3F1SB

Crystal structure of protein z complexed with protein z-dependent inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
259
Chain Sequence
NECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Protein Z-dependent protease inhibitor
total genus 66
structure length 259
sequence length 275
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3f1sB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB02
1OP8A 1VJ9U 3SV8A 1TA6A 2D8WA 3SW2A 2XBWA 1GL0E 3AW1A 3M7UA 1TNJA 2RHPA 1WAYB 3SORA 3AW0A 2XRCA 3GDVA 3ATKA 4NZQA 1O5AB 1V2WT 2HVXA 1IQEA 2XWBI 1SC8U 1HJAB 1WTHD 5T6FA 3OTJE 2AIPA 1W3CA 3NZIA 1W14U 3VFEA 3OY6U 2SGFE 2XBVA 3ATMA 4HZHA 2Y38A 3VXEH 4ZAEB 1DDXA 4Q7XA 4TWWA 3RU4D 1O3EA 1XFEA 1UZKA 1RFNB 3D65E 1SLXB 4KTUA 4D90A 1QTFA 3U9AH 1ZLRA 1WQSA 4JZDL 1V3XA 1QRZA 4RSPA 3KQEL 1O3MA 5EQRA 4PH9A 1ETRH 2VVVA 2VU8E 1XX9A 2Y81B 3FZDA 1AKSB 2Z9LA 3LDXH 1K1PA 4SGAE 4E06H 1EQGA 2TGDA 1WYKA 4X2YA 4C16A 4B2CA 1Y59T 5L30H 1UZJA 2Y82B 3RXMA 4X8UL 2ZFPH 1GJ5H 1Z7KA 1OYQA 3U8OH 1GJBB 1JRSA 4Z0LA 1DX5M 1V6DA 4AG2A 3PO1C 1C5YB 1SGPE 1TOCB 2P95L 5FBIA 2IJOB 2PKSB 2QXJA 3ZZ3A 3RXQA 2QF3A 1DWEH 2Z9IA 1DY8A 4MNXA 3BT2A 2WYGB 1E38B 1IQNL 1ELDE 7LPRA 1BMAA 1EOLA 4XFQA 3TBDA 1CQQA 3NK8A 1EP6A 5C1UA 3KRKA 3QK1A 1EXFA 1JBUL 1SFIA 2AYWA 2UWLA 3LGVA 5C67A 2A5IA 2R3UA 1L4DA 4F4OC 1NM6A 4MQAA 3S9AA 1PQAA 1ABJH 3A85A 3QGJA 4O02B 2HNTE 1O2ZA 2ADXA 1T31A 1GI5A 1ID5H 1AQ7A 2F9PA 1QNJA 3LGYA 1NROH 1GBBA 4X8TL 4X1SU 1GBJA 3ZVDA 1P2KA 1HJAC 1T32A 2NU2E 2O8WA 1IQGL 1AGJA 3ODDA 4Q2KA 5DP8A 1BRUP 1C2KA 1OWDA 2HNTF 3TGFA 4RRWA 3AASA 3GDSA 5FPTA 3NJPC 1GBEA 4Y7AA 1GBLA 4OS1A 4CH2B 2PGBB 5DP7A 1MMJN 5FX5A 5E0HA 4K69A 1EZQB 1IAUA 3SU2A 3EA8A 2ZPQA 3SNAA 1TX8A 4NCYA 4ZXXH 3LIWA 1T4UH 4COXA 1C2EA 2ZC9H 1EASA 2FX4A 5C5NA 3MFJA 5PTPA 4Q80A 1K9OE 3I77A 1ZHPA 2P59A 1KTSB 3N8WA 1TLDA 1AUTL 1GI8B 2QGRA 3RXAA 4D7GA 2SFAA 4FVDA 3RLWH 3ZZ8A 2VWNL 2ZU2A 4AX9H 3BIVH 1EAIA 1O2PA 1A5GH 1ZAQA 3A8CA 2ASUB 1AWFH 2M5TA 2OC7A 1FN8A 1QURH 1GBKA 1GVZA 2QY0B 4Y8YA 3A8BA 1HAGE 1ABIH 1KXEA 3LJOA 2PKAB 4NA8A 3GY5A 1JXPA 3UREA 3MH7A 5SGAE 1PFXC 1BRAA 1SGFG 3RXDA 2BVSH 1SB1H 2UUFB 3VB3A 1CVUA 1Y3XA 3FAOA 3A7VA 1C2IA 1HJ7A 2OC0A 3EYDA 1UK2A 2RCEA 1OB1C 4HFPB 1SHYA 1A46H 3N8YA 4FM5A 2ANYA 1OPHB 1O3OA 1H9IE 2BQ7B 1TGBA 2AMQA 4FUBA 1TNKA 1FN6A 4XBCA 4D9RA 1C1OA 1ADXA 5FPSA 1BCUH 1C2DA 3SU1A 3C1KA 1DQBA 1P09A 1W10U 2LPRA 3LGUA 1E37B 3T28A 3MNBA 1MCVA 3SZNA 2FOAA 1MQ5A 2FLGA 2P16A 1G2MB 1A3PA 2A7CA 3SBKA 4BDWA 1FIWA 3WY8A 1FI8A 1C1UH 3HO4A 3ENSA 2FOCA 3O8CA 2FLBH 2Q1JA 2ZGXH 3PLKA 2LNCA 3LT3A 4B76A 5FX6A 2BQWB 3URDA 4B73A 3TLOA 1TGSZ 1N7DA 1BBRK 1KLIL 5F8TA 5JVYA 2J2UA 2KAIA 3TU7H 4DIHH 2STBE 1LCYA 4YLUA 1F0SA 3PMJA 1G2LB 1Z8IB 1NRPH 3LN1A 2AGIX 3Q77A 2OTVA 3OLTA 1ZHRA 2R3YA 1AE8H 2BXTH 5T6DA 3T62A 3A8AA 8ESTE 1IQFL 2O8UA 1GMDF 4GVUA 1F5RA 3KL6B 5DK1A 1BTHH 2BZAA 2QAAA 2A4RA 4TPIZ 1W7GH 3BTDE 1HAVB 2ZTZA 1UTQA 3H7TA 1SQOA 4BTIA 5FHTA 1O2SA 1TIOA 2FX6A 2ZZUH 4MPWA 1C5TA 4IW4E 2FZZA 1JWTA 3PB1E 2J95A 1C5PA 1CE5A 2R2MB 1XDTR 1TPAE 2P95A 2XTTB 2PW8H 2FOFA 5AFYH 5T6GA 2OYEP 2XBVL 1CEJA 1GCTB 2VNTA 1V2JT 2XWAA 2ZIQH 3LGWA 1HIAB 1ELGA 2ZU4A 2W7UA 1MKWH 2VVCA 4ISHL 1TQ7B 3QO6A 1YLCA 1GJ9B 3M36L 3UPEA 3NXPA 2ZEBA 2QXHA 1TE0A 1RXPA 1OP0A 5LH8A 1MKXH 1JV2B 1BBRH 3SV9A 3SU5A 1EPTC 1RIWC 4X8UH 5E8EH 5A0CA 3VGCB 3R0FA 3RXHA 1QCPA 2FYQA 2NWNA 3MU4A 1ZPCA 5L2ZL 3P8GA 1UZQA 3TNSA 4D7FA 2MGPA 2BDGA 2QXGA 2OC8A 1KSNB 3A87A 2VVUL 5TCAA 1HREA 1GI3A 2R0LA 1N1IA 4BTUB 1Q3XA 3LPRA 2VINA 1CBWC 3SJ8A 3MYWA 1SHHB 3ZZ5A 1D3DB 4UDWH 1HUTH 4RKOB 3RUOA 1EPIA 5B6OA 3V0XA 5IYTA 1TNLA 4ZKRU 2OCVB 2ZPRA 1FY5A 2BVXH 4RUTA 1NU7B 3NUMA 1YPGH 1A3EH 4ZKSU 1BB0B 1FY3A 2A32A 1GHAF 1KIGH 1BT7A 1O5CB 2ZGCA 2P26A 3GYLB 3K6YA 2BYAX 3U8RH 4KP0A 4F49A 4DGJA 1QRWA 2XBWL 2VWLL 3GCTG 1WHFA 2D1JA 4BOHA 2V6NA 1TPSA 1FNIA 4ZHAB 1A3BH 3R05A 1SLWB 5FBEA 1Z6EL 4AGKA 1DLEA 3F9HA 1BJVA 1ELTA 1ESTA 1K37A 3QGNB 3CFWA 2ZWLH 1K36A 1MKXK 4JZDH 2A31A 2XBXA 1P03A 3PROA 1ZTKA 1GDNA 4CR9A 6COXA 2QC2A 1GHWH 1LDTT 3RXOA 1O3IA 2AMDA 1T8NA 1E36B 3BN9A 1IQML 2BMGB 1EUFA 2CHAC 3GCTF 1YKTA 4ABEA 1O33A 2PV9B 2FWWA 2OQUA 1AFEH 2VH0B 1W0YH 1AB9C 1SGQE 2C93B 1MQ6A 3RMOH 5L2YH 1AN1E 4UEHH 4UFEH 4X8TH 4XE4A 3RXJA 1FV9A 1UTOA 2F9BL 4OTYA 2THFB 1P10A 1U8CB 3KQBA 1B5GH 3UTUH 1HV7A 1AB9B 1EB2A 2ZGJA 2ZI2H 1GBTA 1YLDA 6LPRA 1APOA 1XUIA 2G00A 2WPLE 4M11A 3SO3A 1CA0C 1AVXA 1UJ1A 4B2BA 1K1IA 2Y7ZA 1NU9A 3LONA 4OS6A 3EDXB 4YZUB 1HCGA 3FFGA 4FUJA 4R8TB 1ELCA 1C1SA 1ETTH 2AERH 2FM2A 4H6SB 1C5ZB 2XC0A 4Y79A 3ZYJB 1W7XL 2J9NA 3SHCH 4AFUA 2HWLB 2XC5A 2WUCA 1TPGA 1O36A 3ZYEA 1Y3YA 3SGAE 5JBAS 1BTWA 1O2IA 3V64C 3LC3B 3GY7A 3R3GB 4FU7A 1QFKL 3SQEE 2I9BA 1G36A 2Y81A 4OS5A 2Y5GA 1P57B 2MHPA 1XKBC 1XUGA 3CENL 3PMBB 4YO9A 4E7NA 2XC4A 5I46L 2Y80B 4AZ2B 2FXRA 4O3TA 2JKHA 3OX7U 3TK5B 3RMMH 1SGFA 4BXSA 4MTBA 2SGDE 4MMZB 3N8ZA 3LGTA 3OLUA 1BMMH 1SLUB 1G3CA 2SGAA 3HO5A 1IQJA 4BAKB 1HAVA 1TNHA 1VGCC 1ANDA 2BDAA 2BHGA 5KN5C 1CSOE 3PTBA 3S7HB 1H8IH 4WXVA 1M1XB 2B5TB 3KQEA 2BXUH 3O8RA 5EGMB 3M7QA 1CA0B 1XUKA 1C4Y2 3MNXA 4NWKA 5EODA 1ZJDA 5J4QA 2TGTA 2ZHFH 2TPIZ 1O39A 1AY6H 1GHZA 1UO6A 4K1SA 1OP2A 5AF9H 3GCWE 2GGVB 4XDEA 2EI8B 3EA9A 4AYYB 3TJUA 4ISHH 5HMAA 4TPYA 1QB1A 3DFLA 1BTYA 4Q7ZA 3SHAH 5FAHA 2QIQA 4ABFA 1HBTH 5EOKA 1URKA 1TB6H 4WVPE 3FFGL 1CCFA 2ZHEH 2EA3A 1MAYA 2G8TA 1HXFH 2UUYA 2BLVA 4JK5A 4YESB 1ELEE 4X1PU 1KXCA 1YC0A 3VGCC 3JZ2B 3LC3A 1MAXA 1GI1A 1TX7A 3ZZ7A 1UHBB 1B7XB 4IC6A 1QQUA 3HS6A 1S85A 1PRHA 3N8WB 2HPQH 4XBMA 4A7IA 4Y8ZA 1H1BA 4H6TA 2G81E 4AN7A 3HKIB 2EI6A 3L6PA 4ZMAH 1C2GA 4E1GA 1W8BL 1OWEA 4WH6A 4PROA 2WPJE 1C2LA 1SMFE 1VR1H 1P12E 5HM2A 4TYDA 1C5UA 5DP6A 1NS3A 2H9EH 2DUCA 2SNVA 3VB5A 2AS9A 2VWOA 2PTNA 3BTME 1DE7H 4ASHA 5FCKA 1TGNA 1F7MA 1UVSH 1C9PA 3ASIA 1UZPA 2WPME 2AH4X 1D3TB 1L1JA 3QN7A 4CUFA 2OBQA 2JKHL 1EPGA 2EI6B 1QGFA 4BNRA 1T8MA 2VIQA 2AGEX 2WPLS 1PPCE 4NIXA 1QRXA 1JL9A 1O2GH 1YPKH 3S7KB 2WPHE 4IGDA 4OS7A 1Y3WA 2FLRL 2C8XB 1KXDA 2G5VA 1JIMA 1UTKA 1ELFA 1AIXH 4DT7B 2H9HA 4X8VH 5DP5A 1IJQA 1C5SA 1Q2WA 2ODPA 4BAOB 4CREA 1EOJA 3F9FA 1NESE 1SSXA 2ZDLA 1L3YA 2BD9A 2GD4A 4GAWA 2Q6GA 2I6SA 1YUGA 3UFAA 3P92A 4K1TA 1UVUH 3RXFA 1W11U 4ABIA 3MMGA 1P3EA 4NFFA 4IS5A 2BQ7A 5JVZA 3S9CA 1BUIA 1AE5A 2CJIB 3H5CB 3SQHE 1G1QA 2BM2A 3BSQA 3HK6B 3B9FH 3Q3XA 3TH2H 3ZZDA 3M35A 2W86A 5EXNA 1LMJA 1BZXE 2FESH 1H4WA 3RMLH 4M7GA 4JZFL 1ZZZA 4X1RU 5DPAA 1FAXL 1MD8A 3BTQE 1NPEB 1SI5H 4JZIA 1C1RA 1GMHG 2SGQE 1Y3VA 2W2OE 1EJNA 1S81A 1O2TA 1COUA 2GV6A 3P17H 4ISIH 1OXGA 5CE1A 1T8LA 2NU3E 3T25A 5KIRA 5FPYA 1C2FA 4MDSA 1GVLA 2B8OH 1TALA 7GCHF 1IQIL 5EQQA 1GWAA 1ANEA 3CS7A 4NWLA 1OKXA 4ABAA 4XBDA 1CU1A 1SL3A 2AFQB 3RXRA 3ZVEA 1MTWA 5CKMA 2VGCC 1C2HA 3DHKH 1HJ8A 3MHWU 2W2NE 4Y76B 1O5DL 3FVFB 1HLTH 4B74A 4K2YA 4Y71B 4D0FA 1VCQA 1YCPK 3KEEA 2BY6X 4O9VA 3BT1A 4JZEH 4Y79B 1LPZA 4JYVH 4NG9L 3HO3A 1SR5C 4OTJA 3LOXA 2A5KA 1SGTA 4FXGH 2C3SA 3TGJE 3PV4A 2VIDA 1GPZA 1K2I1 3QZQA 3LH1A 2FPZA 3A7XA 2F3CE 4NSVA 1NT0A 1NZIA 3W94A 1BTXA 3E8LA 5ESTE 2R9PA 1GJ6A 2ZG0H 2A5AA 1C9TA 3DUXH 3TITA 2GT7A 1LPKA 4FUDA 3UOPA 5DP3A 2Y5HA 1LHFH 1UVOA 9ESTA 1O3CA 1YO8A 1UTNA 3POYA 1V2QT 2OBOA 2ZDNA 3PYHA 2WFXB 3V7TA 1LO6A 2YGOA 3M36A 3BEFB 2PGQB 3E6PH 1WU1A 2HNTC 4I8KA 1TYNA 4CBOA 1CT0E 4JYUL 1O3LA 4YT6H 1JMOH 1JOUB 1D3QB 5ESBA 3ZYIB 2QN5T 3MTYA 4Y0YE 1C5MD 2BD5A 2G5NA 1P3CA 1G1RA 3LTGD 3GCOA 1AHTH 1WHEA 2C4FH 2OLGA 1WBGB 1FLEE 4WXIA 3QDZB 1FF7A 1BTPA 1TOMH 3O8BA 2ZNKH 5K0HB 4R0IA 4YTAA 2Z9JA 1ZSJA 2ILNA 1KLIH 5EGMA 3RP2A 3SV7A 2P93A 4AGJA 3UY9A 1TONA 2ULLA 1C4V2 4CHAC 3ZYDA 2V3HH 2WFTA 1V2VT 4G1MB 3MQEA 2DE8A 3GY8A 4CBNA 1F5LA 4NGAH 1LHEH 2RA0A 2WYJA 5T3HA 4O97A 2Z3EA 1OOKB 2GMTB 1QIXB 4Y76A 1C5QA 1C5RA 2XW9A 1SG8B 2BY5X 4FU8A 4I8JA 1C5OH 3GY4A 1GL1A 1NRRH 1K1OA 1P9SA 4D8NA 1NFXA 3F68H 2PKSC 3HKJB 2WYJB 4K8YA 1O0DH 3EE0B 1UTPA 1W13U 1RFNA 2B9LA 2F9OA 4X8SH 2OD3B 4Y7BA 2BD4A 2DE9A 1P8VC 2GZ7A 1IVOC 1XMNB 4OGYA 4WMEA 1LPKB 3RC4A 3A86A 2VWMK 2BVRH 3EA7A 3SJIA 3GCNA 1YBWA 2GZ9A 2WV5A 1PQ5A 1X7AC 3UUZA 1HB0B 4DY7B 1BMNH 1MCTA 3G01A 4WMFA 2P3TB 1K21H 1D6WA 3E3TA 1LMWB 1P02A 1FAXA 2TGFA 2TIOA 3GISB 1MU6B 2DDUA 1TBRH 1DANH 2V35A 3GY2A 3H7OA 2QXIA 1P0SL 2UWOB 3MU8A 4FVBA 1UCYE 2FD6A 1GK5A 3M3SA 1DVAL 4GLYA 1GBFA 1HAFA 5E0GA 2P3FL 2GKVE 1RRKA 1TNIA 1HIAA 1MKWK 3E91A 3A89A 5E8DA 4UD9H 1O32A 5EPYA 3UNSA 8LPRA 2O8LA 1XKAL 2XBYA 4Z0KA 2UWPB 2A7JA 1XXDA 2G51A 5GDSH 1FJSL 2JH5D 2G00L 2J4IB 2J95B 1LQEA 3FZZA 1L2EA 1RJXB 2VWMA 1BOQA 3V65B 3ZZBA 3ITIA 1GHBF 1HXEH 3IJEB 1GMCF 3KQDA 3RXGA 1B0FA 6ESTA 1C5MF 2ZP0H 2BDHA 4IMZA 2FOHA 1AFQB 2EI8A 3GISX 4ISIL 2OINA 4RRYA 4Z6AL 1NFWA 2W3IA 1CX2A 1P2QA 3SOQA 1ZMJA 1UK4A 4E05H 1UVPA 1ZTJA 3A84A 1FIZA 1O2MA 4BAQB 5A0BA 1KLOA 4D0EA 1SFQB 1HAZB 1LPZB 2GMTC 1HFDA 4MPXA 3SUEA 2ZQ2A 2XBYL 2ZDKA 3MO9A 3T26A 3M37L 3V3MA 3SV2H 1IQKA 3GY3A 1YPHC 1ATBA 3UR9A 5A09A 1YUFA 1TFXA 2QF0A 4JYTA 3A80A 4NA7A 3ATWA 2I6QA 3QLPH 4GPGA 1H8DH 2PUXB 3RXEA 1GHVH 2WPMS 5C20A 1BA8B 3SGQE 1WOFA 4I31A 4O1ZA 1V2MT 2VB0A 1GJDB 1G2MA 1QQ4A 1J14A 3RU4E 1KLJH 3C27B 4NA9H 1F5KU 3TJOA 2BY7X 4MNYA 2OYUP 4U32A 1LQDB 1SGNE 3BTKE 2UWOA 1CGJE 3RXPA 4J2YB 3O8DA 4ABGA 2BTCE 4FUHA 3P8NA 3KQCL 2WYGA 2W26A 2J38B 1TRMA 4RRZA 2PR3B 4CUDA 2FS9A 1T7CA 2NU1E 3SJKA 1VZQH 3PLPA 2SGEE 2W2QE 1HT8A 2WPJS 4I8LA 4K1EA 3VXFH 5DP4A 3LC5A 1XUFA 4TWYA 2Z9KA 1EQHA 1NC6A 2VIPA 1KXAA 5FXLA 1MZDA 3K2UA 3RXSA 3S0NA 5FDQA 3RXUA 2UUKB 4K3JA 1Z8RA 3OSYA 1Q31A 3E0PB 3DA9B 3RR3A 1AVWA 2ZHQH 5F03A 4BTTB 5AFZH 2Y5HL 1CCVA 2J92A 1ZJKA 2ZDVH 3EQ0H 2P94L 3UIRA 1NN6A 1G1TA 4NIYA 2FIRH 3ESTA 3U98H 2FLBL 5F19A 4Y8XA 1AD8H 1MTNC 3PM3A 1HAHH 1XKBA 1WSSH 1N8OC 2OC1A 3GCXE 1GHAG 2XC4L 3KIDU 1HAOH 1GJ8B 2VVVL 1SGYE 2F9UA 2J94A 2VGCB 3M3TA 1MBMA 3B23B 1UTMA 5EG4A 4K8BA 2VIWA 1P01A 1C1QA 5CMXH 3V12A 3TIUA 1HT5A 5F8XA 2UUJB 1BBRE 1U6QA 1G2LA 5JW1A 2JETB 2BDYA 1O5EH 1F92A 2ZGHA 5JYIA 1KXFA 1KLTA 4KELA 4MNVA 1IQHA 1SLVB 1NFYB 1S82A 1LHGH 3OU0A 2J2UB 1G37A 2KAIB 2W5EA 1OWKA 1TMBH 5DG6A 1G30B 5IKQA 2WV4A 4YT7H 1O3DA 1QJ7B 1YPLH 1IQIA 5JB9S 2BB4A 4UFFH 3ZVBA 5DJ7A 3ZVCA 2NU4E 1EPTA 2BY8X 2H2ZA 3PTNA 2KB9A 3N8XA 3QUMP 4NFEA 1S6FA 5G4BA 3RXLA 3P95A 1C5NH 1F0TA 1A0JA 5EPNA 3KQBL 3BTEE 3U7UG 1JIRA 1SQAA 3SUDA 2BD2A 1MTVA 1DITH 4BANB 3L33A 3N7OA 1N6YA 5F8ZA 1G9IE 4FUFA 4OS4A 4X2VA 3RC5A 4I33A 3KHVA 1UTLM 3MNCA 1YM0A 3MH6A 3QH0A 1NRQH 1O3GA 4CRDA 1QBOA 1AUJA 3BTHE 3A7YA 1Z71A 1DWBH 1EAWA 1MTNB 4XLWA 3A7ZA 1O2HA 1ORFA 3ZZCA 2A4QA 1DLKB 3D23A 2P3FN 1HNEE 1SGDE 4A5TS 1GMCG 1YPJH 2P3UB 4WMDA 3F6UL 5EU8A 1YYY1 4AFQA 1WQVH 2XBXL 4ZH8B 1HRTH 2XC5L 2KV4A 3TH3H 1TMUH 2BX4A 1LPGB 1O3JA 3ZVFA 1IQGA 1F7ZA 5H4IB 3LAQA 1D3PB 5F6MA 1DVAH 4JMYA 3F1SB 1BITA 4XOJA 1IGZA 2OXSA 1LHDH 1V2TT 3RXKA 2P8OC 3MDLA 3F9EA 1NFUA 2BLQA 5F1AA 2XNIA 1YCPH 1J17T 3TPIZ 2F9VA 1HAPH 3LTFB 1PQ7A 3BV9B 1BHXF 1WCZA 1DSUA 4CRBA 2V0BA 1GJ7B 2CN0H 3MOCA 1EX3A 2FO9A 3D49H 5A0AE 3PMAB 2A7HA 4AQTA 5IDKA 3NT1A 1MZAA 2HPPH 2BD8A 1EJAA 1WTGH 1SBWA 1SGCA 2ZFTA 1J8AA 4GHQA 4U2WA 4VGCB 4MNWA 3BEUA 3ATIA 4LZ4B 2WPIS 1EAUA 2K2TA 4J1YA 2ZGBH 5K0HA 3FANA 4DW2U 4YOIA 3FBYA 4ZUHA 1OX1A 2YOLA 4A7IB 4BDXA 4INLA 2AEIH 3LKWA 3MH4A 1M9UA 1ELVA 3URCA 5A8XA 3BTWE 1O2KA 1SQTA 3EGFA 1ATAA 4BAMB 2Q6FA 1GBAA 2GZ8A 1V2PT 1TAWA 3RDZA 4I32A 2ZFRH 4B75A 1MH0A 4DURA 3Q3KB 3GCHB 1AO5A 1UTJA 2BOKA 3QZRA 2ALPA 4AB8A 5LPEA 3U73A 1TWXB 2QCYA 4BTTA 3M61U 1MOXC 4AB9A 1QBVH 1PTHA 4X6PA 1TGTA 2CF8H 4B71A 1Y8TA 2GCHG 2EEKA 2ZCKP 1FJSA 5JB9E 1VITF 1KYNA 1CT2E 2GP9B 1YGCL 4ABDA 2ZU5A 4KTSA 2Z3CA 5A8ZA 1C1VH 1D9IA 1TMTH 2Z94A 3OYPA 2IPHA 2ESTE 2GDEH 1HZ8A 1W0ZU 4IBLH 4MVNA 1OS8A 1F0SB 2P3TA 1V2UT 2AMPA 1QHRB 7KMEH 1QB9A 2GVFA 2PWXA 2A45B 2C90B 1N1LA 2K2SB 1P11E 3E16B 1LQDA 4AFZA 1J9CL 2H6MA 4AORA 3CS0A 1IOEL 4OGXA 3U1JB 1O5BB 1CT4E 2FDAA 1ZGIA 2IN2A 4GCHG 1EBVA 5EQSA 1GJCB 4FUCA 3SV6A 3A82A 1O5DH 1KTTB 1UCYK 3KGPA 4FUGA 2YNAA 5A2MH 1TGCA 2XC0L 2ZPSA 1O2NA 1IQFA 1DFPA 1QY6A 3AAVA 1PPHE 4YLQH 3HPTB 4YT6L 3PLBA 2FI4E 5A8YA 1YF4A 3NPSA 3A88A 1FZZA 1J9CH 4IN2A 5IKRA 1J16A 1HYLA 4CRCA 2MGRA 1IQLL 4ZAEA 1S0QA 8GCHG 1KSNA 2GCHF 1VCWA 3BG4C 4A6LA 1OSSA 1V2NT 2FOGA 3GCHC 1EMOA 1PFXL 2P3UA 5HM9A 3LIWB 2P3FH 1L5GB 4WF8A 1EPHA 1G3EA 3NCLA 1P2JA 1KXBA 3TJNA 1CVWH 4CRFA 3PGHA 5E0JA 1ZHMA 2VIVA 3BIUH 2ALVA 5TJXA 3BPSE 2Z7FE 4THNH 4MLFB 1C5LH 5GIBA 1SOTA 1XXFA 3OY5U 5JBTA 2KL7A 1ZPZA 5GWZA 2CGAA 4SGBE 1IQLA 2VH6A 5C2ZA 3DFJA 1PPEE 3IWMA 1T8OA 2PKAA 3RXBA 1TA2A 1THRH 1FUJA 2ZCHP 3SW2B 3RXVA 6CHAB 4ISOA 3QMOA 4JZEL 1O2UA 1PJPA 2J34A 2Y80A 1O5GH 2CHAB 1PYTC 2P16L 2ZFQH 4YT7L 4B2AA 3CS7L 4Y0ZE 3STJA 2AYLA 2Y5GL 1BTUA 1AU8A 1AWHB 1O2VA 2ZHWH 4X0WU 4LORA 4DG4A 2JH0D 1IOEA 2P28B 3F6UH 1TQ0B 1WUNH 1OWHA 1CHGA 2BQ6A 2H1UA 3I78A 3Q3YA 4AG1A 4AFSA 3GDUA 1DX5I 3HATH 4IN1A 4XBBA 3A7WA 3SNBA 1MD7A 2G4TA 4A1XA 1CO7E 3A81A 1GGDB 1E34B 4M10A 5L2ZH 5EW1H 3N8YB 1YPMH 3ATLA 5FCRA 1O30A 5JDUB 2ZHDA 4RRXA 2BD7A 5GCHG 3Q76A 3SJOA 1CBWB 5HYOA 2A0QB 1IQKL 1FY8E 3MNSA 4AYVB 3UQOA 4I7YH 3M5OA 1TBZH 3HGNA 1GI9B 3SNDA 3SU6A 1EP5A 2Y5FA 1V2RT 1NO9H 4X2WA 1S5SA 1P0SH 1PGEA 1O2WA 2O9QA 1NTPA 2B0FA 1UK3A 1S6HA 2ZF0H 3HPTA 2SGPE 1NZQH 1RIWB 5I25A 1GVKB 1K1LA 1AKSA 1KIGL 2O8MA 1QL7A 2J4IA 3TK6A 1QR3E 3Q7DA 2HRVA 4KTCA 3SU4A 1UVTH 1AMHA 3HS7A 4LXBH 2R0KA 3K6ZA 1XUHA 4CUEA 1DWCH 1HRFA 3M37A 4DVAU 1FAKL 5CKQA 2BOUA 1GCTC 2ANWA 1FY1A 2H9EL 2YGPA 1F7EA 3A83A 4ZH8A 4B1TA 4HGCA 1ELAA 4ZXYH 1QA0A 1C2JA 1LVMA 2EI7A 1GI0A 2F9BH 1LVOA 1TPOA 5C1YA 1YUKB 3KCGH 4WH8A 5CHAB 1EATA 3M7TA 1FPHH 3SOSA 3SI3H 2C8ZB 1AUTC 1C1MA 4NA9L 3SUFA 1GHBG 2F9NA 3AAUA 3HK3B 3U8TH 1PPFE 1LKAA 3GOVB 4A92A 2J38A 2PTCE 7GCHG 1ZSLA 3UNQA 3UR6A 1EB1H 1GHYH 4QT8C 5GCHF 4JYUH 1DSTA 1AVGH 2BOHB 1UCYH 1LTOA 4K5ZA 1MTUA 1ESBA 1D4PB 2Y7ZB 2WPHS 4YOJA 3DEMA 5CKNA 2GD4B 1INCA 3BG8A 1FY4A 2VWLA 4UFDH 1EGFA 1O3FA 1SGEE 1WV7H 4I8GA 4GHTA 1ZYOA 2H5DA 2JETC 2RDLA 5AVDA 1FMGA 4XSKU 2WPIE 1GJ4H 1ESAA 3K9XA 4BXWA 1SVPA 3ZZ4A 2PSXA 2A2XH 3RXTA 2OQ5A 4D76A 1B9WA 3BTTE 2ZDAH 2FOBA 1GG6B 2VIOA 2W3KA 1KY9A 3E90B 5I46H 1EAXA 2OUAA 4WJG2 2V3OH 3M5LA 4CRGA 1JRTA 4NGAL 4Y6DB 3LGIA 2XCFA 9LPRA 3KL6A 3T2NA 2Y6TA 1GDUA 3K65B 2M74A 2TBSA 3A7TA 1AI8H 1K1NA 2EC9H 3B8JA 1EMNA 3UQVA 3SUGA 1EZSC 1ANBA 1O5FH 2BD3A 3D62A 3GYMA 4IMQA 1C5XB 2BZ6L 1GG6C 4ZHMU 3MH5A 2P93L 3QX5H 1LVBA 1A0LA 1QL8A 2Z6BD 4NIVA 3T27A 3E0NB 1W12U 3LN0A 1BRCE 1GGDC 1KLJL 1P2IA 4Y71A 2AGGX 5DO4H 5JB8E 1BDAA 1HAXB 3SJ9A 1NT1A 4Z0KB 3UNRA 2VH0A 2UWLB 1C2MA 3PWCA 3SNCA 1OWIA 2O8TA 4E7RG 3ZV9A 5TCCA 1VITH 2J34B 1PPGE 1UMAH 3MU0A 2BOKL 1W2KH 1SGIB 1BQYA 1GMDG 1GBHA 1H9HE 2ZU1A 1NRNH 1VJAU 3MI4A 1IQJL 1ARBA 1LKBA 1IQEL 1YGCH 4X1NU 2WG3C 2Y7XB 3SGBE 5CHAC 1CGIE 1RGQA 4X2XA 1GCDA 2QYIA 3LC5B 1DT2A 2HALA 3V13A 4A1TA 1MUEB 4TY7A 1APQA 1V2ST 1EQ9A 2ZQ1A 1ZRBA 1YPHE 5L2YL 1JBUH 5GJ4B 1ACBE 2F83A 1L1NA 3ZV8A 5EXLA 2PUQL 1THPB 2PHBA 1IGXA 1TRYA 1C5VA 3TK9A 1V2OT 1FQ3A 1GI7B 5DKMA 6CHAC 1PPBH 1K1JA 3M3VA 1RD3B 2A2QH 1TLEA 3MO3A 3S9BA 4GSOA 1G3DA 1O3BA 3ZVAA 3ZZ6A 2W3KB 4MPUA 2Y82A 1P04A 3ZZ9A 3SOBB 2C8WB 3M5NA 3ZYGA 3PWBA 1FE2A 4CH8B 3RXCA 1GDQA 1OYTH 2P94A 1O2QA 2RA3A 2ANMH 3NKKA 4MPVA 3TK6B 1O2RA 1ZOMA 5LPFA 3RC6A 2CXVA 3BEIB 1TOZA 4X8SL 3ZZAA 3L3TA 1IQMA 2QV1A 2WPKS 5LGOA 5IKVA 3TZIA 4ZKOU 2FTMA 5C3NA 3BG4B 4FU9A 2PHBB 1VGCB 4LMFA 4Q7YA 1GHXH 3VB6A 4UONA 4CR5A 1K22H 1PQ8A 1L4ZA 3TVJB 2W3IB 1O3NA 8GCHF 2A4GA 2FODA 2VWNA 1J15A 1P06A 4U01A 1QL9A 1MQ6L 2ZA5A 5E2OA 4DCDA 4O3UA 3MO6A 1HJ9A 1QBNA 1KDQA 1EZUC 1YP9A 1HAEA 1CHOF 1UHBA 4Y6DA 4H4FA 1C1PA 1NPMA 1P9UA 4ISNA 1AZ8A 2PSYA 4X1QU 2ZCLP 3F9GA 2W2ME 2ODYB 1GI4A 2SNWA 4JK6A 3TH3L 1WU1B 4GCHF 1DXWA 1LVYA 1V2KT 3P8OA 3PO1B 4YM9A 5COXA 1ZMNA 1DXPA 3EAJA 4NIWA 2ZKSA 1RTLA 2JH6D 1ZRKA 4ZKNU 4KGAA 3ELAL 1HX2A 3I29A 3RLYH 6GCHF 1TBQH 1BJUA 3LJJA 3TJVA 2XXLA 4LK4A 5L30L 1O2OA 1MU8B 3ODFA 5C5OA 1GBIA 4Z6AH 1O31A 1XVOA 2VVUA 1O3AA 1KDQB 4WY3A 3P70B 2IOTA 3HGPA 1SOZA 1OWJA 3RXIA 2FS8A 1ATEA 4LZ1H 4CSYA 3ELAH 1PXXA 1A61H 2ZFFH 4X6OA 1C5WB 4X6NA 1Z6CA 4XL1A 2TGAA 2W26B 1N6XA 3RMNH 1IQHL 1CQEA 1G1SA 3M5MA 3P5BL 2PLXA 2B7DL 2WPKE 1FSBA 3UWIA 1I0UA 1DUEA 2TRMA 2G4UA 2VJ1A 1NFUB 1P9JA 3TH4H 2D1JB 4CHAB 2BQ6B 4LOYH 2K1QA 4FUIA 5K7RA 1O34A 1LHCH 1O3HA 1QJ6B 3SNEA 1Q4GA 3VB7A 4DIIH 2C8YB 3BTFE 1S84A 1HDTH 4TY6A 1O3PB 2Y5FL 4MMYB 3K9XB 1GBDA 1DUAA 2XCNA 4KKDA 1LPGA 1DM4B 1V3XB 2ZECA 2BZ6H 3P8FA 5HXFA 4RN6A 1G3BA 1B0EA 4ISLA 1ZGVA 4ZXYL 1FPCH 4YOGA 1X7AL 2AIQA 4BTUA 1F2SE 1IOXA 4ESTE 4UE7H 3S69A 5JBCE 1ZR0A 3JZ1B 3MU5A 1Z8JB 2I9AA 2VJ3A 5ABWA 3HS5A 5JBBS 6GCHG 3LH3A 1GI6A 2R2WU 3N8VA 2P8OB 3CP7A 2FLRH 3U1IB 1TRNA 1HCGB 4MMXB 1QFKH 4X8VL 3EGKH 5E2PA 2F91A 3BTGE 1TNGA 2EI7B 1XKAC 5DP9A 2FZZL 3VEQB 5JBCS 1K28D 1DS2E 1NQLB 3NTGA 1CHOG 1O37A 1A7SA 5BRRE 4ABHA 2FI3E 4X6MA 1IP0A 1CVWL 1PYTD 1XVMA 1Z1IA 1P2NA 5JB8S 1F0UA 3NWUA 2A1DB 2NU0E 1P2OA 4ZROA 1MQ5L 1BMLA 3QCWA 3BF6H 3IG6B 5JBBE 1SPJA 4Y10E 2RNLA 1ZSKA 1EPTB 3NTBA 4TGFA 1IHSH 1BRBE 2YNBA 2GTBA 1L1GA 1W7XH 2Q6DA 1TPPA 2D2DA 4VGCC 3KN2A 4NZLA 3U69H 2RA0L 1A0HB 2VH6B 1Y5BT 2ZO3H 1FDPA 2HOBA 2BY9X 1QJ1B 3FP6E 4U30A 1GBCA 2RG3A 1F0RA 1W8BH 3TGKE 1ELBA 5EXMA 2GV7A 1NRSH 4WWYA 1AZZA 1E35B 3RU4T 2Z3DA 1EZQA 1Y3UA 1S83A 2ANKH 1FXYA 3QWCH 2H9TH 2BOXA 4ZXXL 3DD2H 5J4SA 1D6RA 2BLOA 2BQWA 2BDIA 1GI2A 5JBAE 4HTCH 2NPRA 1QA7A 4JYVL 2CMYA 3SU3A 1DY9A 4H42U 1DICA 3FCSB 3VB4A 2G52A 1A2CH 2J94B 4ZHAA 3CENA 3CA7A 2FTLE 4AOQA 1Z8GA 4RS0A 1GMHF 1T4VH 2BLWA 2PFEA 3TNTA 2W7SA 1C1WH 2CF9H 1HPGA 3FP7E 1DIYA 2GCTC 4DJZB 4ZHLU 2FOMB 1EJMA 3KCGL 2D26C 4GUXA 2ODQA 4INHA 1ETSH 3W95A 3KNXA 2BDBA 3T5FH 1A4WH 1A1RA 3MWIU 4ABJA 5ETXA 5DGJA 4K60A 3A8DA 2STAE 2OP9A 4NSYA 4ABBA 3SU0A 4HI3A 5JPMH 4OS2A 1PPZA 1YCPM 1O3KA 1V2LT 1Y5AT 3FP8E 3T29A 1RTFB 1N8OB 1YPEH 1BTZA 2B7DH 4O03A 2BDCA 1O2YA 1O38A 2GCTB 2ZTYA 1K1MA 2BOHA 3UWJH 2FI5E 4YZUA 1P05A 1RTKA 1O35A 4RKJB 2CJIA 1Z1JA 1XM1A 4I8HA 3VPKA 2PR3A 3MU1A 4IC5A 1SGRE 1CGHA 3ZVGA 4CRAA 1DOJA 3KK6A 5GXPA 3UOUA 1EKBB 1Z6JH 4FUEA 3KQDL 3P6ZB 1L0ZA 3TK5A 1ANCA 1QB6A 1EZXC 4UFGH 2FEQH 2FOEA 1C1NA 1NFXB 2FP7B 2QA9E 1C4U2 1ATDA 1FFMA 1O2LA 3KQCA 3Q00A 5BPEA 3SN8A 7ESTE 3C9AC 1DDJA 3GICB 1GBMA 3QTVH 3E1XB 4JZ1A 1HAIH 2W2PE 4DOQA 2VWOL 3PMHB 1A5HA 1TABE 5HGGA 5CISA 5L6NH 2BMGA 4BTIB 1EAIC 1ZTLA 1A5IA 5IKTA 1RS0A 3RM2H 1MBQA 3LU9B 1Z6EA 2HLCA 2XYAA 4NG9H 2BO2A 1S0RA 2PUQH 3DT0H 2FYRA 1ZMLA 1DWDH 4INKA 1NFYA 8KME2 5EW2H 2WINI 1ARCA 5C1XA 3GY6A 1U67A 1O2XA 1XUJA 1GJAB 2GT8A 2GX4A 2Z9GA 4Y11E 2Y7XA 1BIOA 1THSH 2G55A 2A4OA 1P2MA 1BHXB 2VVCK 3KF2A 2WUBA 2ZTXA 1NFWB 4JCNA 1ZPBA 2ZFSA 1F0RB 1FONA 4Y7AB 2ZU3A 2TGPZ 3TGIE 1SZBA 2CV3A 5GPIB 4BAHB 3QTOH 4A1VA 2GDDA 4D9QA 3STIA 1Y5UT 5LPRA 1O2JA 3ENSB 5AHGH 4Y7BB 2HGTH 2H5CA 3IITA 1NY22 1C1TA 1IHTH 1CA8B 2Q1JB 3RM0H 1HGTH 1DPOA 2WG4B 1H9LB 1MTSA 1AFQC 2UWPA 1E0FD 2FMJA 1EPJA 3SI4H 3Q3KA 1G32B 1FAKH 1TX6A 1HAYB 2ZDMA 3SOVA 3AVZA 1VITG 4JZFH 3IITB 1IQNA 1BF9A 2BX3A 4MG3A 1VCPA
chains in the Genus database with same CATH superfamily
1OP8A 1VJ9U 5FL7D 3SV8A 1TA6A 2D8WA 3SW2A 3U28C 2XBWA 1GL0E 3AW1A 3M7UA 1TNJA 2RHPA 1WAYB 3SORA 3AW0A 2XRCA 3GDVA 3F2FA 3ATKA 4NZQA 1O5AB 1V2WT 2HVXA 1IQEA 2XWBI 1SC8U 1HJAB 1WTHD 5T6FA 3OTJE 2AIPA 1W3CA 3NZIA 1W14U 3VFEA 3OY6U 2SGFE 2XBVA 3ATMA 3OE7D 4GU4A 2Y38A 4HZHA 3VXEH 4ZAEB 1DDXA 4Q7XA 4TWWA 3RU4D 1O3EA 1XFEA 1UZKA 1RFNB 3D65E 1SLXB 4KTUA 4D90A 1QTFA 3U9AH 1ZLRA 1WQSA 4JZDL 1V3XA 1QRZA 4RSPA 3KQEL 1O3MA 5EQRA 4PH9A 1ETRH 2VVVA 2VU8E 1XX9A 1K0HA 2Y81B 3FZDA 1AKSB 2Z9LA 3LDXH 1K1PA 4SGAE 4E06H 1EQGA 2TGDA 1WYKA 4X2YA 4C16A 4B2CA 1Y59T 5L30H 1UZJA 2Y82B 3RXMA 4X8UL 2ZFPH 1GJ5H 1Z7KA 1OYQA 3U8OH 1GJBB 1JRSA 4Z0LA 1DX5M 1V6DA 2H9EC 4AG2A 3PO1C 1C5YB 1SGPE 1TOCB 2P95L 5FBIA 2IJOB 2PKSB 4RT1A 2QXJA 3ZZ3A 3RXQA 5EJ1A 2QF3A 1DWEH 2Z9IA 1DY8A 4MNXA 3BT2A 2WYGB 1E38B 1IQNL 1ELDE 7LPRA 1BMAA 1EOLA 4XFQA 3TBDA 1CQQA 3OEED 3NK8A 1EP6A 5C1UA 3KRKA 3QK1A 1EXFA 1JBUL 1SFIA 2AYWA 2UWLA 3LGVA 5C67A 2A5IA 2R3UA 1L4DA 4F4OC 1NM6A 4MQAA 3S9AA 1PQAA 1ABJH 3A85A 3QGJA 4O02B 2HNTE 1O2ZA 2ADXA 1T31A 1GI5A 1ID5H 1AQ7A 2F9PA 1QNJA 3LGYA 1NROH 1GBBA 4X8TL 4X1SU 1GBJA 3ZVDA 1P2KA 1HJAC 1T32A 2NU2E 2O8WA 1IQGL 1AGJA 3ODDA 4Q2KA 5DP8A 1BRUP 1C2KA 1OWDA 2HNTF 3TGFA 4RRWA 3AASA 3GDSA 5FPTA 3NJPC 1GBEA 1H8ED 4Y7AA 1GBLA 4OS1A 4CH2B 2PGBB 5DP7A 4P02A 1MMJN 5FX5A 5E0HA 4K69A 1EZQB 1IAUA 3SU2A 3EA8A 2ZPQA 3SNAA 4Z1MD 1TX8A 4NCYA 4ZXXH 3LIWA 1T4UH 4COXA 1C2EA 2ZC9H 1EASA 2FX4A 5C5NA 3MFJA 5PTPA 4Q80A 1K9OE 3I77A 1ZHPA 2P59A 1KTSB 3N8WA 1TLDA 1AUTL 1GI8B 2QGRA 3RXAA 4D7GA 2SFAA 4FVDA 3RLWH 3ZZ8A 2VWNL 2ZU2A 4AX9H 3BIVH 1EAIA 1O2PA 1A5GH 1ZAQA 3A8CA 2ASUB 1AWFH 2M5TA 2OC7A 1FN8A 1QURH 2M2AA 1GBKA 1GVZA 2QY0B 4ZCNA 4Y8YA 3A8BA 1HAGE 1ABIH 1KXEA 3LJOA 2PKAB 4NA8A 3GY5A 1JXPA 3UREA 3MH7A 5SGAE 1PFXC 1BRAA 1SGFG 3RXDA 2BVSH 5KEDA 2F4LA 1SB1H 2UUFB 3VB3A 1CVUA 1Y3XA 3FAOA 3A7VA 1C2IA 1HJ7A 2OC0A 3EYDA 1UK2A 2RCEA 1OB1C 4HFPB 1SHYA 1A46H 3N8YA 4FM5A 2ANYA 1OPHB 1O3OA 3ZIAD 1H9IE 2BQ7B 1TGBA 2AMQA 4FUBA 1TNKA 1FN6A 4XBCA 4D9RA 1C1OA 1ADXA 5FPSA 1BCUH 1C2DA 3SU1A 3C1KA 1DQBA 1P09A 1W10U 2LPRA 3LGUA 1E37B 3T28A 3MNBA 1MCVA 3SZNA 2FOAA 1MQ5A 2FLGA 2P16A 1G2MB 1A3PA 2A7CA 3SBKA 4BDWA 1FIWA 3WY8A 1FI8A 1C1UH 4F55A 3HO4A 3ENSA 2FOCA 3O8CA 2FLBH 2Q1JA 2ZGXH 3PLKA 2LNCA 3LT3A 4B76A 5FX6A 2BQWB 3URDA 4B73A 3TLOA 1TGSZ 1N7DA 1BBRK 1KLIL 5F8TA 5JVYA 2J2UA 2KAIA 3TU7H 4DIHH 2STBE 1LCYA 4YLUA 1F0SA 3PMJA 1G2LB 1Z8IB 1NRPH 3LN1A 2AGIX 3Q77A 2OTVA 3OLTA 1ZHRA 2R3YA 1AE8H 2BXTH 5T6DA 3T62A 3A8AA 2WZQA 8ESTE 1IQFL 2O8UA 1GMDF 4GVUA 1F5RA 3F2HA 3KL6B 5DK1A 1BTHH 2BZAA 2QAAA 2A4RA 2W6ID 4TPIZ 1W7GH 3BTDE 1HAVB 2ZTZA 1UTQA 3H7TA 1SQOA 4BTIA 5FHTA 1O2SA 1TIOA 2FX6A 2ZZUH 3VG8A 4MPWA 1C5TA 4IW4E 2FZZA 1JWTA 3PB1E 2J95A 1C5PA 1CE5A 2R2MB 5DSFA 1XDTR 1TPAE 2P95A 2XTTB 2PW8H 2FOFA 5AFYH 5T6GA 2OYEP 2XBVL 1CEJA 1GCTB 2VNTA 1V2JT 2XWAA 2ZIQH 3LGWA 1HIAB 1ELGA 2KR7A 2W7UA 2ZU4A 4RT0A 1MKWH 2VVCA 4ISHL 1TQ7B 3QO6A 1YLCA 1GJ9B 2BT8A 3M36L 3UPEA 3NXPA 2JIZD 2K8IA 2ZEBA 2QXHA 1TE0A 1RXPA 1OP0A 5LH8A 1MKXH 1JV2B 1BBRH 3SV9A 3SU5A 1EPTC 1RIWC 4X8UH 5E8EH 5A0CA 3VGCB 3R0FA 3RXHA 1QCPA 2FYQA 2NWNA 3MU4A 1ZPCA 5L2ZL 3P8GA 1UZQA 3TNSA 4D7FA 2MGPA 2BDGA 2QXGA 2OC8A 1KSNB 2CK3D 3A87A 2VVUL 5TCAA 1HREA 1GI3A 2R0LA 1N1IA 4BTUB 1Q3XA 3LPRA 2VINA 1CBWC 3SJ8A 3MYWA 1SHHB 3ZZ5A 1D3DB 4UDWH 1HUTH 4RKOB 3RUOA 1EPIA 5B6OA 3V0XA 5IYTA 1TNLA 4ZKRU 2OCVB 2ZPRA 1FY5A 2BVXH 4RUTA 1NU7B 3NUMA 1YPGH 1A3EH 4ZKSU 1BB0B 1FY3A 2A32A 1GHAF 1KIGH 1BT7A 1O5CB 2ZGCA 2P26A 3GYLB 3K6YA 2BYAX 3U8RH 4KP0A 4F49A 4DGJA 1QRWA 2XBWL 2VWLL 3GCTG 3DSGA 1WHFA 2D1JA 3H09A 4BOHA 2V6NA 1TPSA 1FNIA 4ZHAB 1A3BH 3R05A 1SLWB 5FBEA 1Z6EL 4AGKA 1DLEA 3F9HA 1BJVA 1ELTA 1ESTA 1K37A 3QGNB 3CFWA 2ZWLH 1K36A 1MKXK 4JZDH 2A31A 2XBXA 1P03A 3PROA 1ZTKA 1GDNA 4CR9A 6COXA 2QC2A 2YMSD 1GHWH 1LDTT 3RXOA 1O3IA 2AMDA 1T8NA 1E36B 3BN9A 1IQML 2BMGB 2RDEA 1EUFA 2CHAC 3GCTF 1YKTA 4ABEA 1O33A 2PV9B 2FWWA 3UAIC 1V1IA 2OQUA 1AFEH 2VH0B 1W0YH 1AB9C 1SGQE 2C93B 1MQ6A 3RMOH 2BT7A 5L2YH 1AN1E 4UEHH 4UFEH 4X8TH 2WHXA 4XE4A 1FV9A 3RXJA 1UTOA 2F9BL 4OTYA 2THFB 1P10A 1U8CB 3KQBA 1B5GH 3UTUH 1HV7A 1AB9B 1EB2A 2ZGJA 2ZI2H 1GBTA 1YLDA 6LPRA 1APOA 1XUIA 2G00A 2WPLE 4M11A 3SO3A 1CA0C 1AVXA 1UJ1A 4B2BA 1K1IA 2Y7ZA 4Q63A 1NU9A 3LONA 1YWUA 2J98A 2VBCA 4OS6A 3EDXB 4YZUB 1HCGA 3FFGA 4FUJA 4R8TB 1ELCA 1C1SA 1ETTH 2AERH 2FM2A 4H6SB 1C5ZB 2XC0A 4Y79A 3ZYJB 1W7XL 2J9NA 3SHCH 4AFUA 2HWLB 2XC5A 2WUCA 1TPGA 1O36A 3ZYEA 1Y3YA 3SGAE 5JBAS 1BTWA 1O2IA 3V64C 3F0PA 3LC3B 3GY7A 3R3GB 4FU7A 1QFKL 3SQEE 2I9BA 1G36A 2Y81A 4OS5A 2KFWA 2Y5GA 3OTPA 1P57B 2MHPA 1XKBC 1XUGA 3CENL 3PMBB 4YO9A 4E7NA 2XC4A 5I46L 2Y80B 4AZ2B 2FXRA 4O3TA 1MABB 2JKHA 3OX7U 3TK5B 3RMMH 1SGFA 4BXSA 4MTBA 2SGDE 4MMZB 3N8ZA 3LGTA 5EIYA 3OLUA 1BMMH 1SLUB 1G3CA 2SGAA 3HO5A 1IQJA 4BAKB 1HAVA 1TNHA 1VGCC 1ANDA 2BDAA 2BHGA 5KN5C 1CSOE 3PTBA 3PV5A 3S7HB 1H8IH 4WXVA 1M1XB 2B5TB 3KQEA 2BXUH 3O8RA 5EGMB 3M7QA 1CA0B 1XUKA 1C4Y2 3MNXA 4NWKA 5EODA 1ZJDA 2VRSA 3OEHD 5J4QA 2TGTA 2ZHFH 2TPIZ 1O39A 1AY6H 1GHZA 1UO6A 4K1SA 3AK5A 1OP2A 5AF9H 3GCWE 2GGVB 4XDEA 2EI8B 3EA9A 4AYYB 3TJUA 4ISHH 5HMAA 4TPYA 1QB1A 3DFLA 1BTYA 4Q7ZA 3SHAH 5FAHA 2QIQA 4ABFA 1HBTH 5EOKA 1QIUA 1URKA 1TB6H 4YXWD 4WVPE 3FFGL 1CCFA 2ZHEH 2EA3A 1MAYA 2G8TA 1HXFH 2UUYA 2BLVA 4JK5A 1E79D 4YESB 1ELEE 4X1PU 1KXCA 1YC0A 3VGCC 3JZ2B 3LC3A 1MAXA 1GI1A 1E1QD 1TX7A 3ZZ7A 1UHBB 1B7XB 4IC6A 1QQUA 3HS6A 1S85A 1PRHA 3N8WB 2HPQH 4XBMA 4A7IA 4Y8ZA 1H1BA 4H6TA 2G81E 4AN7A 1V1HA 3HKIB 2EI6A 3L6PA 4ZMAH 1C2GA 4E1GA 1W8BL 1OWEA 4WH6A 4PROA 2WPJE 1C2LA 5DN6D 1SMFE 1VR1H 1P12E 5HM2A 4TYDA 1C5UA 5DP6A 1NS3A 4I86A 2H9EH 2DUCA 2SNVA 3VB5A 2AS9A 2VWOA 2PTNA 3BTME 1DE7H 4ASHA 5FCKA 1TGNA 1F7MA 1UVSH 1C9PA 3ASIA 1UZPA 2WPME 2AH4X 1D3TB 1L1JA 3QN7A 4CUFA 2OBQA 1SKYE 2JKHL 1EPGA 2EI6B 1QGFA 2HVYB 4BNRA 1T8MA 2VIQA 2AGEX 2WPLS 1PPCE 4NIXA 3OAAD 1QRXA 1JL9A 1O2GH 5HIYA 1YPKH 3S7KB 2WPHE 4IGDA 4OS7A 1Y3WA 2FLRL 2C8XB 1KXDA 2G5VA 1JIMA 1UTKA 1ELFA 1AIXH 4DT7B 2H9HA 4X8VH 5DP5A 1IJQA 1C5SA 1Q2WA 2ODPA 4BAOB 4CREA 1EOJA 3F9FA 1NESE 1SSXA 2ZDLA 1L3YA 3MQKC 2BD9A 2GD4A 4GAWA 2Q6GA 2I6SA 1YUGA 3UFAA 3P92A 4K1TA 1UVUH 3RXFA 1W11U 4ABIA 2LELA 3MMGA 1P3EA 4NFFA 2WPDD 3DSPA 4IS5A 2BQ7A 5JVZA 3S9CA 1BUIA 1AE5A 2CJIB 3H5CB 3SQHE 1G1QA 2BM2A 3BSQA 3CNRA 3B9FH 3HK6B 2K0QA 3Q3XA 3TH2H 3ZZDA 3M35A 2W86A 5EXNA 1LMJA 1BZXE 2FESH 1H4WA 3S6XA 3RMLH 4M7GA 4JZFL 1ZZZA 1W0KD 4X1RU 5DPAA 1FAXL 1MD8A 5T1VA 3BTQE 1NPEB 1SI5H 4JZIA 1C1RA 1GMHG 2SGQE 1Y3VA 2JJ1D 2W2OE 1EJNA 1S81A 1O2TA 1COUA 2GV6A 3P17H 4ISIH 1OXGA 5CE1A 1T8LA 2NU3E 3T25A 5KIRA 5FPYA 1C2FA 4MDSA 1GVLA 2B8OH 5EJLA 1TALA 7GCHF 1IQIL 5EQQA 1GWAA 1ANEA 3CS7A 4NWLA 1OKXA 2IPQX 4XBDA 1CU1A 1SL3A 4ABAA 2AFQB 3RXRA 3ZVEA 1MTWA 5CKMA 5KGOA 2VGCC 1C2HA 3DHKH 1HJ8A 3MHWU 2W2NE 4Y76B 1O5DL 3FVFB 1HLTH 4B74A 4K2YA 4Y71B 4D0FA 1VCQA 1YCPK 3KEEA 2BY6X 4O9VA 3BT1A 4JZEH 4Y79B 1LPZA 4JYVH 4FOUC 4NG9L 3HO3A 1SR5C 4OTJA 3LOXA 2A5KA 1SGTA 4FXGH 2C3SA 3TGJE 3PV4A 2VIDA 1GPZA 1K2I1 3QZQA 3LH1A 2FPZA 3A7XA 2F3CE 4NSVA 1NT0A 1NZIA 3W94A 1BTXA 3E8LA 5ESTE 2R9PA 1GJ6A 2ZG0H 2A5AA 1C9TA 3DUXH 3TITA 2GT7A 1LPKA 4FUDA 3UOPA 5DP3A 2Y5HA 1LHFH 1UVOA 2EQNA 2WZPP 9ESTA 1O3CA 1YO8A 1UTNA 3POYA 1V2QT 2OBOA 2ZDNA 3PYHA 2WFXB 3V7TA 1LO6A 2YGOA 3M36A 3BEFB 4HG6A 2PGQB 3E6PH 1WU1A 2HNTC 4I8KA 1TYNA 4CBOA 1CT0E 4JYUL 1O3LA 4YT6H 1JMOH 1JOUB 2XOKD 1D3QB 5ESBA 3ZYIB 2QN5T 3MTYA 4Y0YE 1C5MD 3EE7A 2BD5A 2G5NA 1P3CA 1G1RA 3LTGD 3GCOA 1AHTH 1WHEA 2C4FH 2OLGA 1WBGB 1FLEE 4WXIA 3QDZB 1FF7A 1BTPA 1TOMH 3O8BA 2ZNKH 5K0HB 4R0IA 4YTAA 2Z9JA 2EY4C 1ZSJA 2ILNA 1KLIH 5EGMA 3RP2A 4A94C 3SV7A 2P93A 4AGJA 3UY9A 1TONA 2ULLA 1C4V2 4CHAC 3ZYDA 2V3HH 2WFTA 1V2VT 4G1MB 2XNDD 3MQEA 2DE8A 3GY8A 4CBNA 1F5LA 4NGAH 1LHEH 2RA0A 2WYJA 5T3HA 4O97A 2Z3EA 1OOKB 2GMTB 1QIXB 4Y76A 1C5QA 1C5RA 2XW9A 1SG8B 2BY5X 3FKSD 4FU8A 4I8JA 1C5OH 3GY4A 3WWFA 1GL1A 2KZ4A 1NRRH 1K1OA 1P9SA 4D8NA 5CHBA 1NFXA 3F68H 2PKSC 3HKJB 2WYJB 4K8YA 1O0DH 3EE0B 1UTPA 1W13U 1RFNA 2B9LA 2F9OA 4X8SH 2OD3B 4Y7BA 2BD4A 3KYGA 2DE9A 1P8VC 2GZ7A 1IVOC 1XMNB 4OGYA 4WMEA 1LPKB 3RC4A 3A86A 5KECA 2VWMK 2BVRH 3EA7A 3SJIA 3GCNA 1YBWA 2GZ9A 2WV5A 1PQ5A 1X7AC 3UUZA 1HB0B 4DY7B 1BMNH 1MCTA 3G01A 4WMFA 2P3TB 1K21H 1D6WA 3E3TA 1LMWB 1P02A 1FAXA 2TGFA 2TIOA 3GISB 1MU6B 2DDUA 1TBRH 1DANH 2V35A 3GY2A 3H7OA 1YLNA 2QXIA 1P0SL 2UWOB 3MU8A 4FVBA 1UCYE 2FD6A 1GK5A 3M3SA 1DVAL 4GLYA 1GBFA 1HAFA 5E0GA 2P3FL 2GKVE 1RRKA 1TNIA 1HIAA 1MKWK 3E91A 3A89A 5E8DA 4UD9H 1O32A 5EPYA 3UNSA 8LPRA 2O8LA 1XKAL 2XBYA 4Z0KA 2JJ2D 2UWPB 2A7JA 1XXDA 2G51A 5GDSH 1FJSL 2JH5D 2G00L 2J4IB 2J95B 1LQEA 3FO8D 3FZZA 1L2EA 1RJXB 2VWMA 1BOQA 3V65B 3ZZBA 3ITIA 1GHBF 1HXEH 3IJEB 1GMCF 3KQDA 3RXGA 1B0FA 6ESTA 1C5MF 2ZP0H 2BDHA 4IMZA 2FOHA 1AFQB 2EI8A 3GISX 4ISIL 2OINA 4RRYA 4Z6AL 1NFWA 2W3IA 1CX2A 1P2QA 3SOQA 1ZMJA 1UK4A 4E05H 2L6OA 1UVPA 1ZTJA 3A84A 1FIZA 1O2MA 4BAQB 5A0BA 1KLOA 4D0EA 1SFQB 1HAZB 1LPZB 2GMTC 1HFDA 4MPXA 3SUEA 2ZQ2A 2XBYL 2ZDKA 3MO9A 3T26A 3M37L 3V3MA 3SV2H 1IQKA 3GY3A 1YPHC 1ATBA 2J97A 3UR9A 5A09A 5IK2D 1YUFA 1TFXA 2QF0A 4JYTA 3A80A 3PRDA 4NA7A 3ATWA 2I6QA 3QLPH 4GPGA 1H8DH 2PUXB 3RXEA 1GHVH 2WPMS 5C20A 1BA8B 3SGQE 1WOFA 4I31A 4O1ZA 1V2MT 2VB0A 2YMSB 1GJDB 1G2MA 1QQ4A 1J14A 3RU4E 1KLJH 3C27B 4NA9H 5HKKD 1F5KU 3TJOA 2BY7X 4MNYA 2OYUP 4U32A 1LQDB 1SGNE 3BTKE 2UWOA 1CGJE 3RXPA 4J2YB 3O8DA 4ABGA 2BTCE 4FUHA 3P8NA 3KQCL 2WYGA 2W26A 2J38B 1TRMA 4RRZA 2PR3B 4CUDA 2FS9A 1T7CA 2NU1E 3SJKA 1VZQH 3PLPA 2SGEE 2W2QE 1HT8A 2WPJS 4I8LA 4K1EA 3VXFH 3WWBA 3DSOA 5DP4A 3LC5A 1XUFA 4TWYA 2Z9KA 1EQHA 1NC6A 2VIPA 1KXAA 5FXLA 1MZDA 3K2UA 3RXSA 3S0NA 5FDQA 3RXUA 2UUKB 4K3JA 1Z8RA 3OSYA 1Q31A 3E0PB 3DA9B 3RR3A 1AVWA 2ZHQH 5F03A 4BTTB 5AFZH 2Y5HL 1CCVA 2J92A 1ZJKA 2KCYA 2ZDVH 3EQ0H 2P94L 3UIRA 1NN6A 1G1TA 4NIYA 2FIRH 3ESTA 3U98H 2FLBL 5F19A 4Y8XA 1AD8H 1MTNC 3PM3A 1HAHH 1XKBA 1WSSH 1N8OC 2OC1A 3GCXE 1GHAG 2V3MA 2XC4L 3KIDU 1HAOH 1GJ8B 2VVVL 1SGYE 2F9UA 2J94A 2VGCB 3M3TA 1MBMA 3B23B 1UTMA 5EG4A 4K8BA 2VIWA 2OK5A 1P01A 1C1QA 5CMXH 3V12A 3TIUA 1HT5A 5F8XA 2UUJB 1BBRE 1U6QA 1G2LA 5JW1A 2JETB 2BDYA 3N99A 1O5EH 2J98B 1F92A 2ZGHA 5JYIA 1KXFA 1KLTA 4KELA 4MNVA 1IQHA 1SLVB 3FN8A 1NFYB 1S82A 1LHGH 3OU0A 2J2UB 1G37A 2KAIB 2W5EA 1OWKA 1TMBH 5DG6A 1G30B 5IKQA 1W0JD 2WV4A 4YT7H 1O3DA 1QJ7B 1YPLH 1IQIA 5JB9S 2BB4A 1SQRA 4UFFH 3ZVBA 5DJ7A 3ZVCA 2NU4E 1EPTA 2BY8X 2H2ZA 3PTNA 2KB9A 2LP6A 3N8XA 3QUMP 4NFEA 1S6FA 5G4BA 3RXLA 3P95A 1C5NH 1F0TA 1A0JA 5EPNA 3KQBL 1E1RD 3BTEE 4XRNA 3U7UG 1JIRA 1SQAA 3SUDA 4TSFD 2BD2A 1MTVA 1DITH 4BANB 3L33A 3N7OA 1N6YA 5F8ZA 1G9IE 4FUFA 4OS4A 4X2VA 3RC5A 4I33A 3KHVA 1UTLM 1KMHB 3MNCA 1LK9A 1YM0A 3MH6A 3QH0A 1NRQH 1O3GA 4CRDA 1QBOA 1AUJA 3BTHE 3A7YA 1Z71A 1DWBH 1EAWA 1MTNB 4XLWA 3A7ZA 1O2HA 1ORFA 1KKEA 3ZZCA 2A4QA 1DLKB 3D23A 2P3FN 1HNEE 1SGDE 4A5TS 1GMCG 1YPJH 2P3UB 4WMDA 3F6UL 3N7DA 1YYY1 5EU8A 4AFQA 1WQVH 2XBXL 4ZH8B 5C0UA 1HRTH 2XC5L 2PP6A 2KV4A 3TH3H 1TMUH 2BX4A 1LPGB 1O3JA 3ZVFA 1IQGA 1F7ZA 5H4IB 4F48B 3LAQA 1D3PB 5F6MA 1DVAH 4JMYA 3F1SB 1BITA 4XOJA 1IGZA 2OXSA 1LHDH 1NBMD 1V2TT 3RXKA 2P8OC 3MDLA 3F9EA 1NFUA 2BLQA 5F1AA 2XNIA 1EFRD 1YCPH 3KYFA 1J17T 3TPIZ 2F9VA 1HAPH 3LTFB 1PQ7A 3BV9B 1BHXF 1WCZA 1DSUA 4CRBA 2V0BA 1GJ7B 2CN0H 3MOCA 1EX3A 2FO9A 3D49H 5A0AE 3PMAB 2A7HA 4AQTA 2HLDD 3NT1A 5IDKA 1MZAA 2HPPH 2BD8A 1EJAA 1WTGH 1SBWA 1SGCA 2ZFTA 1J8AA 4GHQA 4U2WA 4VGCB 4MNWA 3BEUA 3ATIA 4LZ4B 2WPIS 1EAUA 2K2TA 4J1YA 2ZGBH 5K0HA 3FANA 4DW2U 2W6JD 4YOIA 3FBYA 4ZUHA 1OX1A 2AHME 2YGQA 2YOLA 4A7IB 4BDXA 4INLA 2AEIH 3LKWA 3MH4A 1M9UA 1ELVA 3URCA 5A8XA 3BTWE 1O2KA 1SQTA 3EGFA 1ATAA 4BAMB 2Q6FA 1GBAA 2GZ8A 1V2PT 1TAWA 3RDZA 4I32A 2ZFRH 4B75A 1MH0A 4DURA 3Q3KB 4FETA 3GCHB 1AO5A 1UW7A 1UTJA 2BOKA 3QZRA 2ALPA 4AB8A 5LPEA 3U73A 1TWXB 2QCYA 4BTTA 3M61U 1MOXC 4AB9A 1QBVH 1PTHA 4X6PA 1TGTA 2CF8H 4B71A 1Y8TA 2GCHG 2EEKA 2ZCKP 1FJSA 5JB9E 1VITF 1KYNA 1CT2E 2GP9B 1YGCL 4ABDA 2ZU5A 4KTSA 2Z3CA 5A8ZA 1C1VH 1D9IA 1TMTH 2Z94A 3OYPA 2IPHA 2ESTE 2GDEH 1HZ8A 1W0ZU 4IBLH 4MVNA 1OS8A 1F0SB 2P3TA 4GU3A 1V2UT 2AMPA 1QHRB 2GJGA 7KMEH 1QB9A 2GVFA 2PWXA 2A45B 2C90B 1N1LA 2K2SB 1P11E 3E16B 1LQDA 4AFZA 1J9CL 2H6MA 4AORA 3CS0A 3F2GA 1IOEL 4OGXA 3U1JB 1O5BB 1CT4E 2FDAA 1ZGIA 2IN2A 4GCHG 1EBVA 5EQSA 1GJCB 4FUCA 3SV6A 2HOXA 3A82A 1O5DH 1KTTB 1UCYK 3KGPA 4FUGA 2RFKC 2YNAA 5A2MH 1TGCA 2XC0L 2ZPSA 1O2NA 1IQFA 1DFPA 1QY6A 3AAVA 1PPHE 4YLQH 3HPTB 4YT6L 3PLBA 2FI4E 5A8YA 1YF4A 3NPSA 3A88A 1FZZA 1J9CH 4IN2A 5IKRA 1J16A 1HYLA 3SYJA 4CRCA 2MGRA 1IQLL 4ZAEA 1S0QA 8GCHG 1KSNA 2GCHF 1VCWA 3BG4C 4A6LA 1OSSA 1V2NT 5B6LA 2FOGA 3GCHC 1EMOA 1BMFD 1PFXL 2P3UA 5HM9A 3LIWB 2P3FH 1L5GB 3UB0A 4WF8A 1EPHA 1G3EA 3NCLA 1P2JA 1KXBA 2KCPA 3TJNA 1CVWH 4CRFA 3PGHA 5E0JA 1ZHMA 2VIVA 3BIUH 2ALVA 5TJXA 3BPSE 4AC9A 2Z7FE 4THNH 4MLFB 4RI0A 1C5LH 5GIBA 1SOTA 1XXFA 3OY5U 5JBTA 2KL7A 1ZPZA 5GWZA 2CGAA 4SGBE 1IQLA 2VH6A 5C2ZA 3DFJA 1PPEE 3IWMA 3W1EA 1T8OA 2PKAA 3RXBA 1TA2A 1THRH 1FUJA 2ZCHP 3SW2B 3RXVA 6CHAB 4ISOA 3QMOA 4JZEL 1O2UA 1PJPA 2J34A 2Y80A 1O5GH 2CHAB 1PYTC 2P16L 2ZFQH 4YT7L 4B2AA 3CS7L 2HORA 4Y0ZE 3STJA 2AYLA 2Y5GL 2QF4A 1BTUA 1AU8A 1AWHB 1O2VA 2ZHWH 4X0WU 4LORA 4DG4A 2JH0D 1IOEA 2P28B 3F6UH 1TQ0B 1WUNH 1OWHA 1CHGA 2BQ6A 2H1UA 3I78A 3Q3YA 4AG1A 4AFSA 3GDUA 1DX5I 3HATH 4IN1A 4XBBA 3A7WA 3SNBA 1MD7A 2G4TA 4A1XA 2KNIA 1CO7E 3A81A 1GGDB 1E34B 4M10A 5L2ZH 5EW1H 3N8YB 1YPMH 3ATLA 5FCRA 1O30A 5JDUB 2ZHDA 4RRXA 2BD7A 5GCHG 3Q76A 3SJOA 1CBWB 5HYOA 2A0QB 1IQKL 1FY8E 3MNSA 4AYVB 3UQOA 4I7YH 3M5OA 1TBZH 3HGNA 1GI9B 3SNDA 3SU6A 1EP5A 2Y5FA 1V2RT 1NO9H 4X2WA 1S5SA 5C0TA 1P0SH 1PGEA 1O2WA 5C17A 2O9QA 1NTPA 2B0FA 1UK3A 1S6HA 2ZF0H 3HPTA 2SGPE 1NZQH 1RIWB 5I25A 1GVKB 1K1LA 1AKSA 1KIGL 2O8MA 1QL7A 2J4IA 3TK6A 1QR3E 3Q7DA 2HRVA 4KTCA 3SU4A 1UVTH 1AMHA 3HS7A 4LXBH 2R0KA 3K6ZA 1XUHA 4CUEA 1WDIA 1DWCH 1HRFA 3M37A 4DVAU 1WXRA 1FAKL 5CKQA 2KCOA 2BOUA 1GCTC 2ANWA 1FY1A 2H9EL 2YGPA 1F7EA 3A83A 4ZH8A 4B1TA 4HGCA 1ELAA 4ZXYH 1QA0A 1C2JA 1LVMA 2EI7A 1GI0A 2F9BH 1LVOA 1TPOA 5C1YA 3N7EA 1YUKB 3KCGH 4WH8A 5CHAB 1EATA 3M7TA 1FPHH 3SOSA 3SI3H 2C8ZB 1AUTC 1C1MA 4NA9L 3SUFA 1GHBG 2F9NA 3AAUA 3HK3B 3U8TH 1PPFE 1LKAA 3GOVB 4A92A 2J38A 2PTCE 7GCHG 1ZSLA 3UNQA 3UR6A 1EB1H 1GHYH 4QT8C 5GCHF 4JYUH 1DSTA 1AVGH 2BOHB 2V7QD 1UCYH 1LTOA 4K5ZA 1MTUA 1ESBA 1D4PB 2Y7ZB 2WPHS 4YOJA 3DEMA 5CKNA 2GD4B 1INCA 3BG8A 1FY4A 2VWLA 4UFDH 1EGFA 1O3FA 1SGEE 1QZ8A 1WV7H 4I8GA 4GHTA 1ZYOA 2H5DA 2JETC 2RDLA 5AVDA 1FMGA 4XSKU 2WPIE 1GJ4H 1ESAA 4M9FA 3K9XA 4BXWA 1VKYA 1SVPA 3ZZ4A 2PSXA 5GNDA 2A2XH 3RXTA 2OQ5A 4D76A 1B9WA 3BTTE 2ZDAH 2FOBA 1GG6B 2VIOA 2W3KA 1KY9A 3E90B 5I46H 1EAXA 2OUAA 4WJG2 2V3OH 3M5LA 4CRGA 1JRTA 4XD7D 4NGAL 1FX0B 4Y6DB 3LGIA 2XCFA 9LPRA 3KL6A 3T2NA 2Y6TA 1GDUA 3K65B 2M74A 2TBSA 3A7TA 1AI8H 2KCAA 1K1NA 2EC9H 3B8JA 1EMNA 3UQVA 3SUGA 1EZSC 1ANBA 1O5FH 2BD3A 3D62A 3GYMA 4IMQA 2KX4A 3NRLA 1C5XB 2BZ6L 1GG6C 4ZHMU 3MH5A 2P93L 3QX5H 2QE7D 1LVBA 1A0LA 1QL8A 2Z6BD 4NIVA 3T27A 3E0NB 1W12U 3LN0A 1BRCE 1GGDC 1KLJL 1P2IA 4Y71A 2AGGX 5DO4H 5JB8E 1BDAA 1HAXB 3SJ9A 1NT1A 4Z0KB 3UNRA 2VH0A 2UWLB 1C2MA 3PWCA 3SNCA 1OWIA 2O8TA 4E7RG 3ZV9A 5TCCA 1VITH 2J34B 1PPGE 1UMAH 3MU0A 2BOKL 1W2KH 1SGIB 1BQYA 1GMDG 1GBHA 1H9HE 2ZU1A 1NRNH 1VJAU 3MI4A 1IQJL 1ARBA 1LKBA 3FOAA 1IQEL 1YGCH 4X1NU 2WG3C 2Y7XB 3SGBE 5CHAC 1CGIE 1RGQA 4X2XA 1GCDA 2QYIA 3LC5B 2BSFA 1DT2A 2HALA 3V13A 4A1TA 1MUEB 4TY7A 1APQA 1V2ST 1EQ9A 2ZQ1A 1ZRBA 1YPHE 5L2YL 1JBUH 5GJ4B 1ACBE 2F83A 1L1NA 3ZV8A 5EXLA 2PUQL 1THPB 2PHBA 1IGXA 1TRYA 1C5VA 3TK9A 1V2OT 1FQ3A 1GI7B 5DKMA 6CHAC 1PPBH 1K1JA 3M3VA 1RD3B 2A2QH 1TLEA 3MO3A 3S9BA 4GSOA 1G3DA 1O3BA 3ZVAA 3ZZ6A 2W3KB 4MPUA 2Y82A 1P04A 3ZZ9A 3SOBB 2C8WB 3M5NA 3ZYGA 3PWBA 1FE2A 4CH8B 3RXCA 1GDQA 1OYTH 2P94A 1O2QA 2RA3A 2ANMH 3NKKA 4MPVA 3TK6B 1O2RA 1ZOMA 5LPFA 3RC6A 3WW7A 2CXVA 3BEIB 1TOZA 4X8SL 3ZZAA 3L3TA 1IQMA 2QV1A 2WPKS 1H8HD 5LGOA 5IKVA 3TZIA 4ZKOU 2FTMA 5C3NA 5CDFE 3BG4B 4FU9A 2PHBB 1VGCB 4LMFA 4Q7YA 1GHXH 3VB6A 4UONA 4CR5A 4P00A 1K22H 1PQ8A 1L4ZA 3TVJB 2W3IB 1O3NA 8GCHF 2A4GA 2FODA 2VWNA 1J15A 1P06A 4U01A 1QL9A 1MQ6L 2ZA5A 5E2OA 3SZEA 4DCDA 3F0OA 3MO6A 1HJ9A 1QBNA 1KDQA 4O3UA 1EZUC 1YP9A 1HAEA 1COWD 1CHOF 1UHBA 5EJZA 4Y6DA 4H4FA 2WSSD 1C1PA 1NPMA 1P9UA 4ISNA 1AZ8A 2PSYA 4X1QU 2ZCLP 3F9GA 2W2ME 2ODYB 1GI4A 2SNWA 4JK6A 3TH3L 1WU1B 4GCHF 1DXWA 1LVYA 1V2KT 3P8OA 3PO1B 4YM9A 5COXA 1ZMNA 1DXPA 3EAJA 4NIWA 2ZKSA 1RTLA 2JH6D 1ZRKA 4Q4LA 4ZKNU 4KGAA 3ELAL 1HX2A 3I29A 3RLYH 6GCHF 1TBQH 1BJUA 3LJJA 3TJVA 2XXLA 4LK4A 5L30L 1O2OA 1MU8B 3ODFA 5C5OA 1GBIA 4Z6AH 1O31A 1XVOA 2VVUA 1O3AA 1KDQB 2IJD1 4WY3A 3P70B 2IOTA 3HGPA 1SOZA 1OWJA 3RXIA 2FS8A 1ATEA 4LZ1H 4CSYA 3ELAH 1PXXA 1A61H 2ZFFH 4X6OA 1C5WB 4X6NA 1Z6CA 2KM0A 4XL1A 4ASUD 2TGAA 2W26B 1N6XA 3RMNH 1IQHL 1CQEA 1G1SA 3M5MA 3P5BL 2PLXA 2B7DL 2WPKE 1FSBA 3UWIA 1I0UA 1DUEA 2TRMA 2G4UA 2VJ1A 1NFUB 1P9JA 3TH4H 2D1JB 4CHAB 2BQ6B 4LOYH 2K1QA 4FUIA 5K7RA 1O34A 1LHCH 1O3HA 1QJ6B 3PRBA 3SNEA 4ACBA 1Q4GA 3VB7A 4DIIH 2C8YB 3BTFE 1S84A 1HDTH 4TY6A 1O3PB 2Y5FL 4MMYB 3K9XB 1GBDA 1DUAA 2XCNA 4KKDA 1LPGA 1DM4B 1V3XB 2ZECA 2J5UA 2BZ6H 3P8FA 5HXFA 4RN6A 1G3BA 1B0EA 4ISLA 1ZGVA 4DT4A 4ZXYL 1FPCH 4YOGA 1X7AL 2AIQA 4BTUA 1F2SE 1IOXA 4ESTE 4UE7H 3S69A 5JBCE 1ZR0A 3JZ1B 3MU5A 1Z8JB 4OM9A 2I9AA 2VJ3A 5ABWA 3HS5A 5JBBS 6GCHG 3LH3A 1GI6A 2L74A 2R2WU 3N8VA 2P8OB 3CP7A 2FLRH 3U1IB 1TRNA 3GS9A 1HCGB 4MMXB 2JDID 1QFKH 4X8VL 3EGKH 5E2PA 2F91A 3BTGE 1TNGA 2EI7B 1XKAC 5DP9A 3OFND 2FZZL 3VEQB 5JBCS 1K28D 1DS2E 1NQLB 3NTGA 1CHOG 1O37A 1A7SA 5BRRE 4ABHA 2FI3E 4X6MA 1YY3A 1IP0A 1CVWL 1PYTD 1XVMA 1Z1IA 1P2NA 5JB8S 1F0UA 3NWUA 2A1DB 2NU0E 1P2OA 4ZROA 1MQ5L 1BMLA 3QCWA 3BF6H 3IG6B 5JBBE 1SPJA 3DCLA 4Y10E 2RNLA 1ZSKA 1EPTB 3NTBA 4TGFA 1IHSH 1BRBE 2YNBA 2GTBA 1L1GA 1W7XH 2Q6DA 1TPPA 2D2DA 4VGCC 3KN2A 1S6LA 4NZLA 3U69H 2RA0L 1A0HB 2VH6B 1Y5BT 2ZO3H 1FDPA 2HOBA 2BY9X 1QJ1B 3FP6E 4U30A 1GBCA 2RG3A 1F0RA 1W8BH 3TGKE 1ELBA 5EXMA 2GV7A 1NRSH 4WWYA 1AZZA 1E35B 3RU4T 2Z3DA 1EZQA 1Y3UA 1S83A 2ANKH 1FXYA 3QWCH 2H9TH 2BOXA 4ZXXL 3DD2H 5J4SA 3PV2A 1D6RA 2BLOA 2BQWA 2BDIA 1GI2A 5JBAE 4HTCH 2NPRA 1QA7A 4JYVL 2CMYA 3SU3A 1DY9A 4H42U 1DICA 3FCSB 2QF5A 3VB4A 2G52A 1A2CH 2J94B 4ZHAA 3CENA 3CA7A 2FTLE 4AOQA 1Z8GA 4RS0A 1GMHF 1T4VH 2BLWA 2PFEA 3TNTA 2W7SA 1C1WH 2CF9H 1HPGA 3FP7E 5F53A 1DIYA 2GCTC 4DJZB 4ZHLU 2F43B 2FOMB 1EJMA 3KCGL 2D26C 4GUXA 2ODQA 4INHA 1ETSH 3W95A 3KNXA 2BDBA 3T5FH 1A4WH 1A1RA 3MWIU 4ABJA 5ETXA 5DGJA 4ACAA 4K60A 3A8DA 2STAE 2OP9A 4NSYA 4ABBA 3SU0A 4HI3A 5JPMH 4OS2A 1PPZA 1YCPM 1O3KA 1V2LT 1Y5AT 3FP8E 3T29A 1RTFB 1N8OB 1YPEH 1BTZA 2B7DH 4O03A 2BDCA 1O2YA 1O38A 2GCTB 2ZTYA 1K1MA 2BOHA 3UWJH 2FI5E 4YZUA 1P05A 1RTKA 1O35A 4RKJB 2CJIA 3KQ5A 1Z1JA 1XM1A 4I8HA 3VPKA 2PR3A 2JJLA 3MU1A 4IC5A 1SGRE 1CGHA 3ZVGA 1OHHD 4CRAA 1DOJA 3KK6A 5GXPA 3UOUA 1EKBB 1Z6JH 4FUEA 3KQDL 3P6ZB 1L0ZA 3TK5A 1ANCA 1QB6A 1EZXC 4UFGH 2FEQH 2FOEA 1C1NA 1NFXB 2FP7B 2QA9E 1C4U2 1ATDA 1FFMA 1O2LA 3KQCA 3Q00A 5BPEA 3SN8A 7ESTE 3C9AC 1DDJA 3GICB 1GBMA 3QTVH 3E1XB 4JZ1A 1HAIH 2W2PE 4DOQA 1NBME 2VWOL 3PMHB 1A5HA 1TABE 5HGGA 5CISA 5L6NH 2BMGA 4BTIB 1EAIC 1ZTLA 1A5IA 5IKTA 1RS0A 3RM2H 1MBQA 3LU9B 1Z6EA 2HLCA 2XYAA 4NG9H 2BO2A 2WV9A 1S0RA 2PUQH 3DT0H 2FYRA 1ZMLA 1DWDH 3F3BA 4INKA 1NFYA 8KME2 5EW2H 2WINI 1ARCA 5C1XA 4B6FA 3GY6A 1U67A 1O2XA 1XUJA 1GJAB 2GT8A 2GX4A 2Z9GA 4Y11E 2Y7XA 1BIOA 1THSH 2G55A 2A4OA 4TT3D 5HIZA 1P2MA 2YMSC 1BHXB 2VVCK 3KF2A 2WUBA 2ZTXA 1NFWB 4JCNA 1ZPBA 2ZFSA 1F0RB 1FONA 4Y7AB 2ZU3A 2TGPZ 3TGIE 1SZBA 2CV3A 5GPIB 4BAHB 3QTOH 4A1VA 2GDDA 4D9QA 3STIA 4B6EA 1Y5UT 5LPRA 1O2JA 3ENSB 5AHGH 4Y7BB 2HGTH 2H5CA 3IITA 1NY22 1C1TA 1IHTH 1CA8B 2Q1JB 3RM0H 1HGTH 1DPOA 2WG4B 1H9LB 1MTSA 1AFQC 2UWPA 1E0FD 1LMMA 2FMJA 1EPJA 3SI4H 3Q3KA 1G32B 1FAKH 1TX6A 1HAYB 2ZDMA 3SOVA 3AVZA 1VITG 4JZFH 5C94A 3IITB 1IQNA 1BF9A 2BX3A 4MG3A 1VCPA
chains in the Genus database with same CATH topology
1OP8A 1VJ9U 3SV8A 1TA6A 2D8WA 3SW2A 2XBWA 1GL0E 3AW1A 3M7UA 1TNJA 2RHPA 1WAYB 3SORA 3AW0A 2XRCA 3GDVA 3ATKA 4NZQA 1O5AB 1V2WT 2HVXA 1IQEA 2XWBI 1SC8U 1HJAB 1WTHD 5T6FA 3OTJE 2AIPA 1W3CA 3NZIA 1W14U 3VFEA 3OY6U 2SGFE 2XBVA 3ATMA 4HZHA 2Y38A 3VXEH 4ZAEB 1DDXA 4Q7XA 4TWWA 3RU4D 1O3EA 1XFEA 1UZKA 1RFNB 3D65E 1SLXB 4KTUA 4D90A 1QTFA 3U9AH 1ZLRA 1WQSA 4JZDL 1V3XA 1QRZA 4RSPA 3KQEL 1O3MA 5EQRA 4PH9A 1ETRH 2VVVA 2VU8E 1XX9A 2Y81B 3FZDA 1AKSB 2Z9LA 3LDXH 1K1PA 4SGAE 4E06H 1EQGA 2TGDA 1WYKA 4X2YA 4C16A 4B2CA 1Y59T 5L30H 1UZJA 2Y82B 3RXMA 4X8UL 2ZFPH 1GJ5H 1Z7KA 1OYQA 3U8OH 1GJBB 1JRSA 4Z0LA 1DX5M 1V6DA 2H9EC 4AG2A 3PO1C 1C5YB 1SGPE 1TOCB 2P95L 5FBIA 2IJOB 2PKSB 2QXJA 3ZZ3A 3RXQA 2QF3A 1DWEH 2Z9IA 1DY8A 4MNXA 3BT2A 2WYGB 1E38B 1IQNL 1ELDE 7LPRA 1BMAA 1EOLA 4XFQA 3TBDA 1CQQA 3NK8A 1EP6A 5C1UA 3KRKA 3QK1A 1EXFA 1JBUL 1SFIA 2AYWA 2UWLA 3LGVA 5C67A 2A5IA 2R3UA 1L4DA 4F4OC 1NM6A 4MQAA 3S9AA 1PQAA 1ABJH 3A85A 3QGJA 4O02B 2HNTE 1O2ZA 2ADXA 1T31A 1GI5A 1ID5H 1AQ7A 2F9PA 1QNJA 3LGYA 1NROH 1GBBA 4X8TL 4X1SU 1GBJA 3ZVDA 1P2KA 1HJAC 1T32A 2NU2E 2O8WA 1IQGL 1AGJA 3ODDA 4Q2KA 5DP8A 1BRUP 1C2KA 1OWDA 2HNTF 3TGFA 4RRWA 3AASA 3GDSA 5FPTA 3NJPC 1GBEA 4Y7AA 1GBLA 4OS1A 4CH2B 2PGBB 5DP7A 1MMJN 5FX5A 5E0HA 4K69A 1EZQB 1IAUA 3SU2A 3EA8A 2ZPQA 3SNAA 1TX8A 4NCYA 4ZXXH 3LIWA 1T4UH 4COXA 1C2EA 2ZC9H 1EASA 2FX4A 5C5NA 3MFJA 5PTPA 4Q80A 1K9OE 3I77A 1ZHPA 2P59A 1KTSB 3N8WA 1TLDA 1AUTL 1GI8B 2QGRA 3RXAA 4D7GA 2SFAA 4FVDA 3RLWH 3ZZ8A 2VWNL 2ZU2A 4AX9H 3BIVH 1EAIA 1O2PA 1A5GH 1ZAQA 3A8CA 2ASUB 1AWFH 2M5TA 2OC7A 1FN8A 1QURH 1GBKA 1GVZA 2QY0B 4Y8YA 3A8BA 1HAGE 1ABIH 1KXEA 3LJOA 2PKAB 4NA8A 3GY5A 1JXPA 3UREA 3MH7A 5SGAE 1PFXC 1BRAA 1SGFG 3RXDA 2BVSH 1SB1H 2UUFB 3VB3A 1CVUA 1Y3XA 3FAOA 3A7VA 1C2IA 1HJ7A 2OC0A 3EYDA 1UK2A 2RCEA 1OB1C 4HFPB 1SHYA 1A46H 3N8YA