3V65B

Crystal structure of agrin and lrp4 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
335
structure length
330
Chain Sequence
YCSQGCTFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Agrin
total genus 71
structure length 330
sequence length 335
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
B PF12662 cEGF Complement Clr-like EGF-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3v65B01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3v65B02
1CRZA 3IAXA 3HS6A 3WWAA 1ZAQA 4CUDA 1FF7A 1F7EA 3Q6KA 2VWMK 1JL9A 3DR2A 4BTUA 4XBMA 4D0FA 4GNAA 1P0SL 2G8SA 3EGFA 3NTBA 2IASA 5JBCE 3FBYA 2KB9A 3DASA 1B9WA 3KGGA 2WG3C 2D1JB 2P95L 4Y79B 2GVWA 1HJ7A 1UZQA 3MQEA 4D90A 3S8VA 1DVAL 1YGCL 1UZJA 2WYJB 4GN8A 1DDXA 3HLIA 3V1SA 2VH6B 3ASIA 1JV2B 1K37A 2Y81B 1HCGB 2I9BA 3GCXE 3TH3L 4G1MB 1TPGA 1LMJA 2FD6A 1F0RB 2BQ7A 1ADXA 2W8BB 5L30L 2MHPA 3N8XA 2HQSA 4BTIA 1YUGA 3OLUA 1FFMA 1PJXA 1ATBA 2J34B 1EPJA 5CISA 2YGOA 3P5BL 4MMXB 5GX2A 1XFEA 5D9BA 1TOZA 1YUFA 1J9CL 3OLTA 1C9UA 3V65B 3Q7DA 2TGFA 1V04A 3KL6B 3RR3A 2XBWL 1CX2A 3GCWE 4BTTA 3TK6B 4DG6A 4RRXA 1EPGA 2P16L 4O5SA 3LI3A 3HO3A 3S8ZA 2FLBL 1IQFL 1N1IA 2WYGB 3CFWA 4AQTA 4X8TL 1NFYB 3BPSE 5CKNA 4A7IA 3V64C 3Q6PA 3DEMA 5EGMB 4YZUB 3HO5A 1DX5I 4IYGA 2DG1A 2Y5HL 4OTYA 4Z6AL 3LI4A 1NPEB 1IQKL 2BOXA 4MMZB 2P3FL 1MQ6L 2VWLL 4YT7L 2RA0L 3LN0A 4ZAEB 1A3PA 3SOQA 2EI7B 3WW9A 1YUKB 3M37L 5JB8E 2W2QE 1EMOA 4PWZA 5GX3A 2J38B 5E8DA 2NPRA 2VH0B 1PTHA 3HS7A 4RS0A 5IKQA 4X8VL 4CUFA 2H9EL 1CCVA 4HW6A 1UZKA 1NT0A 3Q6TA 4JMLA 5F19A 3A9HA 2XC0L 1HZ8A 4O02B 1OB1C 1RWIA 2B7DL 1EGFA 3TZIA 5EX7A 3FW0A 2P94L 3K9XA 1RFNB 4COXA 1IQLL 1DQBA 2FLGA 2J94B 2DDUA 2UWOB 2KL7A 3TK5B 2FPBA 3HO4A 3N8WB 5GX5A 2Y7ZB 4XL1A 2WPLE 4RRWA 3G4HA 2P3TA 2KV4A 3LC5B 5D9CA 1GK5A 3KK6A 1F7MA 3GISX 1FAKL 2BZ6L 4C16A 1WHFA 1PFXL 1IQEL 3HRPA 1U8CB 2GVVA 1LPZA 4R40A 2Q1JB 1FE2A 2J4IB 2W3KB 4ZXXL 1EMNA 3SRGA 2W86A 4O1ZA 3N8VA 1UZPA 1CRUA 1PGEA 1G1SA 3TBDA 2GD4A 2ISMA 1APOA 2J2UB 4Q1UA 2QE8A 3F1SB 2XBXL 2W8BA 3ZYGA 3LC3B 5JW1A 1X7AL 1IVOC 2OYUP 3ENSA 2GVXA 3BT2A 4BXSA 3QH0A 1CQEA 2EI8B 1HAEA 2VVUL 4JYUL 4JZEL 1KIGL 4RRZA 4MMYB 3ELAL 1FSBA 2WPME 1YO8A 1QFKL 2WPJE 1KLIL 2MGRA 2WPKE 2Y7XB 1AUTL 2DSOA 3NTGA 1G1TA 2P26A 5JBBE 3KQEL 3LAQA 4Y71B 3BT1A 4GN9A 3QMOA 4IMBA 3ZYIB 2G00L 1EQHA 1EBVA 2V91A 3HS5A 1G2LB 3U73A 2RHPA 2XBVL 1IP0A 2IAOA 2P93L 3LTFB 4Z0LA 2W26B 1G1QA 4ZHAB 1N7DA 2VVCK 1P9JA 1TLEA 3LTGD 1IOXA 1ATAA 3HPTA 1CQ1A 2XBYL 2IAWA 3KYAA 3PGHA 2UWPB 2VAQA 3HLHA 4FM5A 1LQDA 4CUEA 2GHSA 2Y80B 3KQCL 3N8ZA 3U0SA 4ISHL 1ATEA 5KN5C 3G4EA 1EAIC 1NFXB 1G1RA 4X8SL 1M1XB 1W8BL 2M74A 5COXA 2Y5FL 3R05A 4D0EA 2FP9A 1LPGA 2F9BL 1L3YA 1NFUB 4Z0KB 4JZFL 2Y5GL 2POOA 1Z6EL 1BF9A 1Q4GA 2K2SB 3F6UL 1IQIL 2BQ6A 4NG9L 1FJSL 4Y7BB 4YT6L 2PR3B 3LIWB 5FWWA 2W2OE 1CVMA 2XC5L 3N8YB 1IOEL 1IQJL 5GTQA 2BQWA 1IQML 1FAXL 4M11A 3SOVA 2YGPA 5CKQA 2OYEP 3LI5A 2RNLA 2DG0A 1Z6CA 3N8WA 1URKA 4E1GA 5GX1A 4GN7A 1C5MF 1PXXA 4O5TA 5JBAE 3AMRA 2W2NE 2ADXA 2WPIE 4LMFA 5JVZA 1HT8A 5KIRA 2IATA 4HHOA 4PH9A 4ISIL 1ATDA 4NGAL 3E5ZA 1LPKA 5JVYA 3S2KA 2BOKL 2XC4L 1H6LA 2P3FN 4A0PA 3O4PA 1RWLA 3M36L 4XLWA 2Y82B 2VWNL 3I1CA 5IKTA 3IJEB 5JB9E 1Q7FA 2UWLB 2CJIB 4BXWA 1WHEA 1COUA 3KQBL 2IAQA 3NJPC 3N8YA 3FVZA 3KRKA 1HREA 4M10A 1NPEA 3A9GA 2K2TA 3ZYJB 2VVVL 1F0SB 4ZH8B 2Y38A 4ZLRA 2AYLA 1XKAL 4Y76B 3LN1A 4ZXYL 1EQGA 3CA7A 5D9DA 4RRYA 1SZBA 2BO2A 1KLOA 1W7XL 1MQ5L 1G2MB 1XDTR 1CVWL 2W2PE 4OTJA 2IAUA 4BDWA 3NT1A 5CKMA 5I46L 5GX4A 5L2ZL 1EZQB 1POOA 2IAPA 1NQLB 1WU1B 3POYA 3CENL 3U7UG 3C9AC 4Y6DB 1C5KA 3KQDL 1IJQA 2FPCA 3MDLA 2WFTA 2GVUA 3Q3KB 5K0HB 3TC9A 3SREA 6COXA 1CVUA 2EI6B 1QBIA 4JYVL 2FZZL 4TGFA 1V3XB 3IITB 2JKHL 1E1AA 3BYCA 1HAFA 1APQA 2J95B 5F1AA 4GNCA 4NA9L 1MOXC 1EPIA 1HT5A 1QLGA 3FFGL 2IVZA 1EPHA 3KCGL 2FLRL 3CS7L 4LORA 1NFWB 4HHQA 3SW2A 1IGZA 4RUTA 2OJHA 2IAVA 2P28B 1JBUL 1IGXA 2PUQL 1IQNL 1U67A 1DIYA 3TGFA 2WPHE 2FP8A 2VJ3A 3S94A 1L5GB 3H5CB 3QCWA 2WFXB 5IKRA 2BOUA 2BOHA 4X8UL 1PRHA 1XKBA 2P3UA 3FCSB 1K36A 1I0UA 1KSNB 4Y7AB 5IKVA 2IAXA 1CEJA 2VWOL 2P4OA 2WG4B 2I9AA 4JZDL 4GNBA 2MGPA 1KLJL 2IARA 2W3IB 5FDQA 4BDXA 2PHBB 1HX2A 1O5DL 3SOBB 1NZIA 2BMGA 5L2YL 4CSYA 3AMSA 2W2ME 1IQGL 1IQHL 1CCFA 1HRFA
chains in the Genus database with same CATH superfamily
1CRZA 1ZGKA 3IAXA 3HS6A 2BT7A 3WWAA 1W8NA 1ZAQA 4CUDA 4G3NA 4XJ8A 1FF7A 1F7EA 1B9SA 2VWMK 1N1VA 3Q6KA 4ZGCA 4XMIA 1JL9A 1IVBA 3DR2A 4BTUA 5B2CA 4XBMA 4D0FA 1N1TA 1P0SL 2G8SA 2YA4A 4GNAA 3EGFA 5HUGA 3NTBA 2IASA 3UC1A 4K1JA 5JBCE 3FBYA 2KB9A 3DASA 4FOYA 1B9WA 3KGGA 2WG3C 3K38A 2D1JB 2P95L 3CL2A 4MWXA 4Y79B 2GVWA 1HJ7A 3ALWA 2ZB5A 4GU3A 1NSCA 1UZQA 4FPOB 4XJRA 4GJTA 3VNGA 3MQEA 3OPZA 4D90A 2VW1A 4X47A 1DVAL 3S8VA 1YGCL 4FPGA 4QNPA 1UZJA 2WYJB 1X2RA 2X9MA 4GN8A 1DDXA 3HLIA 3V1SA 2VH6B 3ASIA 4AHAA 1MS0A 1JV2B 1K37A 2Y81B 1INXA 1N6FA 1HCGB 2I9BA 3GCXE 3TH3L 2HT8A 3GVLA 4H52A 4G1MB 1TPGA 2SLIA 1LMJA 2FD6A 4KS4A 1F0RB 3K36A 5FNTA 4CSDA 1Z4VA 2BQ7A 2XZKA 4XJ9A 4K1IA 1ADXA 4FPYA 2W8BB 5L30L 2MHPA 3N8XA 2HQSA 4BTIA 4QN7A 1V3EA 4XHXA 2HTQA 1YUGA 3OLUA 1INWA 1FFMA 1PJXA 1ATBA 2J34B 3TI3A 1EPJA 5CISA 2YGOA 3P5BL 1BJIA 4MMXB 2W5OA 4ASCA 2C4LA 5GX2A 1XFEA 2W38A 5D9BA 1TOZA 1YUFA 1J9CL 3OLTA 2BSFA 1C9UA 4FJ6A 3V65B 1IUCA 3Q7DA 4XJWA 2TGFA 1V04A 3KL6B 4MWWA 3RR3A 5FNSA 2XBWL 2VK7A 1CX2A 3GCWE 4BTTA 4IFLX 4D52A 1OFZA 3TK6B 4DG6A 4RRXA 2F26A 4B7RA 2ZWAA 1W0PA 2FLUX 1EPGA 2P16L 2QWCA 3LI3A 4MJVA 3HO3A 4O5SA 3S8ZA 2QWFA 3TIAA 1EUUA 2FLBL 1IQFL 3D12A 1V1IA 2BERA 1N1IA 4L7BA 2HTVA 2WYGB 3CFWA 4AQTA 1USRA 4X8TL 4QN5A 1V0FA 1V3DA 5EO7A 1NFYB 3BPSE 2BF6A 3GVJA 5CKNA 4A7IA 1MS8A 3V64C 3Q6PA 3DEMA 5EGMB 4YZUB 4GB1A 4XMAA 4MC7A 3HO5A 5FNQA 1DX5I 2YDPA 2DG1A 4FOQA 2Y5HL 2AH2A 3O9KA 4IYGA 4OTYA 1EUTA 4Z6AL 3LI4A 4CPZA 1NPEB 4QN4A 1W8OA 1IQKL 2BOXA 3BEQA 2RKCA 2SILA 4MMZB 2P3FL 1MQ6L 2VWLL 4YT7L 2RA0L 3LN0A 4ZAEB 1A3PA 2HU4A 3SOQA 2EI7B 3WW9A 3SILA 1YUKB 3M37L 5JB8E 2W2QE 1EMOA 1NCCN 4PWZA 1QIUA 2J38B 2Z32A 3NO0A 5GX3A 3K39A 5E8DA 5EO8A 2NPRA 2VH0B 3H73A 4HZYA 1E8UA 1PTHA 6NN9A 3HS7A 4RS0A 5IKQA 4M4UA 4X8VL 4CUFA 4SLIA 2H9EL 1CCVA 1A14N 1MS3A 4HW6A 4XJQA 5NN9A 1UZKA 1NT0A 1DIMA 1SUUA 1V2IA 2QWKA 3Q6TA 4JMLA 1E8TA 2FHRA 3TI5A 5F19A 3A9HA 2BATA 2XC0L 1HZ8A 4O02B 1OB1C 1L7HA 1RWIA 2B7DL 4A94C 3TZIA 1EGFA 4FOWA 4FP2A 2VSKA 4YW2A 4QN3A 4MWUA 5EX7A 1NNBA 3FW0A 2P94L 3K9XA 1NNCA 3D11A 1RFNB 4COXA 1IQLL 1EUSA 1DQBA 2FLGA 3O9JA 2YDTA 2J94B 2DDUA 2UWOB 2VK6A 2KL7A 3TK5B 2F27A 4FPFA 4KS3A 2FPBA 2F13A 5M1ZA 3HO4A 1F8BA 3N8WB 5GX5A 2Y7ZB 4XL1A 4GZXA 4CH9A 2WPLE 4RRWA 3G4HA 2P3TA 2KV4A 1S0JA 1VCUA 5FZNA 4B7MA 3LC5B 2CMLA 4M3MA 5D9CA 1GK5A 3KK6A 1F7MA 2HU0A 3GISX 4XHBA 1FAKL 2BZ6L 4XOGA 4C16A 4YW1A 4CPLA 2F10A 1WHFA 1PFXL 2QWIA 1IQEL 4WEFA 3HRPA 1U8CB 2GVVA 1LPZA 1V0ZA 4R40A 4D8SA 2Q1JB 1FE2A 2J4IB 2W3KB 1INHA 1V3CA 4ZXXL 2XZJA 3H71A 1EMNA 2JJLA 2W86A 4O1ZA 4GZWA 3SRGA 3N8VA 1UZPA 1CRUA 4MWVA 1PGEA 1G1SA 3TBDA 5HUMA 5CGJA 1NCBN 2GD4A 4FP3A 2ISMA 1APOA 3CL0A 4ZY3A 2J2UB 4AGIA 2F25A 4Q1UA 2QE8A 3F1SB 3ZGCA 2XBXL 3SLIA 2W8BA 3ZYGA 3LC3B 2VRSA 5JW1A 1W1XA 1LK9A 1X7AL 1E8VA 2VSMA 1NCDN 1L7GA 1IVOC 2OYUP 3ENSA 2GVXA 1IVGA 2HORA 3BT2A 4BXSA 2YA6A 3QH0A 1S0IA 1CQEA 5F9TA 2AEPA 3SANA 2EI8B 1K32A 1HAEA 4XE9A 2VVUL 4JYUL 4JZEL 1KIGL 4RRZA 1NCAN 4Q6KA 2H9EC 4MMYB 3ELAL 4N1BA 4YZ2A 4GZOA 1FSBA 2WPME 1Z4YA 1INVA 2QWJA 1YO8A 4CPNA 4CPMA 1QFKL 2WPJE 1KLIL 2MGRA 2WPKE 5FZJA 2Y7XB 1AUTL 3H72A 2DSOA 5B2DA 3NTGA 1G1TA 2P26A 1B9VA 4MWJA 5JBBE 3KQEL 1NMBN 1A4GA 1Z4XA 1MS4A 2VPJA 3LAQA 4XJZA 3GVKA 4Y71B 3TI6A 3BT1A 2ZB6A 4IFJA 4GN9A 2H2NA 1U6DX 1V3BA 3QMOA 7NN9A 1IVDA 4IMBA 3TICA 3VNHA 3ZYIB 2G00L 1EQHA 1EBVA 2V91A 3HS5A 1KITA 1G2LB 3U73A 2RHPA 2XBVL 1IP0A 2IAOA 4IN4A 2P93L 3LTFB 4Z0LA 2W26B 1N1SA 1G1QA 4ZHAB 1N7DA 2VVCK 1SLIA 1P9JA 1TLEA 3LTGD 1NSDA 1IOXA 4GEZA 1ATAA 4M4NA 3HPTA 1CQ1A 2XBYL 3S6XA 2QWBA 2QWEA 4QN6A 4H53A 4HZXA 4JF7A 2HTYA 2IAWA 3KYAA 3PGHA 2UWPB 2VAQA 4MWRA 3HLHA 4FM5A 4I00A 3II7A 3TIBA 4FZHA 4FVKA 4MJUA 4XMBA 1LQDA 4CUEA 2GHSA 1N6EA 3K37A 2Y80B 3KQCL 3NN9A 2F24A 3N8ZA 3U0SA 4YZ4A 2QWDA 2BT8A 4X6KA 3W09A 4ISHL 1B9TA 2XN4A 3A72A 3H6JA 4YZ3A 1ATEA 4FPJA 5KN5C 3G4EA 1EAIC 1NFXB 4FPEA 1G1RA 1W0OA 2YA8A 4X8SL 4NC5A 1M1XB 4AH4A 4X4AA 1W8BL 2M74A 5COXA 4WA5A 1NSBA 1N6DA 3L6VA 2Y5FL 3R05A 4FOVA 4D0EA 2FP9A 1LPGA 5FNRA 3SALA 2F9BL 1L3YA 1NFUB 4Z0KB 4L7DA 4JZFL 1WCSA 2Y5GL 2POOA 1Z6EL 1BF9A 3JU4A 1F8CA 1Q4GA 2K2SB 2HOXA 3F6UL 1INFA 2AEQA 1IQIL 2BQ6A 1FJSL 4NG9L 4Y7BB 4YT6L 5FNUA 1MS9A 2PR3B 3LIWB 2XCYA 1MZ5A 5FWWA 2JKBA 2W2OE 2ZW9A 1CVMA 2XC5L 3N8YB 3B69A 4XIOA 2ZZKA 1IOEL 1IQJL 5GTQA 2BQWA 1IQML 1FAXL 4M11A 3SOVA 2YGPA 1X2JA 3WDZA 5CKQA 2OYEP 3LI5A 1IVFA 2RNLA 2DG0A 5HUNA 2F11A 1Z6CA 3N8WA 1URKA 1WP5A 3B7EA 4E1GA 3CKZA 5GX1A 4GN7A 1C5MF 1PXXA 4J9TA 4NCSA 4O5TA 5JBAE 3AMRA 2W2NE 1EURA 2ADXA 4GZQA 4K3YA 2WPIE 4LMFA 1MS1A 2AGSA 5HX0A 5JVZA 1HT8A 4K1KA 5KIRA 2IATA 3ALXA 4HHOA 4YW3A 4PH9A 1IVCA 1IVEA 4XJAA 4ISIL 1ATDA 4NGAL 2F28A 3E5ZA 4HZVA 2QWAA 1LPKA 4XJUA 4YW5A 5JVYA 2VWDA 2KNIA 4KS2A 2BOKL 1LMMA 2XC4L 3S2KA 1H6LA 1Z4ZA 2P3FN 2WZPP 4A0PA 3O4PA 1RWLA 1KKEA 4FPCA 3M36L 1MR5A 4XLWA 2Y82B 2VWNL 4MWLA 3I1CA 2QWHA 4GZTA 4MWYA 5IKTA 4NN9A 3IJEB 4HZWA 5JB9E 1Q7FA 4XILA 2UWLB 2CJIB 4BXWA 1WHEA 1COUA 3KQBL 1MZ6A 3NJPC 1SNTA 3N8YA 2IAQA 2XZIA 1USXA 4KS1A 4WA4A 3FVZA 3KRKA 1HREA 4M10A 1NPEA 3A9GA 2K2TA 3ZYJB 4M4VA 2VVVL 1F0SB 3T1EA 2SIMA 2W20A 3TI4A 1INYA 4ZH8B 4GZSA 2Y38A 4ZLRA 3ADEA 2AYLA 1MWEA 1XKAL 4Y76B 3LN1A 4X49A 4ZXYL 1NN2A 1EQGA 2A75A 3CA7A 5D9DA 4RRYA 3CYEA 4GDIA 1SZBA 1NMCA 2BO2A 1KLOA 3INBA 4B7JA 1W7XL 3A71A 1MQ5L 1NMAN 4AGTA 1G2MB 1XDTR 4YZ1A 1CVWL 2W2PE 4OTJA 2BZDA 2IAUA 4BDWA 4FQ4A 3NT1A 5CKMA 5I46L 5GX4A 3WN7A 5L2ZL 1EZQB 1POOA 5F72C 1IUBA 1SO7A 1NQLB 2IAPA 4YZ5A 1WU1B 3POYA 1V1HA 3CENL 5JYYA 3U7UG 3C9AC 4CPOA 1INGA 4Y6DB 4XYXA 1C5KA 3KQDL 2HTUA 2B8HA 1IJQA 4MX0A 4D52C 2FPCA 3MDLA 2WFTA 2GVUA 3Q3KB 4D52B 5K0HB 1VCJA 3TC9A 4WEGA 1DILA 2QWGA 3K3AA 3SREA 6COXA 1CVUA 2EI6B 1QBIA 4BBWA 1S18A 2VW0A 4JYVL 2FZZL 2VW2A 4TGFA 1V3XB 3IITB 4HZZA 4L7CA 2VVZA 2JKHL 1E1AA 1ZI0A 3BYCA 3TI8A 1HAFA 2W5NA 1APQA 4WA3A 2YA5A 3NSSA 4IQKA 2J95B 1Z4WA 5F1AA 4GNCA 4NA9L 1MOXC 1EPIA 1HT5A 1QLGA 4YW4A 3FFGL 2HT7A 2IVZA 1EPHA 2C4AA 3KCGL 2FLRL 3CS7L 1XOGA 4LORA 1NFWB 2YA7A 4MWQA 4HHQA 3SW2A 1IGZA 4RUTA 2OJHA 4GZPA 2VK5A 4XIKA 2IAVA 1WCQA 2P28B 3PJQA 4KS5A 1JBUL 1N1YA 2DYHA 1IGXA 2HT5A 2PUQL 4B7NA 1W21A 1IQNL 4C1YA 2WOZA 1U67A 1DIYA 2F12A 3TGFA 1W20A 2WPHE 2FP8A 4DGRA 2VJ3A 1SLLA 1Z50A 1XOEA 3S94A 4CHBA 1L5GB 3H5CB 2HTRA 3QCWA 2WFXB 5IKRA 2BOUA 2BOHA 4X8UL 5HUKA 1PRHA 1V0EA 1XKBA 2P3UA 4CPYA 3FCSB 2HTWA 4YY8A 1K36A 1I0UA 1MS5A 4D4UA 1KSNB 4Y7AB 5IKVA 4MZEA 2IAXA 1CEJA 2VWOL 3ZGDA 4B7QA 4K1HA 2H2UA 1A4QA 4HIZA 4MZAA 2P4OA 1F8EA 2WG4B 2I9AA 4JZDL 1NNAA 4GNBA 2MGPA 2F0ZA 4FPLA 4C1YB 4UF7A 1KLJL 2IARA 2F29A 4UOUA 4IFNX 2W3IB 5FDQA 4BDXA 2PHBB 1HX2A 1O5DL 4FPKA 3SOBB 5H47A 1S1DA 1NZIA 1L7FA 4GDJA 2BMGA 5L2YL 4CSYA 1F8DA 3AMSA 2W2ME 4GU4A 1IQGL 4FPHA 1IQHL 1CCFA 2YGQA 1HRFA
chains in the Genus database with same CATH topology
1CRZA 3IAXA 3HS6A 3WWAA 1ZAQA 4CUDA 1FF7A 1F7EA 3Q6KA 2VWMK 1JL9A 3DR2A 4BTUA 4XBMA 4D0FA 4GNAA 1P0SL 2G8SA 3EGFA 3NTBA 2IASA 5JBCE 3FBYA 2KB9A 3DASA 1B9WA 3KGGA 2WG3C 2D1JB 2P95L 4Y79B 2GVWA 1HJ7A 1UZQA 3MQEA 4D90A 3S8VA 1DVAL 1YGCL 1UZJA 2WYJB 4GN8A 1DDXA 3HLIA 3V1SA 2VH6B 3ASIA 1JV2B 1K37A 2Y81B 1HCGB 2I9BA 3GCXE 3TH3L 4G1MB 1TPGA 1LMJA 2FD6A 1F0RB 2BQ7A 1ADXA 2W8BB 5L30L 2MHPA 3N8XA 2HQSA 4BTIA 1YUGA 3OLUA 1FFMA 1PJXA 1ATBA 2J34B 1EPJA 5CISA 2YGOA 3P5BL 4MMXB 5GX2A 1XFEA 5D9BA 1TOZA 1YUFA 1J9CL 3OLTA 1C9UA 3V65B 3Q7DA 2TGFA 1V04A 3KL6B 3RR3A 2XBWL 1CX2A 3GCWE 4BTTA 3TK6B 4DG6A 4RRXA 1EPGA 2P16L 4O5SA 3LI3A 3HO3A 3S8ZA 2FLBL 1IQFL 1N1IA 2WYGB 3CFWA 4AQTA 4X8TL 1NFYB 3BPSE 5CKNA 4A7IA 3V64C 3Q6PA 3DEMA 5EGMB 4YZUB 3HO5A 1DX5I 4IYGA 2DG1A 2Y5HL 4OTYA 4Z6AL 3LI4A 1NPEB 1IQKL 2BOXA 4MMZB 2P3FL 1MQ6L 2VWLL 4YT7L 2RA0L 3LN0A 4ZAEB 1A3PA 3SOQA 2EI7B 3WW9A 1YUKB 3M37L 5JB8E 2W2QE 1EMOA 4PWZA 5GX3A 2J38B 5E8DA 2NPRA 2VH0B 1PTHA 3HS7A 4RS0A 5IKQA 4X8VL 4CUFA 2H9EL 1CCVA 4HW6A 1UZKA 1NT0A 3Q6TA 4JMLA 5F19A 3A9HA 2XC0L 1HZ8A 4O02B 1OB1C 1RWIA 2B7DL 4A94C 3TZIA 1EGFA 5EX7A 3FW0A 2P94L 3K9XA 1RFNB 4COXA 1IQLL 1DQBA 2FLGA 2J94B 2DDUA 2UWOB 2KL7A 3TK5B 2FPBA 3HO4A 3N8WB 5GX5A 2Y7ZB 4XL1A 2WPLE 4RRWA 3G4HA 2P3TA 2KV4A 3LC5B 5D9CA 1GK5A 3KK6A 1F7MA 3GISX 1FAKL 2BZ6L 4C16A 1WHFA 1PFXL 1IQEL 3HRPA 1U8CB 2GVVA 1LPZA 4R40A 2Q1JB 1FE2A 2J4IB 2W3KB 4ZXXL 1EMNA 3SRGA 2W86A 4O1ZA 3N8VA 1UZPA 1CRUA 1PGEA 1G1SA 3TBDA 2GD4A 2ISMA 1APOA 2J2UB 4Q1UA 2QE8A 3F1SB 2XBXL 2W8BA 3ZYGA 3LC3B 5JW1A 1X7AL 1IVOC 2OYUP 3ENSA 2GVXA 3BT2A 4BXSA 3QH0A 1CQEA 2EI8B 1HAEA 2VVUL 4JYUL 4JZEL 1KIGL 4RRZA 2H9EC 4MMYB 3ELAL 1FSBA 2WPME 1YO8A 1QFKL 2WPJE 1KLIL 2MGRA 2WPKE 2Y7XB 1AUTL 2DSOA 3NTGA 1G1TA 2P26A 5JBBE 3KQEL 3LAQA 4Y71B 3BT1A 4GN9A 3QMOA 4IMBA 3ZYIB 2G00L 1EQHA 1EBVA 2V91A 3HS5A 1G2LB 3U73A 2RHPA 2XBVL 1IP0A 2IAOA 2P93L 3LTFB 4Z0LA 2W26B 1G1QA 4ZHAB 1N7DA 2VVCK 1P9JA 1TLEA 3LTGD 1IOXA 1ATAA 3HPTA 1CQ1A 2XBYL 3S6XA 2IAWA 3KYAA 3PGHA 2UWPB 2VAQA 3HLHA 4FM5A 1LQDA 4CUEA 2GHSA 2Y80B 3KQCL 3N8ZA 3U0SA 4ISHL 1ATEA 5KN5C 3G4EA 1EAIC 1NFXB 1G1RA 4X8SL 1M1XB 1W8BL 2M74A 5COXA 2Y5FL 3R05A 4D0EA 2FP9A 1LPGA 2F9BL 1L3YA 1NFUB 4Z0KB 4JZFL 2Y5GL 2POOA 1Z6EL 1BF9A 1Q4GA 2K2SB 3F6UL 1IQIL 2BQ6A 1FJSL 4NG9L 4Y7BB 4YT6L 2PR3B 3LIWB 5FWWA 2W2OE 1CVMA 2XC5L 3N8YB 1IOEL 1IQJL 5GTQA 2BQWA 1IQML 1FAXL 4M11A 3SOVA 2YGPA 5CKQA 2OYEP 3LI5A 2RNLA 2DG0A 1Z6CA 3N8WA 1URKA 4E1GA 5GX1A 4GN7A 1C5MF 1PXXA 4O5TA 5JBAE 3AMRA 2W2NE 2ADXA 2WPIE 4LMFA 5JVZA 1HT8A 5KIRA 2IATA 4HHOA 4PH9A 4ISIL 1ATDA 4NGAL 3E5ZA 1LPKA 5JVYA 2KNIA 3S2KA 2BOKL 1LMMA 2XC4L 1H6LA 2P3FN 2WZPP 4A0PA 3O4PA 1RWLA 3M36L 4XLWA 2Y82B 2VWNL 3I1CA 5IKTA 3IJEB 5JB9E 1Q7FA 2UWLB 2CJIB 4BXWA 1WHEA 1COUA 3KQBL 2IAQA 3NJPC 3N8YA 3FVZA 3KRKA 1HREA 4M10A 1NPEA 3A9GA 2K2TA 3ZYJB 2VVVL 1F0SB 4ZH8B 2Y38A 4ZLRA 2AYLA 1XKAL 4Y76B 3LN1A 4ZXYL 1EQGA 3CA7A 5D9DA 4RRYA 1SZBA 2BO2A 1KLOA 1W7XL 1MQ5L 1G2MB 1XDTR 1CVWL 2W2PE 4OTJA 2IAUA 4BDWA 3NT1A 5CKMA 5I46L 5GX4A 5L2ZL 1EZQB 1POOA 2IAPA 1NQLB 1WU1B 3POYA 3CENL 3U7UG 3C9AC 4Y6DB 1C5KA 3KQDL 1IJQA 2FPCA 3MDLA 2WFTA 2GVUA 3Q3KB 5K0HB 3TC9A 3SREA 6COXA 1CVUA 2EI6B 1QBIA 4JYVL 2FZZL 4TGFA 1V3XB 3IITB 2JKHL 1E1AA 3BYCA 1HAFA 1APQA 2J95B 5F1AA 4GNCA 4NA9L 1MOXC 1EPIA 1HT5A 1QLGA 3FFGL 2IVZA 1EPHA 3KCGL 2FLRL 3CS7L 4LORA 1NFWB 4HHQA 3SW2A 1IGZA 4RUTA 2OJHA 2IAVA 2P28B 1JBUL 1IGXA 2PUQL 1IQNL 1U67A 1DIYA 3TGFA 2WPHE 2FP8A 2VJ3A 3S94A 1L5GB 3H5CB 3QCWA 2WFXB 5IKRA 2BOUA 2BOHA 4X8UL 1PRHA 1XKBA 2P3UA 3FCSB 1K36A 1I0UA 1KSNB 4Y7AB 5IKVA 2IAXA 1CEJA 2VWOL 2P4OA 2WG4B 2I9AA 4JZDL 4GNBA 2MGPA 1KLJL 2IARA 2W3IB 5FDQA 4BDXA 2PHBB 1HX2A 1O5DL 3SOBB 1NZIA 2BMGA 5L2YL 4CSYA 3AMSA 2W2ME 1IQGL 1IQHL 1CCFA 2YGQA 1HRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRZ A;  3IAX A;  3HS6 A;  3WWA A;  1ZAQ A;  4CUD A;  1FF7 A;  1F7E A;  3Q6K A;  2VWM K;  1JL9 A;  3DR2 A;  4BTU A;  4XBM A;  4D0F A;  4GNA A;  1P0S L;  2G8S A;  3EGF A;  3NTB A;  2IAS A;  5JBC E;  3FBY A;  2KB9 A;  3DAS A;  1B9W A;  3KGG A;  2WG3 C;  2D1J B;  2P95 L;  4Y79 B;  2GVW A;  1HJ7 A;  1UZQ A;  3MQE A;  4D90 A;  3S8V A;  1DVA L;  1YGC L;  1UZJ A;  2WYJ B;  4GN8 A;  1DDX A;  3HLI A;  3V1S A;  2VH6 B;  3ASI A;  1JV2 B;  1K37 A;  2Y81 B;  1HCG B;  2I9B A;  3GCX E;  3TH3 L;  4G1M B;  1TPG A;  1LMJ A;  2FD6 A;  1F0R B;  2BQ7 A;  1ADX A;  2W8B B;  5L30 L;  2MHP A;  3N8X A;  2HQS A;  4BTI A;  1YUG A;  3OLU A;  1FFM A;  1PJX A;  1ATB A;  2J34 B;  1EPJ A;  5CIS A;  2YGO A;  3P5B L;  4MMX B;  5GX2 A;  1XFE A;  5D9B A;  1TOZ A;  1YUF A;  1J9C L;  3OLT A;  1C9U A;  3V65 B;  3Q7D A;  2TGF A;  1V04 A;  3KL6 B;  3RR3 A;  2XBW L;  1CX2 A;  3GCW E;  4BTT A;  3TK6 B;  4DG6 A;  4RRX A;  1EPG A;  2P16 L;  4O5S A;  3LI3 A;  3HO3 A;  3S8Z A;  2FLB L;  1IQF L;  1N1I A;  2WYG B;  3CFW A;  4AQT A;  4X8T L;  1NFY B;  3BPS E;  5CKN A;  4A7I A;  3V64 C;  3Q6P A;  3DEM A;  5EGM B;  4YZU B;  3HO5 A;  1DX5 I;  4IYG A;  2DG1 A;  2Y5H L;  4OTY A;  4Z6A L;  3LI4 A;  1NPE B;  1IQK L;  2BOX A;  4MMZ B;  2P3F L;  1MQ6 L;  2VWL L;  4YT7 L;  2RA0 L;  3LN0 A;  4ZAE B;  1A3P A;  3SOQ A;  2EI7 B;  3WW9 A;  1YUK B;  3M37 L;  5JB8 E;  2W2Q E;  1EMO A;  4PWZ A;  5GX3 A;  2J38 B;  5E8D A;  2NPR A;  2VH0 B;  1PTH A;  3HS7 A;  4RS0 A;  5IKQ A;  4X8V L;  4CUF A;  2H9E L;  1CCV A;  4HW6 A;  1UZK A;  1NT0 A;  3Q6T A;  4JML A;  5F19 A;  3A9H A;  2XC0 L;  1HZ8 A;  4O02 B;  1OB1 C;  1RWI A;  2B7D L;  1EGF A;  3TZI A;  5EX7 A;  3FW0 A;  2P94 L;  3K9X A;  1RFN B;  4COX A;  1IQL L;  1DQB A;  2FLG A;  2J94 B;  2DDU A;  2UWO B;  2KL7 A;  3TK5 B;  2FPB A;  3HO4 A;  3N8W B;  5GX5 A;  2Y7Z B;  4XL1 A;  2WPL E;  4RRW A;  3G4H A;  2P3T A;  2KV4 A;  3LC5 B;  5D9C A;  1GK5 A;  3KK6 A;  1F7M A;  3GIS X;  1FAK L;  2BZ6 L;  4C16 A;  1WHF A;  1PFX L;  1IQE L;  3HRP A;  1U8C B;  2GVV A;  1LPZ A;  4R40 A;  2Q1J B;  1FE2 A;  2J4I B;  2W3K B;  4ZXX L;  1EMN A;  3SRG A;  2W86 A;  4O1Z A;  3N8V A;  1UZP A;  1CRU A;  1PGE A;  1G1S A;  3TBD A;  2GD4 A;  2ISM A;  1APO A;  2J2U B;  4Q1U A;  2QE8 A;  3F1S B;  2XBX L;  2W8B A;  3ZYG A;  3LC3 B;  5JW1 A;  1X7A L;  1IVO C;  2OYU P;  3ENS A;  2GVX A;  3BT2 A;  4BXS A;  3QH0 A;  1CQE A;  2EI8 B;  1HAE A;  2VVU L;  4JYU L;  4JZE L;  1KIG L;  4RRZ A;  4MMY B;  3ELA L;  1FSB A;  2WPM E;  1YO8 A;  1QFK L;  2WPJ E;  1KLI L;  2MGR A;  2WPK E;  2Y7X B;  1AUT L;  2DSO A;  3NTG A;  1G1T A;  2P26 A;  5JBB E;  3KQE L;  3LAQ A;  4Y71 B;  3BT1 A;  4GN9 A;  3QMO A;  4IMB A;  3ZYI B;  2G00 L;  1EQH A;  1EBV A;  2V91 A;  3HS5 A;  1G2L B;  3U73 A;  2RHP A;  2XBV L;  1IP0 A;  2IAO A;  2P93 L;  3LTF B;  4Z0L A;  2W26 B;  1G1Q A;  4ZHA B;  1N7D A;  2VVC K;  1P9J A;  1TLE A;  3LTG D;  1IOX A;  1ATA A;  3HPT A;  1CQ1 A;  2XBY L;  2IAW A;  3KYA A;  3PGH A;  2UWP B;  2VAQ A;  3HLH A;  4FM5 A;  1LQD A;  4CUE A;  2GHS A;  2Y80 B;  3KQC L;  3N8Z A;  3U0S A;  4ISH L;  1ATE A;  5KN5 C;  3G4E A;  1EAI C;  1NFX B;  1G1R A;  4X8S L;  1M1X B;  1W8B L;  2M74 A;  5COX A;  2Y5F L;  3R05 A;  4D0E A;  2FP9 A;  1LPG A;  2F9B L;  1L3Y A;  1NFU B;  4Z0K B;  4JZF L;  2Y5G L;  2POO A;  1Z6E L;  1BF9 A;  1Q4G A;  2K2S B;  3F6U L;  1IQI L;  2BQ6 A;  4NG9 L;  1FJS L;  4Y7B B;  4YT6 L;  2PR3 B;  3LIW B;  5FWW A;  2W2O E;  1CVM A;  2XC5 L;  3N8Y B;  1IOE L;  1IQJ L;  5GTQ A;  2BQW A;  1IQM L;  1FAX L;  4M11 A;  3SOV A;  2YGP A;  5CKQ A;  2OYE P;  3LI5 A;  2RNL A;  2DG0 A;  1Z6C A;  3N8W A;  1URK A;  4E1G A;  5GX1 A;  4GN7 A;  1C5M F;  1PXX A;  4O5T A;  5JBA E;  3AMR A;  2W2N E;  2ADX A;  2WPI E;  4LMF A;  5JVZ A;  1HT8 A;  5KIR A;  2IAT A;  4HHO A;  4PH9 A;  4ISI L;  1ATD A;  4NGA L;  3E5Z A;  1LPK A;  5JVY A;  3S2K A;  2BOK L;  2XC4 L;  1H6L A;  2P3F N;  4A0P A;  3O4P A;  1RWL A;  3M36 L;  4XLW A;  2Y82 B;  2VWN L;  3I1C A;  5IKT A;  3IJE B;  5JB9 E;  1Q7F A;  2UWL B;  2CJI B;  4BXW A;  1WHE A;  1COU A;  3KQB L;  2IAQ A;  3NJP C;  3N8Y A;  3FVZ A;  3KRK A;  1HRE A;  4M10 A;  1NPE A;  3A9G A;  2K2T A;  3ZYJ B;  2VVV L;  1F0S B;  4ZH8 B;  2Y38 A;  4ZLR A;  2AYL A;  1XKA L;  4Y76 B;  3LN1 A;  4ZXY L;  1EQG A;  3CA7 A;  5D9D A;  4RRY A;  1SZB A;  2BO2 A;  1KLO A;  1W7X L;  1MQ5 L;  1G2M B;  1XDT R;  1CVW L;  2W2P E;  4OTJ A;  2IAU A;  4BDW A;  3NT1 A;  5CKM A;  5I46 L;  5GX4 A;  5L2Z L;  1EZQ B;  1POO A;  2IAP A;  1NQL B;  1WU1 B;  3POY A;  3CEN L;  3U7U G;  3C9A C;  4Y6D B;  1C5K A;  3KQD L;  1IJQ A;  2FPC A;  3MDL A;  2WFT A;  2GVU A;  3Q3K B;  5K0H B;  3TC9 A;  3SRE A;  6COX A;  1CVU A;  2EI6 B;  1QBI A;  4JYV L;  2FZZ L;  4TGF A;  1V3X B;  3IIT B;  2JKH L;  1E1A A;  3BYC A;  1HAF A;  1APQ A;  2J95 B;  5F1A A;  4GNC A;  4NA9 L;  1MOX C;  1EPI A;  1HT5 A;  1QLG A;  3FFG L;  2IVZ A;  1EPH A;  3KCG L;  2FLR L;  3CS7 L;  4LOR A;  1NFW B;  4HHQ A;  3SW2 A;  1IGZ A;  4RUT A;  2OJH A;  2IAV A;  2P28 B;  1JBU L;  1IGX A;  2PUQ L;  1IQN L;  1U67 A;  1DIY A;  3TGF A;  2WPH E;  2FP8 A;  2VJ3 A;  3S94 A;  1L5G B;  3H5C B;  3QCW A;  2WFX B;  5IKR A;  2BOU A;  2BOH A;  4X8U L;  1PRH A;  1XKB A;  2P3U A;  3FCS B;  1K36 A;  1I0U A;  1KSN B;  4Y7A B;  5IKV A;  2IAX A;  1CEJ A;  2VWO L;  2P4O A;  2WG4 B;  2I9A A;  4JZD L;  4GNB A;  2MGP A;  1KLJ L;  2IAR A;  2W3I B;  5FDQ A;  4BDX A;  2PHB B;  1HX2 A;  1O5D L;  3SOB B;  1NZI A;  2BMG A;  5L2Y L;  4CSY A;  3AMS A;  2W2M E;  1IQG L;  1IQH L;  1CCF A;  1HRF A; 
#chains in the Genus database with same CATH topology
 1CRZ A;  1ZGK A;  3IAX A;  3HS6 A;  2BT7 A;  3WWA A;  1W8N A;  1ZAQ A;  4CUD A;  4G3N A;  4XJ8 A;  1FF7 A;  1F7E A;  1B9S A;  2VWM K;  1N1V A;  3Q6K A;  4ZGC A;  4XMI A;  1JL9 A;  1IVB A;  3DR2 A;  4BTU A;  5B2C A;  4XBM A;  4D0F A;  1N1T A;  1P0S L;  2G8S A;  2YA4 A;  4GNA A;  3EGF A;  5HUG A;  3NTB A;  2IAS A;  3UC1 A;  4K1J A;  5JBC E;  3FBY A;  2KB9 A;  3DAS A;  4FOY A;  1B9W A;  3KGG A;  2WG3 C;  3K38 A;  2D1J B;  2P95 L;  3CL2 A;  4MWX A;  4Y79 B;  2GVW A;  1HJ7 A;  3ALW A;  2ZB5 A;  4GU3 A;  1NSC A;  1UZQ A;  4FPO B;  4XJR A;  4GJT A;  3VNG A;  3MQE A;  3OPZ A;  4D90 A;  2VW1 A;  4X47 A;  1DVA L;  3S8V A;  1YGC L;  4FPG A;  4QNP A;  1UZJ A;  2WYJ B;  1X2R A;  2X9M A;  4GN8 A;  1DDX A;  3HLI A;  3V1S A;  2VH6 B;  3ASI A;  4AHA A;  1MS0 A;  1JV2 B;  1K37 A;  2Y81 B;  1INX A;  1N6F A;  1HCG B;  2I9B A;  3GCX E;  3TH3 L;  2HT8 A;  3GVL A;  4H52 A;  4G1M B;  1TPG A;  2SLI A;  1LMJ A;  2FD6 A;  4KS4 A;  1F0R B;  3K36 A;  5FNT A;  4CSD A;  1Z4V A;  2BQ7 A;  2XZK A;  4XJ9 A;  4K1I A;  1ADX A;  4FPY A;  2W8B B;  5L30 L;  2MHP A;  3N8X A;  2HQS A;  4BTI A;  4QN7 A;  1V3E A;  4XHX A;  2HTQ A;  1YUG A;  3OLU A;  1INW A;  1FFM A;  1PJX A;  1ATB A;  2J34 B;  3TI3 A;  1EPJ A;  5CIS A;  2YGO A;  3P5B L;  1BJI A;  4MMX B;  2W5O A;  4ASC A;  2C4L A;  5GX2 A;  1XFE A;  2W38 A;  5D9B A;  1TOZ A;  1YUF A;  1J9C L;  3OLT A;  2BSF A;  1C9U A;  4FJ6 A;  3V65 B;  1IUC A;  3Q7D A;  4XJW A;  2TGF A;  1V04 A;  3KL6 B;  4MWW A;  3RR3 A;  5FNS A;  2XBW L;  2VK7 A;  1CX2 A;  3GCW E;  4BTT A;  4IFL X;  4D52 A;  1OFZ A;  3TK6 B;  4DG6 A;  4RRX A;  2F26 A;  4B7R A;  2ZWA A;  1W0P A;  2FLU X;  1EPG A;  2P16 L;  2QWC A;  3LI3 A;  4MJV A;  3HO3 A;  4O5S A;  3S8Z A;  2QWF A;  3TIA A;  1EUU A;  2FLB L;  1IQF L;  3D12 A;  1V1I A;  2BER A;  1N1I A;  4L7B A;  2HTV A;  2WYG B;  3CFW A;  4AQT A;  1USR A;  4X8T L;  4QN5 A;  1V0F A;  1V3D A;  5EO7 A;  1NFY B;  3BPS E;  2BF6 A;  3GVJ A;  5CKN A;  4A7I A;  1MS8 A;  3V64 C;  3Q6P A;  3DEM A;  5EGM B;  4YZU B;  4GB1 A;  4XMA A;  4MC7 A;  3HO5 A;  5FNQ A;  1DX5 I;  2YDP A;  2DG1 A;  4FOQ A;  2Y5H L;  2AH2 A;  3O9K A;  4IYG A;  4OTY A;  1EUT A;  4Z6A L;  3LI4 A;  4CPZ A;  1NPE B;  4QN4 A;  1W8O A;  1IQK L;  2BOX A;  3BEQ A;  2RKC A;  2SIL A;  4MMZ B;  2P3F L;  1MQ6 L;  2VWL L;  4YT7 L;  2RA0 L;  3LN0 A;  4ZAE B;  1A3P A;  2HU4 A;  3SOQ A;  2EI7 B;  3WW9 A;  3SIL A;  1YUK B;  3M37 L;  5JB8 E;  2W2Q E;  1EMO A;  1NCC N;  4PWZ A;  1QIU A;  2J38 B;  2Z32 A;  3NO0 A;  5GX3 A;  3K39 A;  5E8D A;  5EO8 A;  2NPR A;  2VH0 B;  3H73 A;  4HZY A;  1E8U A;  1PTH A;  6NN9 A;  3HS7 A;  4RS0 A;  5IKQ A;  4M4U A;  4X8V L;  4CUF A;  4SLI A;  2H9E L;  1CCV A;  1A14 N;  1MS3 A;  4HW6 A;  4XJQ A;  5NN9 A;  1UZK A;  1NT0 A;  1DIM A;  1SUU A;  1V2I A;  2QWK A;  3Q6T A;  4JML A;  1E8T A;  2FHR A;  3TI5 A;  5F19 A;  3A9H A;  2BAT A;  2XC0 L;  1HZ8 A;  4O02 B;  1OB1 C;  1L7H A;  1RWI A;  2B7D L;  4A94 C;  3TZI A;  1EGF A;  4FOW A;  4FP2 A;  2VSK A;  4YW2 A;  4QN3 A;  4MWU A;  5EX7 A;  1NNB A;  3FW0 A;  2P94 L;  3K9X A;  1NNC A;  3D11 A;  1RFN B;  4COX A;  1IQL L;  1EUS A;  1DQB A;  2FLG A;  3O9J A;  2YDT A;  2J94 B;  2DDU A;  2UWO B;  2VK6 A;  2KL7 A;  3TK5 B;  2F27 A;  4FPF A;  4KS3 A;  2FPB A;  2F13 A;  5M1Z A;  3HO4 A;  1F8B A;  3N8W B;  5GX5 A;  2Y7Z B;  4XL1 A;  4GZX A;  4CH9 A;  2WPL E;  4RRW A;  3G4H A;  2P3T A;  2KV4 A;  1S0J A;  1VCU A;  5FZN A;  4B7M A;  3LC5 B;  2CML A;  4M3M A;  5D9C A;  1GK5 A;  3KK6 A;  1F7M A;  2HU0 A;  3GIS X;  4XHB A;  1FAK L;  2BZ6 L;  4XOG A;  4C16 A;  4YW1 A;  4CPL A;  2F10 A;  1WHF A;  1PFX L;  2QWI A;  1IQE L;  4WEF A;  3HRP A;  1U8C B;  2GVV A;  1LPZ A;  1V0Z A;  4R40 A;  4D8S A;  2Q1J B;  1FE2 A;  2J4I B;  2W3K B;  1INH A;  1V3C A;  4ZXX L;  2XZJ A;  3H71 A;  1EMN A;  2JJL A;  2W86 A;  4O1Z A;  4GZW A;  3SRG A;  3N8V A;  1UZP A;  1CRU A;  4MWV A;  1PGE A;  1G1S A;  3TBD A;  5HUM A;  5CGJ A;  1NCB N;  2GD4 A;  4FP3 A;  2ISM A;  1APO A;  3CL0 A;  4ZY3 A;  2J2U B;  4AGI A;  2F25 A;  4Q1U A;  2QE8 A;  3F1S B;  3ZGC A;  2XBX L;  3SLI A;  2W8B A;  3ZYG A;  3LC3 B;  2VRS A;  5JW1 A;  1W1X A;  1LK9 A;  1X7A L;  1E8V A;  2VSM A;  1NCD N;  1L7G A;  1IVO C;  2OYU P;  3ENS A;  2GVX A;  1IVG A;  2HOR A;  3BT2 A;  4BXS A;  2YA6 A;  3QH0 A;  1S0I A;  1CQE A;  5F9T A;  2AEP A;  3SAN A;  2EI8 B;  1K32 A;  1HAE A;  4XE9 A;  2VVU L;  4JYU L;  4JZE L;  1KIG L;  4RRZ A;  1NCA N;  4Q6K A;  2H9E C;  4MMY B;  3ELA L;  4N1B A;  4YZ2 A;  4GZO A;  1FSB A;  2WPM E;  1Z4Y A;  1INV A;  2QWJ A;  1YO8 A;  4CPN A;  4CPM A;  1QFK L;  2WPJ E;  1KLI L;  2MGR A;  2WPK E;  5FZJ A;  2Y7X B;  1AUT L;  3H72 A;  2DSO A;  5B2D A;  3NTG A;  1G1T A;  2P26 A;  1B9V A;  4MWJ A;  5JBB E;  3KQE L;  1NMB N;  1A4G A;  1Z4X A;  1MS4 A;  2VPJ A;  3LAQ A;  4XJZ A;  3GVK A;  4Y71 B;  3TI6 A;  3BT1 A;  2ZB6 A;  4IFJ A;  4GN9 A;  2H2N A;  1U6D X;  1V3B A;  3QMO A;  7NN9 A;  1IVD A;  4IMB A;  3TIC A;  3VNH A;  3ZYI B;  2G00 L;  1EQH A;  1EBV A;  2V91 A;  3HS5 A;  1KIT A;  1G2L B;  3U73 A;  2RHP A;  2XBV L;  1IP0 A;  2IAO A;  4IN4 A;  2P93 L;  3LTF B;  4Z0L A;  2W26 B;  1N1S A;  1G1Q A;  4ZHA B;  1N7D A;  2VVC K;  1SLI A;  1P9J A;  1TLE A;  3LTG D;  1NSD A;  1IOX A;  4GEZ A;  1ATA A;  4M4N A;  3HPT A;  1CQ1 A;  2XBY L;  3S6X A;  2QWB A;  2QWE A;  4QN6 A;  4H53 A;  4HZX A;  4JF7 A;  2HTY A;  2IAW A;  3KYA A;  3PGH A;  2UWP B;  2VAQ A;  4MWR A;  3HLH A;  4FM5 A;  4I00 A;  3II7 A;  3TIB A;  4FZH A;  4FVK A;  4MJU A;  4XMB A;  1LQD A;  4CUE A;  2GHS A;  1N6E A;  3K37 A;  2Y80 B;  3KQC L;  3NN9 A;  2F24 A;  3N8Z A;  3U0S A;  4YZ4 A;  2QWD A;  2BT8 A;  4X6K A;  3W09 A;  4ISH L;  1B9T A;  2XN4 A;  3A72 A;  3H6J A;  4YZ3 A;  1ATE A;  4FPJ A;  5KN5 C;  3G4E A;  1EAI C;  1NFX B;  4FPE A;  1G1R A;  1W0O A;  2YA8 A;  4X8S L;  4NC5 A;  1M1X B;  4AH4 A;  4X4A A;  1W8B L;  2M74 A;  5COX A;  4WA5 A;  1NSB A;  1N6D A;  3L6V A;  2Y5F L;  3R05 A;  4FOV A;  4D0E A;  2FP9 A;  1LPG A;  5FNR A;  3SAL A;  2F9B L;  1L3Y A;  1NFU B;  4Z0K B;  4L7D A;  4JZF L;  1WCS A;  2Y5G L;  2POO A;  1Z6E L;  1BF9 A;  3JU4 A;  1F8C A;  1Q4G A;  2K2S B;  2HOX A;  3F6U L;  1INF A;  2AEQ A;  1IQI L;  2BQ6 A;  1FJS L;  4NG9 L;  4Y7B B;  4YT6 L;  5FNU A;  1MS9 A;  2PR3 B;  3LIW B;  2XCY A;  1MZ5 A;  5FWW A;  2JKB A;  2W2O E;  2ZW9 A;  1CVM A;  2XC5 L;  3N8Y B;  3B69 A;  4XIO A;  2ZZK A;  1IOE L;  1IQJ L;  5GTQ A;  2BQW A;  1IQM L;  1FAX L;  4M11 A;  3SOV A;  2YGP A;  1X2J A;  3WDZ A;  5CKQ A;  2OYE P;  3LI5 A;  1IVF A;  2RNL A;  2DG0 A;  5HUN A;  2F11 A;  1Z6C A;  3N8W A;  1URK A;  1WP5 A;  3B7E A;  4E1G A;  3CKZ A;  5GX1 A;  4GN7 A;  1C5M F;  1PXX A;  4J9T A;  4NCS A;  4O5T A;  5JBA E;  3AMR A;  2W2N E;  1EUR A;  2ADX A;  4GZQ A;  4K3Y A;  2WPI E;  4LMF A;  1MS1 A;  2AGS A;  5HX0 A;  5JVZ A;  1HT8 A;  4K1K A;  5KIR A;  2IAT A;  3ALX A;  4HHO A;  4YW3 A;  4PH9 A;  1IVC A;  1IVE A;  4XJA A;  4ISI L;  1ATD A;  4NGA L;  2F28 A;  3E5Z A;  4HZV A;  2QWA A;  1LPK A;  4XJU A;  4YW5 A;  5JVY A;  2VWD A;  2KNI A;  4KS2 A;  2BOK L;  1LMM A;  2XC4 L;  3S2K A;  1H6L A;  1Z4Z A;  2P3F N;  2WZP P;  4A0P A;  3O4P A;  1RWL A;  1KKE A;  4FPC A;  3M36 L;  1MR5 A;  4XLW A;  2Y82 B;  2VWN L;  4MWL A;  3I1C A;  2QWH A;  4GZT A;  4MWY A;  5IKT A;  4NN9 A;  3IJE B;  4HZW A;  5JB9 E;  1Q7F A;  4XIL A;  2UWL B;  2CJI B;  4BXW A;  1WHE A;  1COU A;  3KQB L;  1MZ6 A;  3NJP C;  1SNT A;  3N8Y A;  2IAQ A;  2XZI A;  1USX A;  4KS1 A;  4WA4 A;  3FVZ A;  3KRK A;  1HRE A;  4M10 A;  1NPE A;  3A9G A;  2K2T A;  3ZYJ B;  4M4V A;  2VVV L;  1F0S B;  3T1E A;  2SIM A;  2W20 A;  3TI4 A;  1INY A;  4ZH8 B;  4GZS A;  2Y38 A;  4ZLR A;  3ADE A;  2AYL A;  1MWE A;  1XKA L;  4Y76 B;  3LN1 A;  4X49 A;  4ZXY L;  1NN2 A;  1EQG A;  2A75 A;  3CA7 A;  5D9D A;  4RRY A;  3CYE A;  4GDI A;  1SZB A;  1NMC A;  2BO2 A;  1KLO A;  3INB A;  4B7J A;  1W7X L;  3A71 A;  1MQ5 L;  1NMA N;  4AGT A;  1G2M B;  1XDT R;  4YZ1 A;  1CVW L;  2W2P E;  4OTJ A;  2BZD A;  2IAU A;  4BDW A;  4FQ4 A;  3NT1 A;  5CKM A;  5I46 L;  5GX4 A;  3WN7 A;  5L2Z L;  1EZQ B;  1POO A;  5F72 C;  1IUB A;  1SO7 A;  1NQL B;  2IAP A;  4YZ5 A;  1WU1 B;  3POY A;  1V1H A;  3CEN L;  5JYY A;  3U7U G;  3C9A C;  4CPO A;  1ING A;  4Y6D B;  4XYX A;  1C5K A;  3KQD L;  2HTU A;  2B8H A;  1IJQ A;  4MX0 A;  4D52 C;  2FPC A;  3MDL A;  2WFT A;  2GVU A;  3Q3K B;  4D52 B;  5K0H B;  1VCJ A;  3TC9 A;  4WEG A;  1DIL A;  2QWG A;  3K3A A;  3SRE A;  6COX A;  1CVU A;  2EI6 B;  1QBI A;  4BBW A;  1S18 A;  2VW0 A;  4JYV L;  2FZZ L;  2VW2 A;  4TGF A;  1V3X B;  3IIT B;  4HZZ A;  4L7C A;  2VVZ A;  2JKH L;  1E1A A;  1ZI0 A;  3BYC A;  3TI8 A;  1HAF A;  2W5N A;  1APQ A;  4WA3 A;  2YA5 A;  3NSS A;  4IQK A;  2J95 B;  1Z4W A;  5F1A A;  4GNC A;  4NA9 L;  1MOX C;  1EPI A;  1HT5 A;  1QLG A;  4YW4 A;  3FFG L;  2HT7 A;  2IVZ A;  1EPH A;  2C4A A;  3KCG L;  2FLR L;  3CS7 L;  1XOG A;  4LOR A;  1NFW B;  2YA7 A;  4MWQ A;  4HHQ A;  3SW2 A;  1IGZ A;  4RUT A;  2OJH A;  4GZP A;  2VK5 A;  4XIK A;  2IAV A;  1WCQ A;  2P28 B;  3PJQ A;  4KS5 A;  1JBU L;  1N1Y A;  2DYH A;  1IGX A;  2HT5 A;  2PUQ L;  4B7N A;  1W21 A;  1IQN L;  4C1Y A;  2WOZ A;  1U67 A;  1DIY A;  2F12 A;  3TGF A;  1W20 A;  2WPH E;  2FP8 A;  4DGR A;  2VJ3 A;  1SLL A;  1Z50 A;  1XOE A;  3S94 A;  4CHB A;  1L5G B;  3H5C B;  2HTR A;  3QCW A;  2WFX B;  5IKR A;  2BOU A;  2BOH A;  4X8U L;  5HUK A;  1PRH A;  1V0E A;  1XKB A;  2P3U A;  4CPY A;  3FCS B;  2HTW A;  4YY8 A;  1K36 A;  1I0U A;  1MS5 A;  4D4U A;  1KSN B;  4Y7A B;  5IKV A;  4MZE A;  2IAX A;  1CEJ A;  2VWO L;  3ZGD A;  4B7Q A;  4K1H A;  2H2U A;  1A4Q A;  4HIZ A;  4MZA A;  2P4O A;  1F8E A;  2WG4 B;  2I9A A;  4JZD L;  1NNA A;  4GNB A;  2MGP A;  2F0Z A;  4FPL A;  4C1Y B;  4UF7 A;  1KLJ L;  2IAR A;  2F29 A;  4UOU A;  4IFN X;  2W3I B;  5FDQ A;  4BDX A;  2PHB B;  1HX2 A;  1O5D L;  4FPK A;  3SOB B;  5H47 A;  1S1D A;  1NZI A;  1L7F A;  4GDJ A;  2BMG A;  5L2Y L;  4CSY A;  1F8D A;  3AMS A;  2W2M E;  4GU4 A;  1IQG L;  4FPH A;  1IQH L;  1CCF A;  2YGQ A;  1HRF A; 
#chains in the Genus database with same CATH homology
 1CRZ A;  3IAX A;  3HS6 A;  3WWA A;  1ZAQ A;  4CUD A;  1FF7 A;  1F7E A;  3Q6K A;  2VWM K;  1JL9 A;  3DR2 A;  4BTU A;  4XBM A;  4D0F A;  4GNA A;  1P0S L;  2G8S A;  3EGF A;  3NTB A;  2IAS A;  5JBC E;  3FBY A;  2KB9 A;  3DAS A;  1B9W A;  3KGG A;  2WG3 C;  2D1J B;  2P95 L;  4Y79 B;  2GVW A;  1HJ7 A;  1UZQ A;  3MQE A;  4D90 A;  3S8V A;  1DVA L;  1YGC L;  1UZJ A;  2WYJ B;  4GN8 A;  1DDX A;  3HLI A;  3V1S A;  2VH6 B;  3ASI A;  1JV2 B;  1K37 A;  2Y81 B;  1HCG B;  2I9B A;  3GCX E;  3TH3 L;  4G1M B;  1TPG A;  1LMJ A;  2FD6 A;  1F0R B;  2BQ7 A;  1ADX A;  2W8B B;  5L30 L;  2MHP A;  3N8X A;  2HQS A;  4BTI A;  1YUG A;  3OLU A;  1FFM A;  1PJX A;  1ATB A;  2J34 B;  1EPJ A;  5CIS A;  2YGO A;  3P5B L;  4MMX B;  5GX2 A;  1XFE A;  5D9B A;  1TOZ A;  1YUF A;  1J9C L;  3OLT A;  1C9U A;  3V65 B;  3Q7D A;  2TGF A;  1V04 A;  3KL6 B;  3RR3 A;  2XBW L;  1CX2 A;  3GCW E;  4BTT A;  3TK6 B;  4DG6 A;  4RRX A;  1EPG A;  2P16 L;  4O5S A;  3LI3 A;  3HO3 A;  3S8Z A;  2FLB L;  1IQF L;  1N1I A;  2WYG B;  3CFW A;  4AQT A;  4X8T L;  1NFY B;  3BPS E;  5CKN A;  4A7I A;  3V64 C;  3Q6P A;  3DEM A;  5EGM B;  4YZU B;  3HO5 A;  1DX5 I;  4IYG A;  2DG1 A;  2Y5H L;  4OTY A;  4Z6A L;  3LI4 A;  1NPE B;  1IQK L;  2BOX A;  4MMZ B;  2P3F L;  1MQ6 L;  2VWL L;  4YT7 L;  2RA0 L;  3LN0 A;  4ZAE B;  1A3P A;  3SOQ A;  2EI7 B;  3WW9 A;  1YUK B;  3M37 L;  5JB8 E;  2W2Q E;  1EMO A;  4PWZ A;  5GX3 A;  2J38 B;  5E8D A;  2NPR A;  2VH0 B;  1PTH A;  3HS7 A;  4RS0 A;  5IKQ A;  4X8V L;  4CUF A;  2H9E L;  1CCV A;  4HW6 A;  1UZK A;  1NT0 A;  3Q6T A;  4JML A;  5F19 A;  3A9H A;  2XC0 L;  1HZ8 A;  4O02 B;  1OB1 C;  1RWI A;  2B7D L;  4A94 C;  3TZI A;  1EGF A;  5EX7 A;  3FW0 A;  2P94 L;  3K9X A;  1RFN B;  4COX A;  1IQL L;  1DQB A;  2FLG A;  2J94 B;  2DDU A;  2UWO B;  2KL7 A;  3TK5 B;  2FPB A;  3HO4 A;  3N8W B;  5GX5 A;  2Y7Z B;  4XL1 A;  2WPL E;  4RRW A;  3G4H A;  2P3T A;  2KV4 A;  3LC5 B;  5D9C A;  1GK5 A;  3KK6 A;  1F7M A;  3GIS X;  1FAK L;  2BZ6 L;  4C16 A;  1WHF A;  1PFX L;  1IQE L;  3HRP A;  1U8C B;  2GVV A;  1LPZ A;  4R40 A;  2Q1J B;  1FE2 A;  2J4I B;  2W3K B;  4ZXX L;  1EMN A;  3SRG A;  2W86 A;  4O1Z A;  3N8V A;  1UZP A;  1CRU A;  1PGE A;  1G1S A;  3TBD A;  2GD4 A;  2ISM A;  1APO A;  2J2U B;  4Q1U A;  2QE8 A;  3F1S B;  2XBX L;  2W8B A;  3ZYG A;  3LC3 B;  5JW1 A;  1X7A L;  1IVO C;  2OYU P;  3ENS A;  2GVX A;  3BT2 A;  4BXS A;  3QH0 A;  1CQE A;  2EI8 B;  1HAE A;  2VVU L;  4JYU L;  4JZE L;  1KIG L;  4RRZ A;  2H9E C;  4MMY B;  3ELA L;  1FSB A;  2WPM E;  1YO8 A;  1QFK L;  2WPJ E;  1KLI L;  2MGR A;  2WPK E;  2Y7X B;  1AUT L;  2DSO A;  3NTG A;  1G1T A;  2P26 A;  5JBB E;  3KQE L;  3LAQ A;  4Y71 B;  3BT1 A;  4GN9 A;  3QMO A;  4IMB A;  3ZYI B;  2G00 L;  1EQH A;  1EBV A;  2V91 A;  3HS5 A;  1G2L B;  3U73 A;  2RHP A;  2XBV L;  1IP0 A;  2IAO A;  2P93 L;  3LTF B;  4Z0L A;  2W26 B;  1G1Q A;  4ZHA B;  1N7D A;  2VVC K;  1P9J A;  1TLE A;  3LTG D;  1IOX A;  1ATA A;  3HPT A;  1CQ1 A;  2XBY L;  3S6X A;  2IAW A;  3KYA A;  3PGH A;  2UWP B;  2VAQ A;  3HLH A;  4FM5 A;  1LQD A;  4CUE A;  2GHS A;  2Y80 B;  3KQC L;  3N8Z A;  3U0S A;  4ISH L;  1ATE A;  5KN5 C;  3G4E A;  1EAI C;  1NFX B;  1G1R A;  4X8S L;  1M1X B;  1W8B L;  2M74 A;  5COX A;  2Y5F L;  3R05 A;  4D0E A;  2FP9 A;  1LPG A;  2F9B L;  1L3Y A;  1NFU B;  4Z0K B;  4JZF L;  2Y5G L;  2POO A;  1Z6E L;  1BF9 A;  1Q4G A;  2K2S B;  3F6U L;  1IQI L;  2BQ6 A;  1FJS L;  4NG9 L;  4Y7B B;  4YT6 L;  2PR3 B;  3LIW B;  5FWW A;  2W2O E;  1CVM A;  2XC5 L;  3N8Y B;  1IOE L;  1IQJ L;  5GTQ A;  2BQW A;  1IQM L;  1FAX L;  4M11 A;  3SOV A;  2YGP A;  5CKQ A;  2OYE P;  3LI5 A;  2RNL A;  2DG0 A;  1Z6C A;  3N8W A;  1URK A;  4E1G A;  5GX1 A;  4GN7 A;  1C5M F;  1PXX A;  4O5T A;  5JBA E;  3AMR A;  2W2N E;  2ADX A;  2WPI E;  4LMF A;  5JVZ A;  1HT8 A;  5KIR A;  2IAT A;  4HHO A;  4PH9 A;  4ISI L;  1ATD A;  4NGA L;  3E5Z A;  1LPK A;  5JVY A;  2KNI A;  3S2K A;  2BOK L;  1LMM A;  2XC4 L;  1H6L A;  2P3F N;  2WZP P;  4A0P A;  3O4P A;  1RWL A;  3M36 L;  4XLW A;  2Y82 B;  2VWN L;  3I1C A;  5IKT A;  3IJE B;  5JB9 E;  1Q7F A;  2UWL B;  2CJI B;  4BXW A;  1WHE A;  1COU A;  3KQB L;  2IAQ A;  3NJP C;  3N8Y A;  3FVZ A;  3KRK A;  1HRE A;  4M10 A;  1NPE A;  3A9G A;  2K2T A;  3ZYJ B;  2VVV L;  1F0S B;  4ZH8 B;  2Y38 A;  4ZLR A;  2AYL A;  1XKA L;  4Y76 B;  3LN1 A;  4ZXY L;  1EQG A;  3CA7 A;  5D9D A;  4RRY A;  1SZB A;  2BO2 A;  1KLO A;  1W7X L;  1MQ5 L;  1G2M B;  1XDT R;  1CVW L;  2W2P E;  4OTJ A;  2IAU A;  4BDW A;  3NT1 A;  5CKM A;  5I46 L;  5GX4 A;  5L2Z L;  1EZQ B;  1POO A;  2IAP A;  1NQL B;  1WU1 B;  3POY A;  3CEN L;  3U7U G;  3C9A C;  4Y6D B;  1C5K A;  3KQD L;  1IJQ A;  2FPC A;  3MDL A;  2WFT A;  2GVU A;  3Q3K B;  5K0H B;  3TC9 A;  3SRE A;  6COX A;  1CVU A;  2EI6 B;  1QBI A;  4JYV L;  2FZZ L;  4TGF A;  1V3X B;  3IIT B;  2JKH L;  1E1A A;  3BYC A;  1HAF A;  1APQ A;  2J95 B;  5F1A A;  4GNC A;  4NA9 L;  1MOX C;  1EPI A;  1HT5 A;  1QLG A;  3FFG L;  2IVZ A;  1EPH A;  3KCG L;  2FLR L;  3CS7 L;  4LOR A;  1NFW B;  4HHQ A;  3SW2 A;  1IGZ A;  4RUT A;  2OJH A;  2IAV A;  2P28 B;  1JBU L;  1IGX A;  2PUQ L;  1IQN L;  1U67 A;  1DIY A;  3TGF A;  2WPH E;  2FP8 A;  2VJ3 A;  3S94 A;  1L5G B;  3H5C B;  3QCW A;  2WFX B;  5IKR A;  2BOU A;  2BOH A;  4X8U L;  1PRH A;  1XKB A;  2P3U A;  3FCS B;  1K36 A;  1I0U A;  1KSN B;  4Y7A B;  5IKV A;  2IAX A;  1CEJ A;  2VWO L;  2P4O A;  2WG4 B;  2I9A A;  4JZD L;  4GNB A;  2MGP A;  1KLJ L;  2IAR A;  2W3I B;  5FDQ A;  4BDX A;  2PHB B;  1HX2 A;  1O5D L;  3SOB B;  1NZI A;  2BMG A;  5L2Y L;  4CSY A;  3AMS A;  2W2M E;  1IQG L;  1IQH L;  1CCF A;  2YGQ A;  1HRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...