FUJA 5KN5C 1IQEA 1Q3XA 3KQCL 2OUAA 4ZXXH 1QBVH 2W2QE 4BTTA 2VIWA 2VH6B 1P3EA 1KXDA 1BTZA 4HZHA 3F2HA 2Y81B 3OLTA 2ZU1A 2C8XB 3TK5B 2WG4B 4GSOA 2ZO3H 4KGAA 5DP7A 3U69H 4BAOB 1AD8H 5FCKA 1C5YB 1AKSB 1RD3B 2BZ6L 3VXEH 4I8KA 3OTJE 1GWAA 1M1XB 2G5VA 5JB9S 3E16B 4X1RU 2ZI2H 3GY4A 2WPLS 5F6MA 7LPRA 4Y76B 4AFQA 1C4V2 1MOXC 1PTHA 3SNDA 1HAFA 1C5MD 3UTUH 2WINI 3V12A 1MD7A 3CENA 4LZ4B 1GBFA 1IQHA 1D3TB 1TGNA 3OFND 5L2ZH 1EB1H 1G1QA 4WMDA 2UWOB 4FUIA 1F2SE 1W14U 9LPRA 3D23A 3RU4E 4BTUB 1IOEA 4IGDA 4JCNA 1V1IA 1TFXA 2G4UA 4M10A 1GK5A 2VIOA 4FU7A 1QQUA 1O2NA 1WSSH 5C1UA 2GV6A 1HIAA 1C5UA 1ELDE 5CKQA 1QL8A 1HAEA 3LIWA 5FHTA 1TQ0B 4FUGA 3O8CA 2UUYA 4XDEA 1TNIA 1H1BA 1XX9A 1EGFA 3UWJH 2OQ5A 1GG6B 4DT4A 2BY9X 3BTQE 2HVXA 1GCTB 1GI8B 2PHBA 4WH8A 3SU0A 4Q80A 4RI0A 3JZ1B 3QGJA 2BTCE 4MMXB 3MFJA 1WTGH 2H9EL 4AOQA 6COXA 2VGCB 1YUFA 1O3HA 5DJ7A 1NBME 3NTBA 1C2IA 3QGNB 2AEIH 1S85A 3BTWE 3CNRA 1ATEA 3Q3KA 4GPGA 1NFWB 3RC6A 1XVMA 1TLDA 1TA6A 1EXFA 3SHAH 1EZQB 1F0SA 1LHGH 1UTJA 3A7ZA 2KFWA 4JZDH 2G5NA 1E1RD 3HK6B 5DP3A 3NKKA 1GBBA 3U1JB 4O1ZA 1DPOA 1DM4B 1UZKA 1A46H 2V3OH 4A92A 4JZEL 1O3FA 2UWLB 1P04A 3MHWU 4B6FA 2GVFA 1P03A 1P3CA 2C4FH 1IOXA 1A61H 2EY4C 3V64C 8GCHF 5IKTA 2XBYA 3GDVA 1L2EA 3CS7A 4X8TL 1EFRD 1UK4A 1P9JA 2F9VA 1MAXA 2Y5FA 1MAYA 3D65E 3P8NA 1SOZA 1DX5I 1BZXE 5CHAB 1C1MA 1O2VA 1O3OA 7KMEH 1KXCA 4AX9H 3MO9A 4IN2A 4BOHA 1YWUA 3TIUA 3SYJA 4MTBA 2WZPP 4OS1A 5C2ZA 1SGTA 2ZDAH 1LKBA 1PPBH 1F5LA 2ZNKH 1V2RT 3WY8A 3FKSD 2PKAB 3AAVA 3QH0A 1GBIA 3HPTA 1K1LA 1FPCH 1E34B 3R3GB 1W7XH 1CBWC 5IKRA 2F9BH 4SGBE 3KQDL 2W3IB 3FBYA 4BAQB 2G81E 5JW1A 5HM2A 1N8OB 1C1RA 1IQKA 1Q31A 2VIQA 2FO9A 4FUEA 8GCHG 2RDEA 5EW1H 4NWLA 4HGCA 1E35B 2ZF0H 1S6FA 2ASUB 1OSSA 4B73A 1GVZA 5EODA 4ABHA 3S7KB 2TRMA 3O8RA 3FP6E 4WMEA 4SGAE 2BDYA 3SN8A 1FF7A 1JRTA 2EI8B 4P00A 4WVPE 1H4WA 1IQIL 1YM0A 3UFAA 4MPXA 1YUKB 1Z8RA 1TBRH 2J95B 2P16A 2BLVA 2PUXB 2QF4A 3E6PH 3LPRA 4GAWA 2WFTA 4WXIA 3TJNA 4YXWD 3IJEB 1YLCA 1ZTJA 2R3UA 3FZZA 4Y79B 4CUFA 1W11U 3WW7A 3ZZBA 3MU5A 5JPMH 1KLTA 2BLOA 3PV5A 1FN8A 1K1OA 2GX4A 1YKTA 2V6NA 1DWBH 1SMFE 2O8UA 2PWXA 3LC5B 2PUQL 1O2TA 1ESAA 3RXGA 1O30A 3QUMP 3ZZ8A 4Y8ZA 5JBAE 1QHRB 4MPWA 2CF9H 5EPNA 1T8LA 2VNTA 3U9AH 1UVPA 3TGIE 1DSUA 1HJAB 1TE0A 1NFXA 4A1VA 3Q00A 4Y0ZE 2ZDNA 4ABGA 1O2GH 3PRDA 1BT7A 1XMNB 2Z94A 3V0XA 2A7CA 1EP5A 4AG1A 1HJ8A 3UAIC 2GT7A 1GI7B 1UW7A 3MH5A 1NZIA 3ZZDA 4D7GA 4U30A 3UOUA 2BY6X 1SQOA 3CS0A 2Y5HL 1DICA 4X1PU 3U8RH 4XBCA 1DDXA 1Y3XA 1Z71A 2QXHA 1MH0A 1WTHD 2QF3A 4FU8A 3A8CA 2ZHQH 2XWBI 1LHCH 3FP8E 1J16A 1HCGA 4FM5A 2KAIB 1O34A 1ELAA 2PGBB 2XC0L 4YT7L 3D62A 3SNBA 1E36B 3SZNA 1J9CL 2VH0B 2WPKS 4D9RA 4Y7AB 1U67A 1KLIL 1APQA 4R0IA 1P2JA 2F91A 2V0BA 2WYGB 2KCPA 1SQRA 2WPIS 2FI5E 3RXRA 4FUDA 4TY7A 2MHPA 3KCGH 4FUJA 1FFMA 1GI2A 1PQ5A 3N8WA 1C5ZB 1LCYA 1AU8A 2J94B 1HJ9A 3M37A 4UFFH 3PROA 1NPMA 2VJ3A 4JZFL 2FS9A 4ABDA 3SUGA 1J14A 2KR7A 1IJQA 3HATH 3TITA 4H42U 2ZFTA 2GMTC 1GBCA 4RRXA 2CF8H 3E90B 1W2KH 1SR5C 1SGFG 2QN5T 1KTTB 4TT3D 1C5NH 3OEED 3AW0A 2XBWL 2PTCE 1HAPH 2P3UB 1QA0A 1WHFA 2ZFQH 3HKJB 3S9AA 3NCLA 1LHDH 1BMFD 1ZLRA 3M35A 4XBMA 3QLPH 3M5LA 3N7DA 4M11A 1TOMH 4INKA 3MNCA 1RTLA 5T6GA 1AZ8A 1EB2A 1UJ1A 4JZIA 1JBUL 4RSPA 3IITB 1TAWA 2ZFPH 3A7XA 4Y71A 1A5HA 1O2PA 4CBNA 1BITA 5EGMB 5E2PA 5JB8E 3H5CB 2QC2A 2M2AA 2CHAC 1W8BL 4IC5A 2A2XH 3URCA 2B7DH 4MMZB 3D49H 3T62A 1O5DH 1KMHB 2A4GA 2OYUP 1Z6EA 1N1IA 1EKBB 1G2MA 2PR3B 2P95A 4O3TA 1YPEH 1NRQH 2AIPA 1AIXH 1HLTH 1SFQB 4MQAA 1BMMH 1ZJKA 1IQJL 3UUZA 4ISHH 3V7TA 3KQDA 1Z6CA 4NFEA 1EPTB 2OC7A 4ABJA 4ABFA 5JBBE 3VB4A 4H4FA 4J2YB 1LPKA 2KV4A 1ZMJA 1AB9C 1EPIA 1HV7A 3LN0A 2XXLA 3ZVBA 2HNTF 4CBOA 3H7TA 4K8YA 2O8TA 5F03A 1TX7A 1DITH 3BF6H 3PLKA 2ZDKA 1C2DA 1QY6A 1MTUA 4JZ1A 1ZPZA 1IQIA 1KYNA 2BQ6B 1ETTH 1SGDE 2FOFA 3R0FA 1VJAU 1OHHD 4D9QA 3F6UL 2VRSA 2BDHA 1JV2B 2VIVA 2XYAA 2DDUA 1O2IA 2BHGA 3BT1A 4ZKSU 2ZHFH 2OD3B 1V2JT 2J2UB 3BEIB 4ESTE 1ZYOA 4D7FA 1C2KA 1HAVB 2Y82A 2P3FH 2Z9GA 3RR3A 1LPGB 1O2LA 2SGFE 3PO1B 1MTSA 1AWHB 4PH9A 3N8ZA 3ZZ5A 2H2ZA 1GJDB 4FXGH 1AE8H 1ARCA 1I0UA 3VEQB 1UCYK 4IN1A 1UZQA 2FPZA 3M36L 1WU1A 1Z6JH 2L6OA 1RRKA 3SV7A 1ELVA 2CGAA 2C3SA 2VIPA 1FIZA 5FX5A 2GP9B 2XBXL 1WV7H 2L74A 2BZAA 2WV9A 1SG8B 1SBWA 1WHEA 1AFQC 2AS9A 1HAOH 1P0SL 1UTLM 4Y11E 4B2AA 1YF4A 4X8UL 3SJOA 1Y3WA 3ZIAD 1YPGH 1Z8GA 3UB0A 1QRWA 2A7JA 1O5FH 1D4PB 1NFUA 3MNXA 1YGCH 3EGFA 5GJ4B 2ZFFH 2Y5HA 3TH2H 4Q7ZA 4B76A 4DIHH 4AC9A 1CE5A 2FI3E 1BMAA 3HK3B 1Z8IB 4I33A 4J1YA 4UDWH 6GCHF 4R8TB 1QB6A 3PYHA 1IQEL 1IGXA 3KNXA 5EQQA 1DUAA 2WUBA 2W2OE 1DSTA 3QZQA 5HKKD 2P3TB 4DJZB 1E79D 2XBVL 4YT6L 2J98B 2BQ7B 4I8LA 3POYA 3P6ZB 2XC0A 3RXSA 4TPIZ 1DXWA 4XBBA 4X8SL 1ZTKA 2RG3A 1D6RA 5CMXH 1L4DA 3E0PB 5BRRE 3LH3A 3FAOA 2XRCA 3GYLB 2LNCA 2Y7ZB 5CISA 3MO6A 4X2VA 3F9HA 2ZTYA 2FOAA 1CVWH 3UNRA 2FZZL 1GBAA 3RLYH 3P8FA 3UIRA 2ZU4A 5C1YA 2ZPRA 2SNVA 2EI6A 1SB1H 1HGTH 1HAIH 5E2OA 3SO3A 2ZHEH 4ZUHA 3OTPA 1N7DA 1K28D 4RS0A 3M61U 5DK1A 6GCHG 1P05A 1S0RA 1O5EH 2BOHB 3B23B 2ZPSA 2FOGA 5IYTA 2Q1JA 2XBWA 3SOVA 2F83A 1FQ3A 2R0LA
chains in the Genus database with same CATH topology
1YUGA 1DT2A 1ZSJA 2TBSA 5GDSH 2D1JB 2BDAA 1LQEA 4UFEH 1PPCE 2ZZUH 1C2LA 1C5MF 3GDUA 2SNWA 4BDWA 2ZKSA 1YPLH 2PV9B 4VGCC 5T6DA 5A8XA 2VWMK 4ISOA 3LDXH 1F7MA 2UUFB 5K0HB 4WH6A 3V65B 2BD5A 2V35A 1E38B 1TB6H 4ZKRU 4ISLA 2AH4X 4AYVB 1HT8A 3TPIZ 2GDEH 5C5OA 2AFQB 4CH2B 2C93B 2ZPQA 3PMJA 2FX4A 3LGTA 5ETXA 3E1XB 3Q3YA 1QFKH 3SNCA 4YLUA 2J34A 4XL1A 2UWPB 1M9UA 4CHAB 2BD7A 1HAXB 3MU0A 2WPJS 1HBTH 3RU4D 1CX2A 1O2WA 5CKMA 2OINA 1SGEE 4WY3A 2LPRA 4UFGH 1DLKB 1KLJH 4NG9L 1B0EA 1RFNB 2RDLA 3KN2A 3T25A 1NS3A 1IQJA 2EI7A 2FM2A 2Y7XA 3MO3A 1GJ6A 2W3KB 1WUNH 3ZVEA 2BMGA 1ZGIA 3TK9A 3RXHA 1ANCA 2GZ8A 5HMAA 1C9PA 2ZGBH 8ESTE 4DY7B 3PMBB 4NCYA 3ODDA 4CRGA 3DD2H 1JWTA 5LH8A 3GCNA 1C5PA 1Y5AT 2J4IA 1NFYB 3PGHA 1DS2E 4I31A 2TGFA 1O39A 2Y5FL 1GI1A 2HNTC 4AB8A 2VWMA 1YCPK 5JBAS 1UVSH 2D2DA 2R2MB 4B71A 1D3DB 1ELCA 4UEHH 5DG6A 1O3DA 5EOKA 1EOJA 1KTSB 3SU4A 1IQNL 3DEMA 1O31A 3FFGL 4JYUL 2J38B 1FXYA 3A83A 4HFPB 3UQVA 3ZZAA 1P11E 1HYLA 1KIGH 1SHYA 1L3YA 3VB6A 2BOXA 1SFIA 2C8YB 4X0WU 1D6WA 1K1MA 3S69A 3HS5A 2H5DA 1UMAH 1GHVH 5A0BA 1OWEA 1G1TA 3ATKA 4ABIA 4Z0KA 3HO4A 1C9TA 1MKXK 4X2WA 2EA3A 3T27A 4A7IB 1PGEA 5T6FA 4XSKU 3S0NA 1GPZA 1ACBE 1SGFA 3RXQA 2IOTA 4NIWA 5J4QA 1AO5A 3ELAL 4IW4E 4OS5A 3STIA 4AFZA 1FJSL 4ZKOU 3RLWH 2XBXA 4COXA 2W26B 3PWBA 4ZHAA 2H9TH 1EAIA 1EAUA 1GG6C 1O36A 3RC4A 3TH3L 2I6SA 3VXFH 2XC5L 3MH7A 5DP9A 1AVWA 1O2XA 4CR5A 2JETC 1T8MA 2IN2A 5A0CA 5JDUB 3UPEA 1W7GH 2R2WU 1BBRH 1QJ6B 3MNSA 1BRAA 2P3FN 2NPRA 3OY6U 4Y8XA 2FODA 1WAYB 1LPZA 3S9CA 3TZIA 1TNLA 1KDQB 1ESTA 1BHXF 1P09A 1TNKA 2A5KA 4KTSA 3ZZ3A 3U8TH 3C27B 1GJ4H 4ISIL 1O3JA 3GY2A 2PTNA 2ALVA 1H9IE 2PKSC 1OWHA 2XBVA 5LGOA 3KHVA 2AMQA 1H9HE 3GY7A 5FCRA 1A0LA 1FY1A 4ZMAH 2GD4B 1QCPA 1PPEE 3GY5A 4K1TA 1L1GA 1OWIA 1G2LA 3UNSA 6CHAC 3A81A 2WYJB 1S0QA 5J4SA 3LU9B 3SOBB 4C16A 1BIO