3F1SB

Crystal structure of protein z complexed with protein z-dependent inhibitor
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
275
structure length
259
Chain Sequence
b'NECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Z-dependent protease inhibitor
publication title Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 66
structure length 259
sequence length 275
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3f1sB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3f1sB02
1XKAL 1HV7A 5EPYA 1V2MT 1BMNH 4XBMA 2C90B 2BVRH 1SC8U 4NGAH 3V13A 2ODPA 1YUGA 4OS6A 5CHAB 1DXPA 5EQRA 2M5TA 3CS7L 2W26B 2FOMB 5E8DA 2BOXA 4IN2A 4X1NU 1BRBE 3ODFA 2ZQ2A 4AGKA 2K2SB 3SI4H 3TNSA 3O8DA 1X7AC 3NKKA 2RCEA 3AVZA 4D9RA 2FI3E 2BY9X 4ZXXL 1GI6A 3ZZDA 4FUEA 1JRTA 3UNSA 4ABHA 1C5RA 2KB9A 3AAUA 4A7IA 1EGFA 3AASA 5FCKA 3VXFH 1QB6A 2WFXB 4ZHAB 2BD5A 2EA3A 2VWOA 5JB9S 2BOUA 1M1XB 5PTPA 5DP7A 2XWAA 1BMMH 3N8XA 1WTGH 1JV2B 2BMGA 2H2ZA 3UR9A 2ZU5A 2RA0L 2ZC9H 1QNJA 1KXEA 1UZJA 2GD4A 1ZHRA 2QA9E 3NWUA 4E7NA 2BD2A 4GSOA 2B8OH 3LKWA 3SOQA 1SPJA 2G5NA 1P06A 3V65B 1HRFA 1BQYA 3Q3YA 4G1MB 1P2QA 2ZDNA 1YUKB 2Q6FA 1A1RA 3U8OH 1GJ6A 3NK8A 1T7CA 3QWCH 4X8SH 1HXEH 5IKQA 4C16A 1AY6H 1YBWA 3F6UH 3MNBA 4X6NA 2GT7A 3TJUA 3PLBA 4AB8A 1TA6A 5DKMA 1KTTB 4INHA 1ZPZA 1G2MA 1V2ST 1YM0A 2F83A 5JW1A 2FOBA 4CH2B 1G3CA 1NT0A 1ELTA 1GMHG 1SLWB 3OYPA 6LPRA 1NO9H 1KSNA 1EX3A 1LCYA 1W0YH 4LOYH 1EUFA 3PTBA 3LC5A 5HXFA 4RRYA 1A3PA 3A87A 1F5KU 5DJ7A 1TONA 1CQQA 5F6MA 1EJMA 3BTWE 5E0JA 1EZQB 3RU4T 2VWOL 3EA8A 3KRKA 3UUZA 2JH6D 1XUIA 1BJUA 1DDJA 5JB8E 4OS2A 5C1UA 2WFTA 1O2VA 3FBYA 1O3BA 1UMAH 1S82A 1FMGA 2QIQA 5L2ZH 4ISIL 1HAGE 1A3EH 2I6SA 2WV4A 2ZHFH 1O2LA 5HM2A 5FBEA 1RFNB 1LPZA 3GCHC 4I8KA 4THNH 1ETRH 3IWMA 1IQFA 2FLRH 1O3GA 4LZ1H 4E1GA 1HAOH 1A0LA 1TIOA 4ABFA 2XCFA 1IAUA 1DOJA 2Z9GA 3LDXH 3SV7A 3ENSB 2PHBB 3D65E 4X1RU 2MGPA 1TPAE 3DHKH 1P3CA 1S85A 3EA9A 4WVPE 4ABIA 3TVJB 1HUTH 1Q31A 1TX6A 1O3IA 3SHCH 4Y0YE 3V0XA 3FCSB 2WYGB 3KIDU 4UDWH 1NFXB 2SNWA 1SHHB 4ISOA 1KXDA 2BD9A 4ABJA 2H5DA 3N8YB 1EQ9A 1SLXB 3UTUH 1BRAA 2H1UA 1S84A 2Z3CA 1E35B 1XXDA 4ZXYL 1C2GA 2ADXA 1ZLRA 1MKXK 4B1TA 4K2YA 2P93A 3QLPH 2XXLA 3O8BA 1FY3A 2FI5E 4MLFB 1THPB 3TU7H 1J17T 1AE8H 1XMNB 1ZHPA 2BLVA 1V2QT 3LGYA 6GCHG 3E90B 3W94A 3SNAA 1T31A 3P8OA 4O1ZA 3PM3A 2WV5A 3A8CA 1F5LA 1GHBF 3KN2A 4IC6A 1DM4B 1JMOH 3NPSA 1YCPK 3TLOA 1MUEB 2J94B 3U98H 2JH5D 1E36B 1M9UA 5FCRA 2FPZA 2BQWA 1A3BH 1B7XB 2BB4A 2OC1A 3RXFA 1K1MA 2ZU4A 4NIWA 1ZGIA 3KHVA 5FX6A 4HI3A 2FOAA 5C1YA 1L5GB 1WTHD 1PFXC 2Y7ZA 1HRTH 2R3YA 4YOIA 4Y8XA 3ZZBA 4BTTB 4BDWA 2Y5FA 1LKBA 3K9XA 1ZPCA 2P93L 1D3QB 3K6ZA 1IQIA 2F3CE 4Y7BB 1GPZA 2ODQA 3F9FA 3M36A 1ANCA 2LPRA 2VB0A 4HTCH 4K1SA 4CRGA 2G52A 9LPRA 3LGVA 1TNIA 3KCGL 1GBDA 2IOTA 2Y81A 1THRH 2V3HH 4OS4A 4NG9H 2BDHA 5C5NA 4B71A 5HGGA 5EXLA 2WPHE 1K28D 1ATBA 1ACBE 1GI7B 1YPEH 1Q2WA 1ZJDA 3M61U 4B74A 4K1EA 1DUAA 3A8AA 4NIYA 1QJ6B 5CKMA 1O5GH 2ZFQH 4AGJA 6ESTA 5C1XA 1CHOF 1DT2A 3BG4C 1FPHH 4IGDA 1DWDH 2UWPA 2FOFA 4X2VA 3M7TA 1A0HB 1SQAA 1TPSA 2JETC 3LGUA 1KLIL 1UZKA 2Y5FL 4DIIH 1GHAG 2J95B 1ESTA 4VGCC 3MO9A 3N8VA 4WH8A 3RXBA 1BBRK 2VGCB 1KDQA 2B5TB 2Z94A 4Z0LA 1O3AA 1IQIL 1BBRE 1TBRH 1ELFA 3ESTA 2BD3A 3TPIZ 3M36L 3LN0A 2ZZUH 1V2RT 3HGPA 4U2WA 3E8LA 1DANH 1SL3A 1T8OA 3LAQA 2Z9IA 3Q77A 3SJKA 3QMOA 4LXBH 4H42U 4M7GA 1G2LB 2G00A 1P3EA 1BT7A 5E2OA 3BEFB 2FOGA 1QIXB 1KYNA 2BDGA 3GDUA 3RXJA 1JIMA 1GBAA 2CF9H 1YO8A 1ZSJA 3OSYA 3M5NA 2A4QA 1NFYB 4IMQA 1FIWA 2GD4B 3ATKA 1DSTA 1FAXA 1O30A 2VIWA 3AAVA 3PMJA 1O5DL 2OUAA 1BZXE 3ZZ9A 1TMUH 1E38B 1Y5BT 3MU4A 1GI2A 1WBGB 4CHAC 1BIOA 4X1QU 1HT5A 1GBFA 3GCXE 2SFAA 1FLEE 4AZ2B 2AIPA 5DO4H 3P70B 3R3GB 3HATH 1GWAA 1PQ7A 4NSYA 3LONA 4D7GA 5HM9A 1GBHA 3RXLA 1DS2E 1A5GH 2F9UA 1H1BA 1EZSC 5GCHF 2WPMS 1ELBA 2G00L 3KNXA 1ZMJA 2Y7XB 1GK5A 1TQ7B 1O2MA 4OGYA 1K1NA 2FS8A 4O3UA 3BTKE 6COXA 1O5AB 2AGEX 3S9CA 1GI4A 3I77A 1LQDA 2ZCKP 3SBKA 3U1JB 1V2UT 4BAOB 2GCHG 1FAXL 3BN9A 4IW4E 3ATLA 2O8LA 3VB7A 3BV9B 1YPHE 1QB1A 4FU8A 3LIWB 3LU9B 3B23B 6CHAC 3TGKE 2ZGBH 1Z8IB 2UUFB 1HJ7A 2ZPRA 3ZV8A 3C9AC 1IQJA 2ANYA 2BDIA 1FN8A 1E37B 4TPIZ 2W2QE 1NT1A 3NTBA 2BVSH 1AZ8A 2CF8H 3SGQE 4GPGA 4BTUB 2XBWA 1PPEE 3SU5A 1C5LH 3DD2H 2CHAB 2AIQA 1MU8B 2PTCE 1UZQA 3GCHB 3QTOH 2VIPA 3M35A 3SJOA 1IQNA 4O3TA 1WQSA 3ZVBA 1EAUA 1MCTA 4R8TB 5JBBS 3RXEA 1YKTA 1ZTLA 1TGNA 3SV2H 4Y11E 4GCHG 1XVMA 3N8WB 2ZPQA 3MO3A 3EYDA 1AGJA 2VVCA 4YO9A 1TMTH 1TX8A 1HAIH 4X8SL 1NY22 1C4U2 3HS5A 5EGMB 4ISIH 2TGPZ 1OWJA 3NUMA 4Q2KA 2ZGHA 1AUTL 1GMCF 1A7SA 1SG8B 4MTBA 1MKXH 3SW2A 1GI1A 4WWYA 1S0RA 1Y3VA 3TK5A 2D8WA 2FS9A 4AYVB 4JYUL 2PR3A 1IQJL 3A85A 4UD9H 2K2TA 2W3KB 4RUTA 1NQLB 4TYDA 2XBWL 1KLTA 3SN8A 1UTOA 1H4WA 2GKVE 2Z7FE 2ZNKH 1TOZA 2ZWLH 3VEQB 3T25A 1C5QA 2RHPA 1O2XA 1AI8H 1Z6EA 2BDYA 3LGTA 1W0ZU 2ZDLA 1CT4E 1V3XA 1P09A 2UUKB 1FUJA 3ZZAA 2VIVA 3LOXA 2CN0H 2WPKE 1D3TB 3DFLA 2NU3E 4BAHB 1AU8A 1MCVA 3SNDA 1NFUB 4GHQA 1F7MA 4GHTA 3QGNB 4KTCA 4ZXYH 1LPGA 5F19A 2HNTC 1GDNA 2YNBA 5E2PA 2BQ7A 4B73A 3QN7A 2ZDAH 1AKSB 1YP9A 1W3CA 4Z0KB 5F03A 1AB9C 2DUCA 1J14A 1P05A 2WYJA 4A6LA 3QCWA 5ABWA 5ESTE 2PKSC 1BRUP 2V3OH 4WMEA 3Q76A 1FY5A 2J4IB 1IOEL 3A89A 2VJ3A 2BOKL 4BTIA 4LZ4B 3U73A 3T62A 1ATAA 2CGAA 4X0WU 2SGPE 1UHBB 1CBWC 1GJ8B 3U9AH 2ZI2H 2HRVA 4I8LA 2WG3C 1Z6EL 3A8BA 5JB9E 2Z3DA 1HJAC 4D0FA 2A4OA 1CT0E 3FP7E 4AORA 1P2MA 2J2UA 2VVCK 1PQ8A 4CUDA 1DXWA 4OGXA 2H9TH 3BTFE 3T2NA 3RC5A 5JBCE 1Z1JA 2OBOA 1F0RA 1GCTC 2UWPB 2STBE 1C9PA 4CBOA 1O2KA 1DY9A 3BG4B 7KMEH 1BBRH 2XCNA 1CX2A 1K1LA 2JKHA 3GY7A 1N8OC 3KCGH 5GIBA 1Z1IA 2JETB 1TLEA 3U7UG 2R3UA 3FAOA 3T29A 2BQ6A 1O2OA 5JBAS 3F9GA 4TY7A 2Y80A 1OWKA 4VGCB 2V35A 4JZEL 3W95A 1IQHA 1NFWA 1MAXA 4BOHA 1UK2A 5AF9H 3RXHA 1P04A 2IJOB 1L3YA 3GCNA 1G3DA 1ELAA 2FXRA 1O2SA 4ABAA 3HK6B 1ZRKA 1O3MA 1FFMA 1QJ1B 1DUEA 1GL1A 5EPNA 2BLQA 4X6OA 4MNWA 4YESB 1NZIA 1Q4GA 3UQOA 1VZQH 1C1MA 4PH9A 2KAIB 2Z6BD 1SGDE 1UTNA 2HPQH 3PTNA 4NG9L 3UIRA 1KLIH 5LPEA 1OXGA 2PGQB 2ZHWH 3EQ0H 3UNQA 1QURH 4Y8YA 4IS5A 1W8BL 1HIAA 4I7YH 1O3OA 2Y82B 1VITF 2JKHL 1RJXB 1W11U 1ADXA 1G36A 2R0KA 3GYLB 1UO6A 3OY6U 3TK9A 2HVXA 2HNTE 5IDKA 3IITA 4A1VA 3E0PB 3H7OA 3V3MA 1IQHL 1TLDA 1AE5A 2BDCA 3ZYJB 1UJ1A 4AYYB 1EZXC 1EB2A 3UY9A 1Y3UA 3UREA 2R2WU 1OWIA 2VH6B 1EPTB 3BTEE 1AQ7A 3R0FA 5JDUB 3TJVA 1ELVA 3UWIA 1YPKH 2HPPH 2ZGXH 1C1UH 4K1TA 2EI7A 1DWEH 1Y8TA 1HAPH 1F0SA 3QZQA 2ZU2A 2FEQH 3SJ9A 2ANWA 1O2YA 8ESTE 3RXGA 1CSOE 1O34A 2Q1JA 3RXAA 1UTQA 1IP0A 1GBEA 1BTXA 3Q00A 2XBYA 3F9EA 3SUFA 4X8VL 4ABDA 1ESAA 2GP9B 4WXVA 1GJDB 1NS3A 1O3JA 5LGOA 3A7ZA 2P3UB 1TMBH 1Z71A 4D90A 1QR3E 2GTBA 3RXMA 1OPHB 1GDUA 4ESTE 4MPUA 1CVWH 2F9OA 2XBXA 1C5UA 2C8WB 2P8OC 2FTLE 1F5RA 5FX5A 3BT2A 2ZHDA 3RC4A 1MBMA 1P10A 3TJNA 1GBMA 2BXUH 4A1XA 1HCGA 1TOCB 2QN5T 3GYMA 1YLCA 2A45B 3MNCA 2UWOB 1GI0A 3HPTA 3PYHA 2YGOA 1A5HA 2BM2A 1IGZA 2BOHA 1MKWH 2PTNA 3TIUA 1UVSH 5L2YL 3OU0A 1C2HA 1K1PA 2TIOA 4RS0A 1MZDA 4FUIA 1ZZZA 4JMYA 5DP8A 1OP0A 2XBYL 4FUJA 4XFQA 2UWLB 2VH0A 4NSVA 3CA7A 3RR3A 2W3IA 1PRHA 1HLTH 4MDSA 1WSSH 1BDAA 1ZAQA 1RTKA 3SUDA 1Y5UT 2D26C 1O3HA 1ORFA 1MTWA 1FV9A 2W7UA 3RXQA 2XBXL 2A2QH 4F49A 5ESBA 1LPKB 4YT6L 1XX9A 2AMPA 3F1SB 3K2UA 3SNEA 2A32A 3I29A 3FANA 3ZVGA 4AQTA 3P8NA 2W5EA 1S0QA 5T6GA 1C5YB 3KK6A 2G8TA 4NIXA 2O9QA 2Y6TA 1DE7H 1NRNH 4J1YA 1F2SE 2H9EL 5KIRA 1WYKA 3VB6A 4JYUH 1NU7B 1D3PB 1GJBB 4Y76A 1HZ8A 1NRSH 2EI8B 2C4FH 3A7WA 1L1JA 4ZUHA 2SGAA 1XDTR 3AW0A 4IC5A 3TITA 3TK6A 2EC9H 2BDBA 3ZVFA 5FPSA 1CA8B 2OCVB 4K8BA 5SGAE 1BMLA 1F0TA 1O5BB 1AB9B 2ZIQH 3M3SA 2WPLS 2W2OE 1GVLA 1EOLA 1O35A 4MNVA 4DCDA 3TGIE 1UTPA 4NWLA 3IJEB 1DPOA 3RXTA 1BTWA 4RRZA 1O3KA 4ZHLU 5A0CA 4X1PU 2W2PE 1HAHH 4A1TA 3GCTF 5LH8A 1QA7A 1A5IA 1O2WA 1V2JT 1PYTD 2Z3EA 4CR5A 3M5MA 1HAYB 1NPEB 1JWTA 2VIOA 3ZVDA 2PKAA 4J2YB 4XL1A 4KTUA 1O3DA 3OY5U 2GGVB 5A8XA 2CJIB 1HJAB 3LC3B 5DP5A 2AMDA 1YPMH 3MNXA 1P11E 1Y3XA 3GICB 1Z7KA 1ZTJA 4Y79B 3ZZCA 1JXPA 1SFIA 4ZH8A 3UPEA 1LMWB 2AH4X 1O5CB 2PLXA 2J34B 1YYY1 1GCTB 1HYLA 1AVXA 4JK6A 4NZLA 5LPRA 1BITA 2BY8X 4D7FA 2KL7A 1ESBA 1H9IE 1L4ZA 4JK5A 4K8YA 5GDSH 2FZZA 3LTFB 2G5VA 3RU4E 3EAJA 1XUKA 2OC8A 1FIZA 1ZMNA 2A7HA 2C8YB 3EGKH 1Z8GA 2WG4B 4B2BA 1CEJA 3URDA 1MAYA 1GBJA 4K5ZA 4ZKOU 1O3LA 1A46H 1DWBH 3KL6B 1SOTA 4BXSA 1C2EA 1SGPE 1WU1A 1ZSLA 2HNTF 3RM0H 2J38A 1URKA 1JL9A 1WV7H 2EI6A 2XNIA 1LVYA 1HBTH 1SQTA 2BLOA 1IOXA 2PUQL 3V64C 1DLEA 3FZZA 1ELGA 1F92A 1V2KT 2PFEA 1Z8RA 4WF8A 1PXXA 4QT8C 4D76A 1FAKH 1DIYA 1PGEA 2Q6GA 4GVUA 1BTZA 2TGDA 1ZOMA 5EODA 1W14U 2XYAA 1MQ5A 3UOUA 4Q7ZA 1GGDC 2G51A 3GDVA 7LPRA 1QBVH 4JZEH 1XM1A 2TGTA 1O2JA 4SGBE 3SUGA 3RLYH 1GMDG 2FZZL 2ZHEH 3BSQA 5J4QA 1MTNB 3BIUH 2O8WA 4D9QA 3TH3L 5CISA 2WINI 4AB9A 2RDLA 2C3SA 4JZDL 1DWCH 1NM6A 4M10A 3E16B 4YLQH 3GISB 3GY5A 1XXFA 2VJ1A 2GCTB 1K1IA 1TNGA 2BYAX 4FM5A 3OLTA 3PO1C 1EPJA 1C4V2 1IGXA 5G4BA 5E0GA 1P2KA 1YPHC 2GVFA 2QCYA 2XW9A 4BAMB 1PPZA 2TPIZ 3M5LA 1E34B 3A80A 4HGCA 1W8BH 1BTUA 1OYTH 2H9HA 2OYEP 1P2JA 1UTLM 1Z8JB 2P26A 4DVAU 2D1JA 1TBQH 1H9LB 3SJ8A 1YUFA 4Y71B 1MQ5L 1AFQC 1FI8A 1QB9A 1C9TA 4I8GA 4Y7AA 2IN2A 4CBNA 2OTVA 4MPWA 2CXVA 3MQEA 2YOLA 1WUNH 1AHTH 2K1QA 4OS5A 4YZUA 1B5GH 1MOXC 4ZAEA 3FP6E 2F91A 4UONA 3WY8A 1MMJN 1N1IA 2ZCLP 3BG8A 3MHWU 5DP4A 2ZP0H 3F68H 1H8DH 1N6XA 4KKDA 1JOUB 2ANMH 4XE4A 1B0FA 1EOJA 1QRWA 4DURA 2FLBH 1SGQE 1ABJH 3LN1A 2P8OB 1FY4A 2MGRA 1L1NA 3E0NB 2VWNA 4A7IB 2H5CA 1QY6A 5AFZH 1HX2A 3LTGD 3PMHB 1ANEA 1QRZA 2QXIA 1RXPA 1O36A 1O2PA 3HS7A 1QBNA 1VCWA 3VXEH 4B2AA 3A7VA 1QQ4A 1RTLA 2BMGB 2QXGA 1OP2A 3UQVA 5JB8S 4WY3A 4RRXA 2XBVA 2NPRA 3KGPA 1EZUC 1HAVA 5DK1A 4X8VH 2P3FL 1O3FA 1DVAL 2FDAA 1TPPA 2FM2A 4BAQB 3TGFA 5JBTA 3VFEA 2VWMA 3MH7A 1GVZA 1WHEA 1HAXB 5K0HA 1C1RA 1LHEH 5AHGH 2W86A 1CCVA 8GCHG 5CE1A 4Y6DA 1G2MB 1SR5C 5ETXA 3QGJA 4OS1A 2ZFRH 2ZKSA 1OWHA 1KSNB 2TGAA 1LVMA 3LPRA 2PWXA 1S83A 3PLKA 3A84A 1SGTA 1C2KA 3LC5B 2FYQA 5BPEA 3SO3A 2VWNL 1AUTC 1FNIA 1OSSA 1SSXA 3M7QA 4GLYA 4ABEA 3ZYGA 3GCOA 4B2CA 5L2YH 1OX1A 1LVBA 1CVWL 2G4TA 2ZG0H 1O3EA 5EXMA 1VGCC 4XBDA 2BHGA 2SGEE 3LGWA 2XBVL 3URCA 4XOJA 1CT2E 7GCHG 4YOGA 1C5PA 4NA9L 4HZHA 2DE8A 5IYTA 2ULLA 2WPJS 3ZZ7A 1LPZB 3NJPC 1GMHF 1K22H 1O2ZA 1WCZA 2BDAA 2YGPA 1DY8A 1APOA 4YT6H 1H9HE 1NTPA 1GDQA 4Y10E 2VWLA 1DITH 1ETTH 4JZ1A 1C5XB 1G37A 1BUIA 1V2OT 2WUBA 1O37A 1AN1E 1W2KH 5F1AA 4TGFA 1TYNA 4R0IA 2H9EH 4GUXA 3FFGA 3NZIA 2CMYA 1PPGE 1KLJL 3L3TA 1RIWC 1TNLA 2ZFSA 1UVTH 1O3NA 2CV3A 1EP6A 4NFFA 1NROH 3D62A 2OQ5A 5AFYH 3SU1A 4E7RG 1YPJH 3RXKA 1QL9A 1C1SA 2ZECA 1MU6B 1C5OH 2A0QB 4FUHA 2VWMK 1QTFA 1Z6JH 2C93B 4LMFA 2W26A 1N7DA 2W2ME 2Z9JA 1ATEA 1MKWK 4PROA 1A61H 3ATWA 4RN6A 4WXIA 1G3BA 1AVWA 2SGFE 1AO5A 2FOEA 3BTTE 1GI8B 1IOEA 2BOKA 2G81E 3AW1A 1SBWA 2VWLL 3U8TH 1EATA 2ZGCA 1YC0A 2AGIX 2OLGA 2WPIS 1TB6H 1YCPM 1LHFH 1GHYH 2PUXB 5I46L 1EPHA 2WPHS 2BLWA 1QL8A 3E3TA 4ZHAA 3FFGL 2BVXH 2BQWB 2ZF0H 5T3HA 4Q80A 1UVPA 2BXTH 5FXLA 2FTMA 3ZVEA 1EASA 2Y7ZB 6GCHF 2FODA 2QF0A 1T8LA 4AFQA 3EE0B 2YNAA 2FI4E 3K9XB 3UOPA 2XC5A 1GI9B 5FHTA 1MTSA 3MMGA 1P02A 1O5FH 4O97A 2OP9A 1TE0A 2VIQA 4FU7A 4X6PA 3N8ZA 1ZSKA 2FWWA 3GY4A 4ZHMU 3ITIA 3ZZ6A 1COUA 5FPYA 1G3EA 2Y81B 1INCA 2PUQH 2BZ6L 2A5IA 4MMZB 1LTOA 3O8CA 1ZTKA 4DIHH 2A31A 1OYQA 1GHWH 2ILNA 1S81A 2HGTH 2ZDMA 1CQEA 3SNBA 1HAZB 3ZZ4A 1GMDF 1EZQA 3NTGA 4UFGH 3ATIA 3PO1B 1GCDA 4JZIA 2ANKH 1KXCA 1ZR0A 1P8VC 4I8HA 5CMXH 1HXFH 4TWWA 4YLUA 3LH1A 1RFNA 4ZAEB 1O31A 2FO9A 8KME2 3S69A 3TH3H 2XC5L 2AMQA 1KDQB 1FAKL 3TNTA 4ZKRU 4JZDH 1BMAA 1V2PT 2VINA 3SU2A 1TPGA 2RG3A 5EXNA 3U8RH 1XUHA 5IKVA 3IG6B 3SJIA 1SLUB 4MVNA 4OTJA 4FUCA 4INKA 2OBQA 3ENSA 1C1NA 2UUJB 2STAE 2PHBA 1TNHA 1BTPA 2TGFA 4Y0ZE 1Y3YA 1IQGL 4ZKNU 3P8FA 4B76A 1UVUH 1O5EH 4CUEA 1F7ZA 2RNLA 1RGQA 4JCNA 1TNJA 1GHBG 5T6DA 3TZIA 4FUGA 1GHAF 2HWLB 1O39A 2WYGA 1HJ8A 1NFXA 1C2FA 1NRPH 2GX4A 1DICA 2MHPA 3MNSA 4FUFA 3CFWA 1A0JA 2R0LA 3N8YA 1QGFA 3HKIB 1EAXA 1GVKB 1TBZH 1BTHH 3OLUA 2M74A 2P59A 2R2MB 4KELA 4IN1A 1FQ3A 2G55A 3BEIB 2ALVA 1L2EA 1CGJE 3PWCA 3QTVH 1JBUL 2ZU1A 4CHAB 3ZZ3A 3Q7DA 4TPYA 3MO6A 5EQQA 1YLDA 4MG3A 3RP2A 1BF9A 3M5OA 1FY8E 2XC0A 3UWJH 2GV7A 3MU8A 1QRXA 3JZ1B 1EAIA 1KXAA 2J94A 4UE7H 4X2XA 3SV9A 5IKTA 3SQHE 4JZFL 2P95A 4H6TA 3PMAB 1C1TA 1P03A 4BANB 2A4GA 5CKNA 1P2OA 1D3DB 1LQDB 4WMFA 1W7XL 3T27A 1VCPA 1L4DA 1OWDA 3HK3B 2P3FH 1IHTH 1J9CL 2KV4A 1DVAH 4KP0A 4E06H 3BTQE 4ZMAH 1C4Y2 1UTMA 4DW2U 1DFPA 1EQHA 2FLBL 4BTTA 2G4UA 2F9PA 4MQAA 3B8JA 1GG6C 4ZKSU 2GDDA 3GDSA 2TBSA 3S7KB 1CHOG 1IQMA 2QY0B 3V7TA 3E6PH 1BA8B 3M37A 1C2MA 4X8TH 4Y7BA 5DPAA 6CHAB 3RMOH 5EQSA 1B9WA 3R05A 1NZQH 2F9BH 2QYIA 2XC0L 1EMOA 3VB3A 4NA8A 4AOQA 1P9UA 3BTHE 1T4VH 3P6ZB 1GBBA 2GCHF 1F0UA 4IBLH 2P95L 5T6FA 1UCYH 1PQ5A 1O2NA 1EP5A 2WPKS 1WAYB 3SZNA 1OS8A 1UZPA 1RS0A 3A88A 3BTME 2BX4A 1BJVA 4CH8B 1SVPA 3PLPA 2VGCC 5DG6A 2BO2A 1O0DH 4NA9H 5B6OA 1RIWB 3PB1E 1ZRBA 1GJ9B 3SW2B 2A4RA 3SV6A 1SGFA 2Y5HA 3A83A 4RKOB 1C2JA 1V2TT 1QFKL 1GJ4H 1K1JA 3TK5B 2J95A 1TGTA 3STJA 3SU6A 1IQML 2XTTB 2PR3B 1C1VH 3M37L 1TQ0B 3NT1A 3NXPA 4GCHF 4Q7YA 2NU4E 1LKAA 9ESTA 1GHZA 4NA7A 5BRRE 1CGIE 1C5MF 2Y5GA 4DJZB 1GBKA 1YF4A 4JYVH 1ZGVA 4RRWA 2DE9A 3VPKA 1V6DA 1G2LA 1FONA 4Q7XA 1XUFA 5COXA 1V3XB 4I32A 1D6WA 3LT3A 1KLJH 4NCYA 1XUGA 1C1PA 1TRNA 2QF3A 1J8AA 4H4FA 1P2IA 4ISHL 1W10U 5HYOA 3QUMP 1ETSH 3SU0A 3MU1A 1NFYA 3HGNA 5GCHG 1GI3A 4MMYB 3TJOA 1SGFG 5JBCS 1ABIH 2ZDKA 1G1QA 1SGNE 3BEUA 5GJ4B 4CR9A 1LPGB 1SI5H 5DGJA 4LK4A 1C1WH 3M7UA 3V12A 5C20A 1S6HA 2BQ7B 2Y5HL 3LJJA 2WUCA 1P12E 2ZFPH 1KXBA 5F8ZA 2WYJB 3RXVA 1GBLA 2O8UA 2P3FN 2PGBB 3O8RA 3VB4A 2B7DL 3A8DA 5K7RA 2W2NE 5TJXA 2Y5GL 4BTIB 2GV6A 1QQUA 5A8ZA 3BF6H 2BTCE 5I46H 1PPBH 4INLA 4O02B 2R9PA 3DT0H 3S9AA 1SOZA 3A7TA 3ZYEA 2NWNA 2PKSB 1X7AL 2Y7XA 3A82A 1XUJA 1EXFA 3PROA 3RXCA 5GXPA 2J2UB 4MPVA 3C1KA 2ESTE 5C67A 4CUFA 1CBWB 3QH0A 2UUYA 3DUXH 4NZQA 5EG4A 3K65B 2BZAA 3LJOA 1F0RB 3Q3KA 3RUOA 1LDTT 5FBIA 3UFAA 2D2DA 3LIWA 4AX9H 1P2NA 3RXRA 1GJ5H 2CHAC 2ZGJA 2VNTA 1GHXH 1V2WT 3M3TA 3PGHA 1GMCG 4BTUA 5DP3A 4COXA 2BQ6B 1DDXA 2GZ9A 2Y80B 4U01A 3MWIU 2BZ6H 2NU2E 5GPIB 2QC2A 1TALA 3VGCC 3BIVH 1NFWB 3FVFB 4JYTA 2FP7B 4X8UL 2WPME 1N8OB 3HO5A 5I25A 2ZHQH 4FU9A 3N8WA 3MI4A 4XBCA 1KY9A 2BY5X 2FLGA 2GDEH 3KEEA 2QXHA 1GBIA 3QO6A 4CRDA 1O33A 3CP7A 1O38A 1Q3XA 5GWZA 4ZROA 5EGMA 1BCUH 1LHGH 3U1IB 4U30A 3RU4D 3A86A 1HFDA 1NN6A 2I6QA 1N6YA 3BPSE 4ABGA 3CENA 4YT7L 1O2TA 1HNEE 2FYRA 1G9IE 2ZTZA 2WPJE 1GJ7B 1O2HA 2AS9A 5E0HA 4UFEH 4XSKU 3MDLA 5KN5C 3QK1A 1RTFB 2J92A 3HO3A 4OS7A 2NU0E 3G01A 1HIAB 3STIA 1C5WB 1IQFL 1TX7A 2W3KA 5TCAA 1KIGL 4KTSA 4KGAA 5EOKA 1XFEA 1JIRA 4CREA 1TGBA 4MPXA 2VU8E 1K9OE 2ALPA 3IITB 1AZZA 3ZYDA 2VVUA 5JBBE 2A1DB 4GAWA 4CRCA 1SGYE 4NFEA 1G32B 4K3JA 1KLOA 3K6YA 4DG4A 3FP8E 1DX5I 2A5AA 1TFXA 1W7GH 4DT7B 2P16A 3POYA 3SI3H 1GJAB 3SUEA 2PSXA 3ZZ5A 1NFUA 3M3VA 2EI7B 1YGCL 1BRCE 2QGRA 3MYWA 1HPGA 1MTVA 1FJSA 4LORA 1F0SB 5IKRA 4TY6A 1HREA 1GI5A 1UVOA 1F7EA 3L33A 3CENL 4B75A 3RMMH 3DFJA 3C27B 3KQEA 1ZYOA 1AKSA 2Q1JB 2OC7A 1JBUH 1THSH 1Y3WA 2OINA 1GBTA 4Z0KA 4AFZA 1D9IA 1N1LA 3SQEE 2LNCA 1GG6B 1TRMA 3HS6A 2AERH 1AUJA 1O2QA 2BX3A 1K36A 2J4IA 2J9NA 2ZA5A 2WPIE 2W7SA 4ASHA 1UHBA 2VVUL 4JZFH 1QHRB 2SNVA 1P57B 3ASIA 1SFQB 3RDZA 1O2GH 4ABBA 3PWBA 3BTGE 3RMLH 2P16L 1ELEE 1W7XH 2RA3A 4O03A 1HB0B 1MD7A 3CS0A 2A5KA 1GJCB 1QBOA 1J9CH 2VIDA 1DX5M 3I78A 5A0BA 1ID5H 5A09A 4MNXA 3S7HB 4MMXB 1EJNA 2ODYB 2XRCA 3PV4A 4U32A 4XBBA 1FJSL 1MTUA 3S9BA 3KQBA 4I33A 2NU1E 1HCGB 2GMTC 5AVDA 1T8MA 4Z6AH 3RLWH 1C5VA 5L30L 3HPTB 3SGBE 1TRYA 1ATDA 3KQEL 3GY2A 4A5TS 2BOHB 1SGRE 4CRBA 1PFXL 5F8XA 4WMDA 3P17H 3SNCA 4D0EA 1AIXH 1HGTH 2HLCA 1FPCH 2F9VA 2VH0B 2SGQE 4RSPA 1P0SL 3ELAL 2GT8A 1EBVA 2W3IB 1OWEA 1KXFA 3MH6A 1VITG 1C2IA 1MH0A 1SHYA 1UTJA 4E05H 2ZFFH 3P5BL 2FOCA 4X8TL 1G1SA 1C5NH 7ESTE 1W13U 1TGSZ 4DY7B 1V2LT 5FPTA 3GY3A 1CVUA 1ZMLA 3LH3A 1CA0C 2F9BL 2KAIA 3DEMA 1EJAA 4BDXA 3P8GA 1C5TA 3GISX 1QFKH 5A8YA 1BB0B 3KQBL 1T8NA 1SMFE 2P94A 3JZ2B 1EAWA 3RXDA 4Y76B 2GZ7A 3S0NA 1HAEA 1LMJA 1AFEH 4HFPB 2EEKA 2Y82A 1SGIB 4CRAA 5JBAE 4BNRA 3TK6B 2ZO3H 4ZXXH 1TOMH 1HT8A 3SOVA 1BOQA 3TH2H 1IHSH 4NIVA 1EPTC 2AFQB 2OD3B 2ZPSA 3SU4A 3BTDE 2FMJA 1ELCA 4NGAL 3QDZB 1FY1A 4X1SU 1L0ZA 1MZAA 1C1OA 1S5SA 2AEIH 1CGHA 2ZTXA 1VJAU 4ISHH 1P9JA 2ZU3A 3A81A 1ARCA 1WHFA 1EPTA 1Y59T 2VH6A 1FZZA 2PV9B 1JRSA 3Q3XA 4XLWA 2THFB 5JYIA 2PKAB 4BXWA 1BTYA 1XVOA 1TAWA 2ZDVH 3Q3KB 2ZEBA 1OKXA 1FF7A 2DDUA 4JYVL 2C8XB 4ISNA 4TWYA 3FZDA 2BD7A 4ZH8B 1T4UH 2P3TA 2H6MA 5A0AE 2P94L 3SHAH 1UCYK 2PSYA 3D49H 1W12U 8LPRA 1UCYE 1ANBA 3GOVB 2IPHA 3OX7U 5CHAC 2B7DH 1HAFA 1WQVH 2QXJA 1HDTH 1LVOA 5JPMH 2BD8A 4I8JA 3ODDA 4SGAE 4UFFH 1B0EA 2I9BA 3A7XA 1O2RA 2BD4A 1AVGH 2P3UA 4FVBA 4WH6A 1OOKB 4UEHH 1GBCA 1O32A 4DOQA 2Z9LA 1MQ6A 3VGCB 1UK4A 5JVYA 1BHXB 4X6MA 2ZTYA 5LPFA 3F6UL 5E8EH 1U67A 2XWBI 2OQUA 1WU1B 1ZJKA 3D23A 2J38B 3BT1A 1A4WH 1FDPA 2EI6B 1QCPA 3GY6A 1J16A 3H5CB 1VJ9U 3T5FH 2FD6A 1L1GA 2GZ8A 1IVOC 5JVZA 2XC4A 4K60A 3ZVCA 2C8ZB 2UWOA 4XDEA 1PQAA 1TNKA 2B0FA 3MH5A 1TA2A 2ZFTA 1PTHA 1PPHE 4OTYA 1K21H 3ZV9A 2QAAA 4IMZA 1GL0E 1NC6A 1C2DA 3MH4A 3SORA 5C2ZA 1CU1A 5L2ZL 1U6QA 2A2XH 1YCPH 4X8UH 1NRQH 2UWLA 1OP8A 1IQNL 1UK3A 3ZYIB 1GGDB 2ZCHP 3SOBB 4K69A 3KF2A 1PPCE 1AD8H 1SGEE 3MOCA 3ZVAA 2F9NA 2AGGX 4FUBA 3B9FH 1TGCA 1K37A 1MQ6L 3SU3A 3KQCA 1LPKA 2FLRL 5CKQA 1NRRH 1XKBC 3SV8A 3RXOA 1C5MD 5TCCA 2O8TA 2ASUB 1GHVH 1WOFA 2FIRH 4YT7H 1KTSB 1I0UA 5DP9A 3SOSA 2FX6A 3MU5A 3UNRA 3OTJE 2HOBA 3HO4A 1IQGA 1TABE 3PMBB 1CE5A 2FOHA 1E0FD 1T32A 3GCTG 1XKBA 1K2I1 2A7JA 2XC4L 3T26A 1IQKA 1P01A 4AG2A 3E91A 3HKJB 1ELDE 1V2VT 1BHXF 5EU8A 2EI8A 3TH4H 3MFJA 1KIGH 5L6NH 2D1JB 2Z9KA 2TRMA 1EPIA 2FESH 4Y7AB 2Q6DA 4WJG2 3GCWE 4H6SB 1FSBA 3SGAE 5A2MH 4YZUB 2VVVA 1NU9A 3L6PA 3F9HA 1AFQB 1EMNA 2AYLA 1C1QA 4UFDH 1O2IA 4M11A 4D8NA 1EPGA 1IQEA 1SZBA 4A92A 3EDXB 1YGCH 1C5ZB 1ANDA 3ATMA 1FXYA 3KQCL 2OYUP 4YOJA 1G1TA 1EB1H 2CJIA 1QJ7B 1DSUA 3LC3A 5DP6A 3RMNH 3A7YA 2PW8H 4Y79A 5C3NA 3TGJE 5EW1H 1EKBB 1QL7A 4NWKA 3U69H 1AMHA 1TWXB 1IQKL 4DGJA 2J34A 1H8IH 4AFSA 1SGCA 1O2UA 1IJQA 1NESE 1NPMA 1P9SA 5C5OA 2GMTB 1G1RA 2A7CA 2SGDE 1Z6CA 1MBQA 1YPGH 5F8TA 4O9VA 4X2WA 1HAVB 1QA0A 1O3CA 3MTYA 1EQGA 1UTKA 1C2LA 2WPLE 1AWFH 1VCQA 1MD8A 4FVDA 3RXSA 4AFUA 3ZZ8A 4AG1A 2VVVL 1SQOA 5K0HB 1LO6A 1EAIC 4FUDA 1CHGA 1LQEA 3NCLA 5J4SA 2FX4A 1DQBA 3KL6A 1A2CH 3QZRA 4AN7A 1SB1H 4Y6DB 1IQEL 3QX5H 2B9LA 1APQA 2Y38A 1ARBA 3E1XB 4FXGH 2JH0D 4F4OC 4YM9A 1RD3B 1FN6A 2O8MA 5L30H 1FE2A 1OB1C 3RXIA 1D6RA 1XKAC 1IQLA 3RXPA 1D4PB 2P28B 1CA0B 3KQDA 1SLVB 3VB5A 4RKJB 1YPLH 4MNYA 2BY6X 3P92A 3UR6A 2ZQ1A 4CRFA 4I31A 1PPFE 1ZHMA 1LHCH 5H4IB 2HALA 2I9AA 2AYWA 4CSYA 1MTNC 3RM2H 8GCHF 1P0SH 3ELAH 1HJ9A 1TPOA 3EA7A 5FDQA 1Y5AT 3TBDA 4Z6AL 1LHDH 3CS7A 1VGCB 4BAKB 3EGFA 3H7TA 3P95A 1U8CB 1AWHB 1VR1H 3T28A 2GCTC 4Y8ZA 3DA9B 1VITH 3MU0A 4X2YA 5FAHA 1O3PB 2OXSA 1RRKA 5EW2H 1O5DH 1S6FA 1CCFA 1CO7E 2QV1A 1J15A 1G30B 2BY7X 1PYTC 1V2NT 2P3TB 4YTAA 4ISLA 1ZPBA 2V0BA 7GCHF 3N7OA 3LGIA 1IQLL 2RA0A 2OC0A 3KQDL 1K1OA 2V6NA 5HMAA 3RXUA 3GY8A 4Y71A 3RC6A 1PJPA 1C5SA 1DLKB
chains in the Genus database with same CATH superfamily
1XKAL 1HV7A 5EPYA 1V2MT 1BMNH 1NBMD 4XBMA 2C90B 2BVRH 1SC8U 4NGAH 3V13A 2BSFA 2ODPA 1YUGA 4OS6A 5CHAB 1DXPA 5EQRA 2M5TA 3CS7L 2W26B 2FOMB 5E8DA 2BOXA 4IN2A 4X1NU 1BRBE 3ODFA 2ZQ2A 4AGKA 2K2SB 3SI4H 3TNSA 3O8DA 1X7AC 3NKKA 2RCEA 3AVZA 4D9RA 2FI3E 2BY9X 4ZXXL 1GI6A 3ZZDA 2KCPA 4FUEA 1JRTA 3UNSA 4ABHA 1C5RA 2KB9A 3AAUA 4A7IA 1EGFA 3AASA 5EJ1A 5FCKA 3VXFH 1QB6A 2WFXB 4ZHAB 2BD5A 2EA3A 2VWOA 5JB9S 3AK5A 2BOUA 1M1XB 3KYGA 5DP7A 2XWAA 5PTPA 1BMMH 3N8XA 1WTGH 1JV2B 2BMGA 2H2ZA 3UR9A 2ZU5A 2RA0L 2ZC9H 1QNJA 1KXEA 2QF5A 1UZJA 2GD4A 1ZHRA 2QA9E 3NWUA 4E7NA 2BD2A 4GSOA 2B8OH 2L74A 3LKWA 3SOQA 1SPJA 2G5NA 1P06A 3V65B 1HRFA 1BQYA 2L6OA 3Q3YA 4G1MB 1P2QA 2ZDNA 1YUKB 2Q6FA 1A1RA 3U8OH 1GJ6A 3NK8A 1T7CA 3QWCH 4X8SH 1HXEH 5IKQA 4C16A 1AY6H 1YBWA 3F6UH 3MNBA 4X6NA 2GT7A 3TJUA 3PLBA 4AB8A 1TA6A 5DKMA 1KTTB 4INHA 1ZPZA 1G2MA 1V2ST 1YM0A 2F83A 5JW1A 2FOBA 4CH2B 1G3CA 1NT0A 1ELTA 1GMHG 1SLWB 3OYPA 6LPRA 1NO9H 1KSNA 1EX3A 1LCYA 1W0YH 4LOYH 1EUFA 3PTBA 3LC5A 5HXFA 4RRYA 1A3PA 3A87A 1F5KU 5DJ7A 1TONA 1CQQA 5F6MA 1EJMA 4P02A 3BTWE 5E0JA 1EZQB 3RU4T 2VWOL 3EA8A 1FX0B 3KRKA 3UUZA 2JH6D 1XUIA 1BJUA 1DDJA 5JB8E 4OS2A 5C1UA 2WFTA 1O2VA 3FBYA 1O3BA 1UMAH 1S82A 1FMGA 2QIQA 5L2ZH 4ISIL 1HAGE 1A3EH 2I6SA 2WV4A 2ZHFH 1O2LA 5HM2A 1LK9A 5FBEA 1RFNB 1LPZA 3GCHC 4I8KA 5T1VA 4THNH 1ETRH 3IWMA 1IQFA 2FLRH 1O3GA 4ACBA 4LZ1H 4E1GA 1HAOH 1A0LA 1TIOA 4ABFA 2XCFA 1IAUA 1DOJA 2Z9GA 3LDXH 2HLDD 3SV7A 2EQNA 3ENSB 2PHBB 3D65E 4X1RU 2MGPA 1TPAE 3DHKH 1P3CA 1S85A 3EA9A 4WVPE 4ABIA 3TVJB 1HUTH 1Q31A 1TX6A 1O3IA 3SHCH 4Y0YE 3V0XA 3FCSB 2WYGB 3KIDU 4UDWH 1NFXB 2SNWA 1SHHB 4ISOA 1KXDA 2BD9A 4ABJA 2H5DA 3N8YB 1EQ9A 1SLXB 3UTUH 1BRAA 2H1UA 1S84A 2Z3CA 1E35B 1XXDA 4ZXYL 1C2GA 2ADXA 1ZLRA 1MKXK 4B1TA 4K2YA 2P93A 3QLPH 2XXLA 3O8BA 2HORA 5HIYA 1FY3A 2FI5E 4MLFB 1THPB 3TU7H 1J17T 1AE8H 1XMNB 1ZHPA 2BLVA 2LP6A 1V2QT 3LGYA 6GCHG 3E90B 3W94A 3SNAA 1T31A 3P8OA 4O1ZA 3PM3A 2WV5A 3A8CA 1F5LA 1GHBF 3KN2A 4IC6A 1DM4B 1JMOH 3NPSA 1YCPK 3TLOA 1MUEB 2J94B 3U98H 2JH5D 1E36B 1M9UA 5FCRA 2FPZA 2BQWA 1A3BH 1B7XB 2BB4A 2OC1A 3RXFA 1K1MA 2ZU4A 4NIWA 1ZGIA 3KHVA 5FX6A 4HI3A 2FOAA 5C1YA 4B6FA 1L5GB 1WTHD 1PFXC 2Y7ZA 1HRTH 2R3YA 4YOIA 4Y8XA 3ZZBA 4BTTB 4BDWA 3PRBA 1QZ8A 2Y5FA 1LKBA 3K9XA 1ZPCA 2P93L 1D3QB 3K6ZA 1IQIA 3OEED 2F3CE 4Y7BB 1GPZA 2ODQA 3F9FA 3M36A 1ANCA 2LPRA 2VB0A 4HTCH 2WZQA 4K1SA 2G52A 4CRGA 3LGVA 1TNIA 3KCGL 1GBDA 2IOTA 2Y81A 1THRH 2V3HH 4OS4A 4NG9H 2BDHA 5C5NA 4B71A 5HGGA 5EXLA 2WPHE 1K28D 1ATBA 3FKSD 1ACBE 2KFWA 1GI7B 1YPEH 1Q2WA 1ZJDA 3M61U 4B74A 4K1EA 1DUAA 3A8AA 4NIYA 1QJ6B 5CKMA 1O5GH 2ZFQH 4AGJA 6ESTA 4DT4A 5C1XA 1CHOF 1DT2A 3BG4C 1FPHH 4IGDA 1DWDH 2UWPA 2FOFA 4X2VA 3M7TA 1A0HB 1SQAA 1TPSA 2JIZD 2JETC 3LGUA 1KLIL 1UZKA 2Y5FL 4DIIH 1GHAG 2J95B 1ESTA 4VGCC 3MO9A 3N8VA 4WH8A 3RXBA 1BBRK 2VGCB 1KDQA 2B5TB 2Z94A 4Z0LA 1O3AA 1IQIL 1BBRE 1TBRH 1ELFA 3ESTA 2BD3A 3TPIZ 3M36L 3LN0A 2ZZUH 1V2RT 3HGPA 4U2WA 3E8LA 1SL3A 1DANH 1T8OA 4Q63A 3LAQA 5KEDA 2Z9IA 3Q77A 3SJKA 3QMOA 4LXBH 2KCYA 4H42U 4M7GA 1G2LB 2G00A 1P3EA 1BT7A 5E2OA 1WXRA 3BEFB 2FOGA 1QIXB 1KYNA 2BDGA 3GDUA 3RXJA 1JIMA 1GBAA 2CF9H 1YO8A 1ZSJA 3OSYA 3M5NA 2A4QA 1NFYB 4IMQA 1FIWA 2GD4B 3ATKA 1DSTA 1FAXA 1O30A 2VIWA 3AAVA 3PMJA 1O5DL 2OUAA 1BZXE 3ZZ9A 1TMUH 1E38B 1Y5BT 3MU4A 1GI2A 1WBGB 4CHAC 1BIOA 4X1QU 1HT5A 1GBFA 3GCXE 2SFAA 1FLEE 4AZ2B 2KM0A 2AIPA 5DO4H 3P70B 3R3GB 9LPRA 3HATH 1GWAA 1PQ7A 4NSYA 3LONA 4D7GA 5HM9A 1GBHA 3RXLA 1DS2E 1A5GH 2F9UA 1H1BA 1EZSC 5GCHF 1OHHD 2WPMS 1ELBA 2G00L 3KNXA 1ZMJA 2Y7XB 1GK5A 1TQ7B 1O2MA 4OGYA 1K1NA 2FS8A 4O3UA 3BTKE 6COXA 1O5AB 2AGEX 3S9CA 1GI4A 3I77A 1LQDA 2ZCKP 3SBKA 3U1JB 1V2UT 4BAOB 2GCHG 1FAXL 3BN9A 4IW4E 3ATLA 2O8LA 3VB7A 3BV9B 1YPHE 1YWUA 1QB1A 4FU8A 3LIWB 3LU9B 3B23B 6CHAC 3TGKE 2ZGBH 1Z8IB 2UUFB 1HJ7A 2ZPRA 3ZV8A 3C9AC 2WV9A 3UAIC 1IQJA 2ANYA 2BDIA 1FN8A 1E37B 4RT0A 4TPIZ 2W2QE 1NT1A 3NTBA 2BVSH 1AZ8A 2CF8H 3SGQE 4GPGA 4BTUB 2XBWA 1PPEE 3SU5A 1C5LH 3DD2H 2CHAB 2AIQA 1MU8B 2PTCE 1UZQA 3GCHB 3QTOH 2VIPA 3M35A 3SJOA 1IQNA 4O3TA 1WQSA 3ZVBA 1EAUA 1MCTA 4R8TB 5JBBS 3RXEA 1YKTA 1ZTLA 1TGNA 3SV2H 4Y11E 4GCHG 1XVMA 3N8WB 2YGQA 4ASUD 2ZPQA 3MO3A 3EYDA 1AGJA 2VVCA 4YO9A 1TMTH 1TX8A 1HAIH 4X8SL 1NY22 1C4U2 3HS5A 5EGMB 4ISIH 2TGPZ 1OWJA 3NUMA 4Q2KA 2ZGHA 2V3MA 1AUTL 1GMCF 1A7SA 1SG8B 4MTBA 1MKXH 3SW2A 1GI1A 4XRNA 4WWYA 1S0RA 1Y3VA 3TK5A 2D8WA 2FS9A 4AYVB 4JYUL 2PR3A 1IQJL 3A85A 4UD9H 2K2TA 2W3KB 4RUTA 1NQLB 4TYDA 2XBWL 1KLTA 3SN8A 1UTOA 1H4WA 2GKVE 2Z7FE 2ZNKH 3DSPA 1TOZA 2ZWLH 3VEQB 3T25A 1C5QA 2RHPA 1O2XA 1AI8H 1Z6EA 2BDYA 3LGTA 1W0ZU 2ZDLA 1CT4E 1V3XA 1P09A 2UUKB 1FUJA 3ZZAA 2VIVA 3LOXA 2CN0H 2WPKE 1D3TB 3DFLA 2NU3E 4BAHB 1AU8A 1MCVA 3SNDA 1NFUB 4GHQA 1F7MA 4GHTA 3QGNB 4KTCA 4ZXYH 1LPGA 5F19A 2HNTC 1GDNA 2YNBA 1QIUA 5E2PA 2BQ7A 4B73A 3QN7A 2ZDAH 1AKSB 1YP9A 1W3CA 4Z0KB 5F03A 1AB9C 2DUCA 1J14A 1P05A 2WYJA 4A6LA 3QCWA 5ABWA 5ESTE 2PKSC 1BRUP 2V3OH 4WMEA 3Q76A 1FY5A 2J4IB 1IOEL 3A89A 2VJ3A 2BOKL 3DCLA 4BTIA 4LZ4B 3U73A 3T62A 1ATAA 2CGAA 4X0WU 2SGPE 1UHBB 1CBWC 1GJ8B 3U9AH 2ZI2H 2HRVA 4I8LA 2WG3C 1Z6EL 3A8BA 5JB9E 3U28C 2Z3DA 1HJAC 4D0FA 1E1RD 2A4OA 1CT0E 3FP7E 4AORA 1P2MA 2J2UA 2VVCK 1PQ8A 4CUDA 1DXWA 4OGXA 2H9TH 3BTFE 3T2NA 3RC5A 5JBCE 1Z1JA 2OBOA 1F0RA 1GCTC 2UWPB 2STBE 1C9PA 4CBOA 1O2KA 1DY9A 3BG4B 7KMEH 1BBRH 2XCNA 1CX2A 1K1LA 2JKHA 3GY7A 1N8OC 3DSGA 3KCGH 5GIBA 1KMHB 1Z1IA 2JETB 1TLEA 3U7UG 2R3UA 3FAOA 3T29A 2BQ6A 1O2OA 5JBAS 3F9GA 4TY7A 2Y80A 1OWKA 4VGCB 2YMSB 2V35A 4JZEL 3W95A 1IQHA 1NFWA 1MAXA 4BOHA 1UK2A 5AF9H 3RXHA 1P04A 2IJOB 1L3YA 3GCNA 1G3DA 1ELAA 2FXRA 3OTPA 1O2SA 4ABAA 3HK6B 1ZRKA 1O3MA 5B6LA 3H09A 1FFMA 1QJ1B 1DUEA 1GL1A 5EPNA 5DSFA 2BLQA 4X6OA 4MNWA 2XOKD 4YESB 1NZIA 1Q4GA 3UQOA 1VZQH 1C1MA 4PH9A 2IPQX 2KAIB 2Z6BD 1SGDE 1UTNA 2HPQH 3PTNA 4NG9L 3UIRA 1KLIH 5LPEA 1OXGA 2PGQB 2ZHWH 3EQ0H 3UNQA 1QURH 4Y8YA 4IS5A 1W8BL 1HIAA 4I7YH 2HVYB 1O3OA 2Y82B 1VITF 2JKHL 1RJXB 1W11U 1ADXA 1G36A 2R0KA 3GYLB 1UO6A 3OY6U 3TK9A 2HVXA 2HNTE 5IDKA 3IITA 4A1VA 3E0PB 3H7OA 3V3MA 1IQHL 1TLDA 1AE5A 2BDCA 3ZYJB 1UJ1A 4AYYB 1EZXC 1EB2A 3UY9A 1Y3UA 3UREA 2R2WU 1OWIA 2VH6B 1EPTB 3BTEE 1AQ7A 3R0FA 5JDUB 3TJVA 1ELVA 3UWIA 1YPKH 2HPPH 2ZGXH 1C1UH 4K1TA 2EI7A 5CHBA 1DWEH 5HIZA 1Y8TA 1HAPH 1F0SA 3QZQA 2ZU2A 2FEQH 3SJ9A 2K8IA 2ANWA 1O2YA 8ESTE 3RXGA 1CSOE 1O34A 2Q1JA 3RXAA 1UTQA 1IP0A 1GBEA 2F43B 1BTXA 3Q00A 2XBYA 1S6LA 3F9EA 3SUFA 4X8VL 4ABDA 1ESAA 2GP9B 4WXVA 1GJDB 1NS3A 1O3JA 5LGOA 3PV2A 3A7ZA 2P3UB 1TMBH 1NBME 4D90A 1QR3E 1Z71A 2GTBA 3RXMA 1OPHB 1GDUA 4ESTE 4MPUA 1CVWH 2F9OA 2XBXA 2RFKC 1C5UA 2C8WB 2P8OC 2FTLE 1F5RA 5FX5A 3BT2A 5C94A 2ZHDA 3RC4A 2JJ1D 1MBMA 1P10A 3TJNA 1GBMA 2BXUH 4A1XA 1HCGA 1TOCB 2QN5T 3GYMA 1YLCA 2A45B 3MNCA 2UWOB 1GI0A 3HPTA 3PYHA 2YGOA 1A5HA 2BM2A 4FETA 1IGZA 2BOHA 1MKWH 2PTNA 3TIUA 1UVSH 5L2YL 3OU0A 1C2HA 1K1PA 2TIOA 4RS0A 1MZDA 4FUIA 1ZZZA 4JMYA 5DP8A 1OP0A 3N7EA 2XBYL 4FUJA 4XFQA 2UWLB 2VH0A 4NSVA 3CA7A 3RR3A 2W3IA 1PRHA 1HLTH 4MDSA 1WSSH 1BDAA 1ZAQA 1RTKA 3SUDA 1Y5UT 2D26C 1O3HA 1ORFA 1MTWA 1FV9A 2W7UA 3RXQA 2XBXL 2A2QH 4F49A 5ESBA 1LPKB 4YT6L 3SZEA 1XX9A 2AMPA 3F1SB 3K2UA 3SNEA 2A32A 3I29A 3FANA 3ZVGA 4AQTA 3P8NA 2W5EA 1S0QA 5T6GA 1C5YB 2GJGA 3KK6A 2G8TA 4NIXA 2O9QA 2Y6TA 1DE7H 1NRNH 4J1YA 2KCAA 1F2SE 2H9EL 5KIRA 1WYKA 3VB6A 4JYUH 1NU7B 4YXWD 1D3PB 1GJBB 4Y76A 1HZ8A 1NRSH 2EI8B 2C4FH 3A7WA 1L1JA 4ZUHA 2SGAA 1XDTR 3AW0A 4IC5A 3TITA 3TK6A 2EC9H 2BDBA 3ZVFA 5FPSA 1CA8B 2OCVB 4K8BA 5SGAE 1BMLA 1F0TA 1O5BB 1AB9B 2ZIQH 3M3SA 2WPLS 4Q4LA 2W2OE 3FOAA 1GVLA 1EOLA 1O35A 4MNVA 4DCDA 3TGIE 1UTPA 4NWLA 3IJEB 1DPOA 3RXTA 1BTWA 4RRZA 1O3KA 4ZHLU 5A0CA 4TT3D 4X1PU 2W2PE 1HAHH 4A1TA 3GCTF 5LH8A 1QA7A 1A5IA 1O2WA 1V2JT 1PYTD 2Z3EA 4CR5A 3M5MA 1HAYB 2J97A 1NPEB 1JWTA 2VIOA 3ZVDA 2PKAA 4J2YB 4XL1A 4KTUA 1O3DA 3OY5U 2GGVB 4P00A 5A8XA 4GU4A 2CJIB 1HJAB 3LC3B 5DP5A 2AMDA 1YPMH 3MNXA 1P11E 1Y3XA 3GICB 1Z7KA 1ZTJA 4Y79B 3ZZCA 1JXPA 1SFIA 4ZH8A 3UPEA 3NRLA 1LMWB 2AH4X 1O5CB 2PLXA 2J34B 1YYY1 1GCTB 1HYLA 1AVXA 4JK6A 4NZLA 5LPRA 1BITA 2BY8X 4D7FA 2KL7A 1ESBA 1H9IE 1L4ZA 3F0PA 4JK5A 4K8YA 5GDSH 2FZZA 3LTFB 2G5VA 2BT8A 3RU4E 2J5UA 3EAJA 1XUKA 2OC8A 1FIZA 1ZMNA 2A7HA 2C8YB 3EGKH 1Z8GA 2WG4B 4B2BA 1CEJA 3URDA 1MAYA 1GBJA 4K5ZA 4ZKOU 1O3LA 3WW7A 1A46H 1DWBH 5CDFE 3KL6B 1SOTA 1BMFD 4BXSA 1C2EA 1SGPE 1WU1A 1ZSLA 2HNTF 3RM0H 2J38A 1URKA 1JL9A 1WV7H 2EI6A 2XNIA 1LVYA 1HBTH 1SQTA 2BLOA 1IOXA 2PUQL 3V64C 1DLEA 3FZZA 1ELGA 1F92A 1V2KT 2V7QD 2IJD1 2PFEA 1Z8RA 4WF8A 1PXXA 4QT8C 4D76A 1FAKH 1DIYA 1MABB 1PGEA 2Q6GA 3F0OA 4GVUA 1BTZA 2TGDA 1ZOMA 5EODA 1W14U 2XYAA 1MQ5A 3UOUA 4Q7ZA 1GGDC 2G51A 3GDVA 7LPRA 1QBVH 4JZEH 1XM1A 3W1EA 2TGTA 1O2JA 4SGBE 3SUGA 3RLYH 1GMDG 2FZZL 2ZHEH 3BSQA 5J4QA 1MTNB 3BIUH 2O8WA 4D9QA 3TH3L 5CISA 2WINI 4AB9A 1H8HD 2RDLA 2C3SA 4JZDL 1DWCH 1NM6A 4M10A 3E16B 4YLQH 3GISB 3GY5A 1XXFA 2VJ1A 2GCTB 1K1IA 1TNGA 2BYAX 4FM5A 3OLTA 2W6JD 3PO1C 1EPJA 1C4V2 1IGXA 5G4BA 5E0GA 1P2KA 1YPHC 2GVFA 2QCYA 2XW9A 4BAMB 1PPZA 2TPIZ 3M5LA 1E34B 3A80A 4HGCA 1W8BH 1BTUA 2LELA 1OYTH 2H9HA 2OYEP 1P2JA 1UTLM 1Z8JB 2P26A 4DVAU 2D1JA 1TBQH 1H9LB 3SJ8A 1YUFA 4Y71B 1MQ5L 1AFQC 1FI8A 1QB9A 1C9TA 4I8GA 4Y7AA 2IN2A 4CBNA 2OTVA 4MPWA 2CXVA 3MQEA 2YOLA 1WUNH 1AHTH 2K1QA 4OS5A 4YZUA 1B5GH 1MOXC 4ZAEA 3FP6E 2F91A 4UONA 3WY8A 1MMJN 1N1IA 2ZCLP 3BG8A 3MHWU 3GS9A 5DP4A 2ZP0H 3F68H 1H8DH 1N6XA 4KKDA 1JOUB 2ANMH 4XE4A 1B0FA 1EOJA 1QRWA 4DURA 1COWD 2FLBH 1SGQE 1ABJH 3LN1A 2P8OB 1FY4A 2MGRA 1L1NA 3E0NB 2VWNA 4A7IB 2H5CA 4B6EA 1QY6A 5AFZH 1HX2A 3LTGD 3PMHB 1ANEA 1V1IA 1QRZA 2QXIA 1RXPA 1O36A 1O2PA 3HS7A 1QBNA 1VCWA 3VXEH 4B2AA 3A7VA 1QQ4A 1RTLA 2BMGB 2QXGA 1OP2A 3UQVA 5JB8S 4WY3A 4RRXA 2XBVA 2NPRA 3KGPA 1EZUC 1HAVA 5DK1A 4X8VH 2P3FL 1O3FA 1DVAL 2J98A 1VKYA 2FDAA 1TPPA 2FM2A 4I86A 4BAQB 3TGFA 1YLNA 5JBTA 3VFEA 2VWMA 3MH7A 1GVZA 1WHEA 1HAXB 5K0HA 1C1RA 1LHEH 5AHGH 2W86A 1CCVA 8GCHG 5CE1A 4Y6DA 1G2MB 1SR5C 5ETXA 3QGJA 4OS1A 2ZFRH 2ZKSA 1OWHA 1KSNB 2TGAA 1LVMA 3LPRA 2PWXA 1S83A 3PLKA 3A84A 1SGTA 1C2KA 3LC5B 2FYQA 5BPEA 3SO3A 2VWNL 4GU3A 1AUTC 1FNIA 1OSSA 1SSXA 3M7QA 4GLYA 4ABEA 3ZYGA 3GCOA 4B2CA 5L2YH 1OX1A 1LVBA 1CVWL 2G4TA 2ZG0H 1O3EA 5EXMA 1VGCC 4XBDA 2BHGA 2SGEE 3LGWA 2XBVL 3URCA 4XOJA 1CT2E 7GCHG 4YOGA 1C5PA 4NA9L 4HZHA 2DE8A 5IYTA 2ULLA 2WPJS 3ZZ7A 1LPZB 3NJPC 1GMHF 1K22H 1O2ZA 1WCZA 2BDAA 2YGPA 1DY8A 1APOA 4YT6H 1H9HE 1NTPA 1GDQA 4Y10E 2VWLA 1DITH 1ETTH 4JZ1A 1C5XB 1G37A 1BUIA 1V2OT 3N99A 2WUBA 1O37A 1AN1E 1W2KH 5F1AA 1KKEA 4TGFA 1TYNA 4R0IA 2H9EH 4GUXA 3FFGA 3NZIA 4F55A 2QF4A 2CMYA 1PPGE 1KLJL 3L3TA 1RIWC 1TNLA 2ZFSA 1UVTH 1O3NA 2CV3A 1EP6A 4NFFA 1NROH 2YMSD 3D62A 2OQ5A 5AFYH 3SU1A 4E7RG 1YPJH 3RXKA 1QL9A 2QE7D 1C1SA 2ZECA 1MU6B 1C5OH 2A0QB 4FUHA 2VWMK 1QTFA 1Z6JH 2C93B 4LMFA 2W26A 1N7DA 2W2ME 4OM9A 2Z9JA 1ATEA 1MKWK 4PROA 1A61H 3ATWA 4RN6A 4WXIA 1G3BA 1AVWA 2SGFE 1AO5A 2FOEA 3BTTE 1GI8B 1IOEA 2BOKA 2G81E 3AW1A 1SBWA 2VWLL 4HG6A 3U8TH 1EATA 2ZGCA 1YC0A 2AGIX 2OLGA 2WPIS 1TB6H 1YCPM 1LHFH 1GHYH 2PUXB 5I46L 1EPHA 2WPHS 2BLWA 1QL8A 3E3TA 4ZHAA 3FFGL 2BVXH 3FO8D 2BQWB 2ZF0H 5T3HA 4Q80A 1UVPA 2BXTH 5FXLA 2FTMA 3ZVEA 1EASA 2Y7ZB 6GCHF 2FODA 2QF0A 1T8LA 4AFQA 3EE0B 2YNAA 2JJLA 2FI4E 2KR7A 3K9XB 3UOPA 2XC5A 1GI9B 5FHTA 1MTSA 3MMGA 1P02A 5IK2D 1O5FH 4O97A 2OP9A 1TE0A 2VIQA 4FU7A 4X6PA 3N8ZA 1ZSKA 2FWWA 3GY4A 4ZHMU 3ITIA 3ZZ6A 1COUA 5FPYA 1G3EA 2Y81B 1INCA 2PUQH 3DSOA 2BZ6L 2A5IA 2JDID 4MMZB 1LTOA 3O8CA 1ZTKA 4DIHH 2A31A 1OYQA 3KYFA 1GHWH 2ILNA 2WPDD 1S81A 2HGTH 2ZDMA 1CQEA 3SNBA 1HAZB 3ZZ4A 1GMDF 1EZQA 3NTGA 2VRSA 4UFGH 3ATIA 3PO1B 1GCDA 4JZIA 2ANKH 1KXCA 1ZR0A 1P8VC 4I8HA 5CMXH 1HXFH 4TWWA 4YLUA 3LH1A 1RFNA 4ZAEB 1O31A 2FO9A 8KME2 3S69A 3TH3H 2XC5L 2AMQA 1KDQB 1FAKL 3TNTA 4ZKRU 4JZDH 5F53A 1BMAA 1V2PT 2VINA 3SU2A 1TPGA 2RG3A 5EXNA 3U8RH 1XUHA 5IKVA 2M2AA 3IG6B 5C0UA 3SJIA 1SLUB 4MVNA 4OTJA 4FUCA 4INKA 2OBQA 3ENSA 1C1NA 2UUJB 2STAE 2PHBA 1TNHA 1BTPA 2TGFA 4Y0ZE 1Y3YA 1IQGL 4ZKNU 3P8FA 4B76A 1UVUH 1O5EH 4CUEA 1F7ZA 2RNLA 1RGQA 4JCNA 1TNJA 1GHBG 5T6DA 5DN6D 3TZIA 4FUGA 1GHAF 2HWLB 1O39A 2WYGA 1HJ8A 1NFXA 1C2FA 1NRPH 2GX4A 1DICA 2MHPA 3MNSA 3OEHD 3CFWA 1A0JA 2R0LA 4FUFA 4XD7D 3EE7A 3N8YA 1QGFA 3HKIB 1EAXA 1GVKB 1TBZH 1BTHH 3OLUA 2M74A 2P59A 2R2MB 4KELA 4IN1A 1FQ3A 2G55A 3BEIB 2ALVA 1L2EA 1CGJE 3PWCA 3QTVH 1JBUL 2ZU1A 3CNRA 4CHAB 3ZZ3A 3Q7DA 4TPYA 3MO6A 5EQQA 1YLDA 4MG3A 3RP2A 1BF9A 3M5OA 1FY8E 2XC0A 3UWJH 2GV7A 3MU8A 1QRXA 3JZ1B 1EAIA 1KXAA 3OFND 2J94A 4UE7H 4X2XA 3SV9A 5IKTA 3SQHE 4JZFL 2P95A 4H6TA 3PMAB 1C1TA 1P03A 4BANB 1K0HA 2A4GA 5CKNA 1P2OA 1D3DB 1LQDB 4WMFA 1W0KD 1W7XL 3T27A 1VCPA 1L4DA 1OWDA 3HK3B 2P3FH 1IHTH 1J9CL 2KV4A 1DVAH 4KP0A 4E06H 3BTQE 4ZMAH 1C4Y2 1UTMA 4DW2U 1DFPA 1EQHA 2FLBL 4BTTA 2G4UA 2F9PA 4MQAA 3B8JA 1YY3A 1GG6C 4ZKSU 2GDDA 3GDSA 2TBSA 3S7KB 1CHOG 1IQMA 2QY0B 3V7TA 3E6PH 1BA8B 3M37A 1C2MA 4X8TH 4Y7BA 5DPAA 6CHAB 3RMOH 5EQSA 1B9WA 3R05A 1NZQH 2F9BH 2QYIA 2XC0L 1EMOA 3VB3A 5EJLA 4NA8A 4AOQA 1P9UA 3BTHE 1T4VH 3P6ZB 1GBBA 2GCHF 1F0UA 4IBLH 2P95L 5T6FA 1UCYH 1PQ5A 1O2NA 1EP5A 4M9FA 2WPKS 1WAYB 3SZNA 1OS8A 1UZPA 2H9EC 1RS0A 3A88A 3BTME 4A94C 2BX4A 1BJVA 4CH8B 1SVPA 3PLPA 2VGCC 5FL7D 5DG6A 2BO2A 1O0DH 4NA9H 5B6OA 5C0TA 1RIWB 3PB1E 1ZRBA 1GJ9B 3SW2B 2A4RA 3SV6A 1SGFA 2Y5HA 3A83A 4RKOB 1C2JA 1V2TT 1QFKL 1GJ4H 1K1JA 3TK5B 2J95A 1TGTA 3STJA 3SU6A 1IQML 2XTTB 2PR3B 1C1VH 3M37L 1TQ0B 3NT1A 3NXPA 4GCHF 4Q7YA 2NU4E 3FN8A 1LKAA 9ESTA 1GHZA 4NA7A 5BRRE 1CGIE 1C5MF 2Y5GA 4DJZB 1GBKA 1YF4A 4JYVH 1ZGVA 4RRWA 2DE9A 3VPKA 3OAAD 1V6DA 1G2LA 1FONA 3N7DA 4Q7XA 1XUFA 5COXA 1V3XB 4I32A 1D6WA 3LT3A 3F2FA 1KLJH 4NCYA 1XUGA 1C1PA 1TRNA 2QF3A 1J8AA 4H4FA 1P2IA 4ISHL 1W10U 5HYOA 3QUMP 1ETSH 3SU0A 3MU1A 1NFYA 3HGNA 5GCHG 1GI3A 4MMYB 3TJOA 1SGFG 5JBCS 1ABIH 2ZDKA 1G1QA 1SGNE 3BEUA 5GJ4B 4CR9A 1LPGB 1SI5H 5DGJA 4LK4A 1C1WH 3M7UA 3V12A 5C20A 1S6HA 2BQ7B 2Y5HL 3LJJA 2WUCA 1P12E 2ZFPH 1KXBA 5F8ZA 2WYJB 3RXVA 1GBLA 2O8UA 2P3FN 2PGBB 3O8RA 3VB4A 2B7DL 3A8DA 2HOXA 3S6XA 5K7RA 2W2NE 5TJXA 2Y5GL 4BTIB 2GV6A 1QQUA 5A8ZA 3BF6H 2BTCE 5I46H 1PPBH 4INLA 4O02B 2R9PA 3DT0H 3S9AA 1SOZA 3A7TA 3ZYEA 2NWNA 5EIYA 2PKSB 1X7AL 2Y7XA 3A82A 2W6ID 1XUJA 1EXFA 3PROA 3RXCA 5GXPA 2J2UB 4MPVA 3C1KA 2ESTE 5C67A 4CUFA 1CBWB 3QH0A 2UUYA 3DUXH 4NZQA 5EG4A 3K65B 2BZAA 3LJOA 1F0RB 3Q3KA 3RUOA 1LDTT 3WWBA 5FBIA 3UFAA 2D2DA 3LIWA 4AX9H 1P2NA 3RXRA 1GJ5H 2CHAC 2ZGJA 4AC9A 2VNTA 1GHXH 1V2WT 1W0JD 2CK3D 3M3TA 3PGHA 1GMCG 4ACAA 4BTUA 5DP3A 4COXA 2BQ6B 1DDXA 2GZ9A 2OK5A 2Y80B 4U01A 3MWIU 2BZ6H 2NU2E 5GPIB 2QC2A 1TALA 3VGCC 3BIVH 1NFWB 3FVFB 4JYTA 2FP7B 4X8UL 2WPME 1N8OB 3HO5A 5I25A 2ZHQH 4FU9A 3N8WA 3MI4A 4XBCA 1KY9A 2BY5X 2FLGA 2GDEH 3KEEA 2QXHA 1GBIA 3QO6A 4CRDA 1O33A 3CP7A 1O38A 1Q3XA 5GWZA 2EY4C 4ZROA 3F2HA 5EGMA 1BCUH 1LHGH 3U1IB 4U30A 3RU4D 3A86A 1HFDA 1NN6A 2I6QA 1N6YA 3BPSE 4ABGA 3CENA 4YT7L 1O2TA 1HNEE 2FYRA 1G9IE 2ZTZA 2WPJE 1GJ7B 1O2HA 2AS9A 5E0HA 4UFEH 4XSKU 3MDLA 5KN5C 3QK1A 1RTFB 3KQ5A 2J92A 3HO3A 4OS7A 2NU0E 3G01A 1HIAB 3STIA 5KGOA 2WHXA 1C5WB 1IQFL 1TX7A 2W3KA 5TCAA 1KIGL 4KTSA 4KGAA 5EOKA 1XFEA 1JIRA 4CREA 1TGBA 4MPXA 2VU8E 1K9OE 2ALPA 3IITB 1AZZA 3ZYDA 2VVUA 5JBBE 2A1DB 4GAWA 4CRCA 1SGYE 4NFEA 1G32B 4K3JA 1KLOA 3K6YA 4DG4A 3FP8E 1DX5I 2A5AA 1TFXA 1W7GH 4DT7B 2P16A 3POYA 3SI3H 1GJAB 3SUEA 2PSXA 3ZZ5A 1NFUA 3M3VA 2EI7B 1YGCL 1BRCE 2QGRA 3MYWA 1HPGA 1MTVA 1FJSA 4LORA 1F0SB 5IKRA 4TY6A 1HREA 1GI5A 1UVOA 1F7EA 3L33A 3CENL 4B75A 3RMMH 3DFJA 3C27B 3KQEA 1ZYOA 1AKSA 2Q1JB 2OC7A 1JBUH 1THSH 1Y3WA 2OINA 1GBTA 4Z0KA 4AFZA 3F3BA 1D9IA 1N1LA 3SQEE 4Z1MD 2LNCA 2K0QA 1GG6B 1TRMA 3HS6A 2AERH 1AUJA 1O2QA 2BX3A 1K36A 2J4IA 3ZIAD 2J9NA 2ZA5A 2WPIE 2W7SA 4ASHA 1UHBA 2VVUL 4JZFH 1QHRB 2SNVA 1E79D 3ASIA 1P57B 1SFQB 1O2GH 3RDZA 4ABBA 3PWBA 3BTGE 3RMLH 2P16L 1ELEE 1W7XH 2RA3A 4O03A 1HB0B 1MD7A 3CS0A 2A5KA 1GJCB 4F48B 1QBOA 1J9CH 2VIDA 1DX5M 3I78A 5A0BA 1ID5H 5A09A 4MNXA 3S7HB 4MMXB 1EJNA 2ODYB 2XRCA 3PV4A 4U32A 4XBBA 1FJSL 1MTUA 3S9BA 3KQBA 4I33A 2NU1E 1HCGB 2GMTC 5AVDA 1T8MA 4Z6AH 3RLWH 1C5VA 4RI0A 5L30L 3HPTB 3OE7D 3SGBE 1TRYA 1ATDA 3KQEL 2YMSC 3GY2A 1SQRA 4A5TS 2BOHB 1SGRE 4CRBA 1PFXL 5F8XA 4WMDA 3P17H 3SNCA 4D0EA 1AIXH 1HGTH 2HLCA 1FPCH 2F9VA 2VH0B 2SGQE 4RSPA 1P0SL 3ELAL 2GT8A 1EBVA 2W3IB 1OWEA 1V1HA 1KXFA 3MH6A 1VITG 1C2IA 1MH0A 1SHYA 1UTJA 4E05H 2ZFFH 3P5BL 2FOCA 4X8TL 1G1SA 1C5NH 7ESTE 1W13U 1TGSZ 4DY7B 1V2LT 2KCOA 5FPTA 3GY3A 1CVUA 1ZMLA 3LH3A 1CA0C 2F9BL 2KAIA 3DEMA 1EJAA 4BDXA 3P8GA 1C5TA 3GISX 1QFKH 5A8YA 1BB0B 3KQBL 1T8NA 1SMFE 2P94A 3JZ2B 1EAWA 3RXDA 4Y76B 2GZ7A 3S0NA 1HAEA 1LMJA 1AFEH 4HFPB 2EEKA 2Y82A 1SGIB 4CRAA 5JBAE 4BNRA 3TK6B 2ZO3H 4ZXXH 1TOMH 1HT8A 3SOVA 1BOQA 3TH2H 1IHSH 1SKYE 2WZPP 4NIVA 5GNDA 1EPTC 3MQKC 2AFQB 2OD3B 2ZPSA 3SU4A 3BTDE 2FMJA 1ELCA 4NGAL 3QDZB 1FY1A 4X1SU 2BT7A 1L0ZA 1MZAA 1C1OA 1S5SA 2AEIH 1CGHA 2ZTXA 1VJAU 4ISHH 1P9JA 2ZU3A 3A81A 1ARCA 1WHFA 1EPTA 1Y59T 2VH6A 1FZZA 2PV9B 1JRSA 3Q3XA 4XLWA 2KNIA 2THFB 5JYIA 2PKAB 4BXWA 5EJZA 2KX4A 1BTYA 1XVOA 1TAWA 2ZDVH 3Q3KB 2ZEBA 1OKXA 1FF7A 2DDUA 4JYVL 2C8XB 4ISNA 4TWYA 3FZDA 2BD7A 4ZH8B 1T4UH 2P3TA 2H6MA 5A0AE 2P94L 3SHAH 1H8ED 1UCYK 2PSYA 3D49H 5C17A 1W12U 8LPRA 1UCYE 1ANBA 3GOVB 2IPHA 3OX7U 5CHAC 2B7DH 1HAFA 1WQVH 2QXJA 1HDTH 1LVOA 5JPMH 2BD8A 4I8JA 3ODDA 4SGAE 4UFFH 1B0EA 2I9BA 3A7XA 2PP6A 1O2RA 2BD4A 1AVGH 2P3UA 4FVBA 4WH6A 1OOKB 4UEHH 1GBCA 1O32A 1UW7A 4DOQA 2Z9LA 1MQ6A 3VGCB 1UK4A 5JVYA 1BHXB 4X6MA 2ZTYA 5LPFA 3F6UL 5E8EH 1U67A 2XWBI 2OQUA 1WU1B 1ZJKA 3D23A 1WDIA 2J38B 3BT1A 1A4WH 1FDPA 2EI6B 1QCPA 2JJ2D 3GY6A 1J16A 3H5CB 1VJ9U 3T5FH 2FD6A 1L1GA 2GZ8A 1IVOC 5JVZA 2XC4A 3F2GA 1LMMA 4K60A 3ZVCA 2C8ZB 2UWOA 4XDEA 1PQAA 1TNKA 2B0FA 3MH5A 1TA2A 2ZFTA 1PTHA 1PPHE 4OTYA 1K21H 3ZV9A 2QAAA 4IMZA 1GL0E 1NC6A 1C2DA 3MH4A 3PRDA 3SORA 5C2ZA 1CU1A 5L2ZL 1EFRD 1U6QA 1YCPH 2A2XH 4X8UH 1NRQH 2KZ4A 2UWLA 1OP8A 1IQNL 1UK3A 3ZYIB 1GGDB 2ZCHP 3SOBB 4K69A 3KF2A 1PPCE 1AD8H 1SGEE 3MOCA 3ZVAA 2F9NA 2AGGX 3VG8A 4FUBA 3B9FH 1TGCA 1K37A 1MQ6L 3SU3A 3KQCA 1LPKA 2FLRL 5CKQA 1NRRH 1XKBC 3SV8A 3RXOA 1C5MD 5TCCA 2O8TA 2ASUB 1GHVH 1WOFA 2FIRH 4YT7H 1KTSB 1I0UA 5DP9A 3SOSA 3WWFA 2FX6A 3MU5A 3UNRA 3OTJE 2HOBA 3HO4A 1IQGA 1TABE 3PMBB 1CE5A 2FOHA 1E0FD 1T32A 3GCTG 2WSSD 1XKBA 1K2I1 2A7JA 2XC4L 3T26A 1IQKA 1P01A 4AG2A 3E91A 3HKJB 1ELDE 1V2VT 1BHXF 5EU8A 2EI8A 3TH4H 3MFJA 1KIGH 5L6NH 2D1JB 2Z9KA 2TRMA 1EPIA 2FESH 4Y7AB 2Q6DA 4WJG2 3GCWE 4H6SB 1FSBA 4ZCNA 3SGAE 5A2MH 4YZUB 2VVVA 1NU9A 3L6PA 3F9HA 1AFQB 5KECA 1EMNA 2AYLA 1C1QA 4UFDH 1O2IA 4M11A 4D8NA 1EPGA 1IQEA 1SZBA 4A92A 3EDXB 1YGCH 1C5ZB 1ANDA 3ATMA 1FXYA 3KQCL 1E1QD 2OYUP 4YOJA 1G1TA 1EB1H 2CJIA 1QJ7B 1DSUA 3LC3A 4RT1A 5DP6A 3RMNH 3A7YA 2PW8H 4Y79A 5C3NA 4TSFD 3TGJE 5EW1H 1EKBB 1QL7A 4NWKA 3U69H 1AMHA 1TWXB 1IQKL 4DGJA 2J34A 1H8IH 4AFSA 1SGCA 1O2UA 1IJQA 1NESE 1P9SA 1NPMA 2VBCA 2XNDD 5C5OA 2GMTB 1G1RA 2A7CA 2SGDE 1Z6CA 1MBQA 1YPGH 5F8TA 3SYJA 4O9VA 4X2WA 1HAVB 2AHME 1QA0A 1O3CA 3MTYA 1EQGA 1UTKA 1C2LA 2J98B 2WPLE 1AWFH 1VCQA 1MD8A 4FVDA 3RXSA 4AFUA 3ZZ8A 4AG1A 2VVVL 1SQOA 5K0HB 1LO6A 1EAIC 4FUDA 1CHGA 1LQEA 3NCLA 5J4SA 2FX4A 1DQBA 3KL6A 1A2CH 3QZRA 4AN7A 1SB1H 4Y6DB 1IQEL 3QX5H 2B9LA 1APQA 2Y38A 1ARBA 3E1XB 4FXGH 2JH0D 4F4OC 4YM9A 1RD3B 1FN6A 2O8MA 5L30H 1FE2A 1OB1C 3RXIA 1D6RA 1XKAC 1IQLA 3RXPA 1D4PB 5HKKD 2P28B 1CA0B 3KQDA 1SLVB 3VB5A 4RKJB 1YPLH 4MNYA 2BY6X 3P92A 4FOUC 2ZQ1A 3UR6A 4CRFA 4I31A 1PPFE 1ZHMA 1LHCH 5H4IB 2HALA 2I9AA 2AYWA 4CSYA 1MTNC 3RM2H 8GCHF 1P0SH 3ELAH 1HJ9A 1TPOA 3EA7A 5FDQA 1Y5AT 3TBDA 4Z6AL 1LHDH 3CS7A 1VGCB 4BAKB 3EGFA 3H7TA 2RDEA 3P95A 1U8CB 1AWHB 1VR1H 3T28A 2GCTC 4Y8ZA 3UB0A 3DA9B 1VITH 3MU0A 4X2YA 5FAHA 1O3PB 2OXSA 1RRKA 5EW2H 1O5DH 1S6FA 1CCFA 2F4LA 1CO7E 2QV1A 1J15A 3PV5A 1G30B 2BY7X 1PYTC 1V2NT 2P3TB 4YTAA 4ISLA 1ZPBA 2V0BA 7GCHF 3N7OA 3LGIA 1IQLL 2RA0A 2OC0A 3KQDL 1K1OA 2V6NA 5HMAA 3RXUA 3GY8A 4Y71A 3RC6A 1PJPA 1C5SA 1DLKB
chains in the Genus database with same CATH topology
1XKAL 1HV7A 5EPYA 1V2MT 1BMNH 4XBMA 2C90B 2BVRH 1SC8U 4NGAH 3V13A 2ODPA 1YUGA 4OS6A 5CHAB 1DXPA 5EQRA 2M5TA 3CS7L 2W26B 2FOMB 5E8DA 2BOXA 4IN2A 4X1NU 1BRBE 3ODFA 2ZQ2A 4AGKA 2K2SB 3SI4H 3TNSA 3O8DA 1X7AC 3NKKA 2RCEA 3AVZA 4D9RA 2FI3E 2BY9X 4ZXXL 1GI6A 3ZZDA 4FUEA 1JRTA 3UNSA 4ABHA 1C5RA 2KB9A 3AAUA 4A7IA 1EGFA 3AASA 5FCKA 3VXFH 1QB6A 2WFXB 4ZHAB 2BD5A 2EA3A 2VWOA 5JB9S 2BOUA 1M1XB 5PTPA 5DP7A 2XWAA 1BMMH 3N8XA 1WTGH 1JV2B 2BMGA 2H2ZA 3UR9A 2ZU5A 2RA0L 2ZC9H 1QNJA 1KXEA 1UZJA 2GD4A 1ZHRA 2QA9E 3NWUA 4E7NA 2BD2A 4GSOA 2B8OH 3LKWA 3SOQA 1SPJA 2G5NA 1P06A 3V65B 1HRFA 1BQYA 3Q3YA 4G1MB 1P2QA 2ZDNA 1YUKB 2Q6FA 1A1RA 3U8OH 1GJ6A 3NK8A 1T7CA 3QWCH 4X8SH 1HXEH 5IKQA 4C16A 1AY6H 1YBWA 3F6UH 3MNBA 4X6NA 2GT7A 3TJUA 3PLBA 4AB8A 1TA6A 5DKMA 1KTTB 4INHA 1ZPZA 1G2MA 1V2ST 1YM0A 2F83A 5JW1A 2FOBA 4CH2B 1G3CA 1NT0A 1ELTA 1GMHG 1SLWB 3OYPA 6LPRA 1NO9H 1KSNA 1EX3A 1LCYA 1W0YH 4LOYH 1EUFA 3PTBA 3LC5A 5HXFA 4RRYA 1A3PA 3A87A 1F5KU 5DJ7A 1TONA 1CQQA 5F6MA 1EJMA 3BTWE 5E0JA 1EZQB 3RU4T 2VWOL 3EA8A 3KRKA 3UUZA 2JH6D 1XUIA 1BJUA 1DDJA 5JB8E 4OS2A 5C1UA 2WFTA 1O2VA 3FBYA 1O3BA 1UMAH 1S82A 1FMGA 2QIQA 5L2ZH 4ISIL 1HAGE 1A3EH 2I6SA 2WV4A 2ZHFH 1O2LA 5HM2A 5FBEA 1RFNB 1LPZA 3GCHC 4I8KA 4THNH 1ETRH 3IWMA 1IQFA 2FLRH 1O3GA 4LZ1H 4E1GA 1HAOH 1A0LA 1TIOA 4ABFA 2XCFA 1IAUA 1DOJA 2Z9GA 3LDXH 3SV7A 3ENSB 2PHBB 3D65E 4X1RU 2MGPA 1TPAE 3DHKH 1P3CA 1S85A 3EA9A 4WVPE 4ABIA 3TVJB 1HUTH 1Q31A 1TX6A 1O3IA 3SHCH 4Y0YE 3V0XA 3FCSB 2WYGB 3KIDU 4UDWH 1NFXB 2SNWA 1SHHB 4ISOA 1KXDA 2BD9A 4ABJA 2H5DA 3N8YB 1EQ9A 1SLXB 3UTUH 1BRAA 2H1UA 1S84A 2Z3CA 1E35B 1XXDA 4ZXYL 1C2GA 2ADXA 1ZLRA 1MKXK 4B1TA 4K2YA 2P93A 3QLPH 2XXLA 3O8BA 1FY3A 2FI5E 4MLFB 1THPB 3TU7H 1J17T 1AE8H 1XMNB 1ZHPA 2BLVA 1V2QT 3LGYA 6GCHG 3E90B 3W94A 3SNAA 1T31A 3P8OA 4O1ZA 3PM3A 2WV5A 3A8CA <