3V65B

Crystal structure of agrin and lrp4 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
335
structure length
330
Chain Sequence
YCSQGCTFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Agrin
publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 71
structure length 330
sequence length 335
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
B PF12662 cEGF Complement Clr-like EGF-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3v65B01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3v65B02
5JBBE 3V65B 3F6UL 2P3FN 3KK6A 2FLBL 1CQEA 2FPBA 2P3TA 3U0SA 2VWMK 3O4PA 5F1AA 2MHPA 3SREA 4Y6DB 4YZUB 1FSBA 2WPIE 1TLEA 4G1MB 4NGAL 3TZIA 1FF7A 3N8ZA 1XKBA 2J34B 1Q4GA 2W8BA 3NJPC 2Y80B 3Q6TA 2VH6B 2IASA 4GN8A 1G1TA 1M1XB 4OTJA 4ISIL 3GCWE 4CSYA 1HRFA 4E1GA 2GVUA 1WHFA 2YGPA 4O5TA 2GVWA 2UWPB 5JW1A 1UZQA 3LC3B 3Q6PA 1YUFA 1QBIA 2BOKL 4Z6AL 3BYCA 1EPIA 2BQ7A 4D0EA 3GISX 2Y5FL 4X8UL 2UWOB 1IQEL 2M74A 1N1IA 4ZXXL 4X8SL 2HQSA 3ELAL 3Q3KB 4GNCA 1RFNB 3N8WB 3N8YA 1NZIA 2F9BL 1DQBA 1N7DA 4ZXYL 2NPRA 2FP9A 5K0HB 3Q6KA 2TGFA 5IKQA 2P3FL 3ZYIB 1P0SL 2OYUP 1WU1B 2XBYL 2P94L 4JZEL 1ATEA 1DVAL 3ZYJB 1A3PA 5GX2A 5JB8E 4M10A 5JVZA 1G1RA 2P28B 2DG0A 4D0FA 5JBCE 1FE2A 2UWLB 1C9UA 3AMRA 1B9WA 5I46L 4GN9A 1OB1C 1CVWL 3CA7A 3KCGL 3OLTA 3LN0A 4M11A 3LAQA 1XKAL 3R05A 3QH0A 1G2MB 2W2OE 4RRYA 3SRGA 1V04A 1POOA 2PUQL 3KQBL 5JB9E 1NFUB 1Q7FA 1KLOA 1LPKA 1HREA 1Z6EL 2Y5GL 4Y79B 1KIGL 2W86A 5GX3A 1EAIC 3KRKA 5E8DA 4AQTA 4RRWA 1IJQA 2WYGB 3RR3A 3V64C 1EPJA 1K36A 2BOUA 1HX2A 2IAUA 3TK5B 2PR3B 2KL7A 3KQCL 1CCVA 2V91A 2WFTA 2WYJB 4O5SA 3V1SA 4MMZB 3KYAA 3ZYGA 1ATBA 4CUDA 1Z6CA 1ATAA 2Q1JB 4ZAEB 4YT6L 1E1AA 1J9CL 3HO5A 4JYVL 3LI3A 3HS7A 1K37A 1YGCL 4YT7L 1CVUA 1IQJL 5KIRA 3HS6A 4XLWA 1EPHA 5COXA 1LQDA 2IATA 3HLIA 2VVUL 5CKQA 4O02B 2XBXL 2J94B 3NT1A 4Y76B 2FZZL 1ATDA 3G4EA 1FFMA 2W26B 2W2PE 1G1SA 3QMOA 3SW2A 3A9HA 1O5DL 4O1ZA 2B7DL 2J38B 5D9CA 2H9EL 3DR2A 1EBVA 1U8CB 2XC0L 1MOXC 2W2QE 3N8XA 1NPEA 1V3XB 2EI8B 4HW6A 4DG6A 3M37L 4LORA 1P9JA 2VAQA 1NFYB 1X7AL 4GNBA 2Y81B 1PXXA 1F0SB 1EGFA 1HCGB 1LPZA 4PH9A 3M36L 4A0PA 5FWWA 4RRZA 4XBMA 2W8BB 1NT0A 1DX5I 1HAEA 1IQLL 3FVZA 3GCXE 3MDLA 1EMOA 2VVCK 5GTQA 4JMLA 2ISMA 2J4IB 4A7IA 3TGFA 4Y7AB 4TGFA 1UZPA 2KB9A 3NTBA 2Y7XB 2G8SA 3POYA 2WG3C 1PGEA 2XC5L 1IGXA 4NA9L 1DDXA 3K9XA 3EGFA 1MQ5L 3CS7L 2G00L 1TOZA 1G2LB 5JVYA 3A9GA 3FW0A 5JBAE 2GD4A 3N8YB 2VWLL 1WHEA 1W8BL 2FLGA 1EPGA 3LTGD 2VWNL 2VH0B 4BTUA 4BDWA 2BO2A 2CJIB 1XFEA 1IOEL 3WW9A 3KGGA 2AYLA 1IQGL 2IVZA 1RWIA 5L30L 1UZKA 2P16L 4ZH8B 2IAWA 3N8VA 4ZHAB 3DASA 2BOHA 3QCWA 4IMBA 2W3IB 4ZLRA 2WPLE 1XDTR 3C9AC 1IOXA 3FBYA 3HLHA 1I0UA 2IAQA 2OYEP 2DG1A 4JZFL 5KN5C 3HO3A 1NFXB 3TBDA 1KLJL 3H5CB 2DDUA 5IKVA 3E5ZA 1GK5A 3LI4A 1CVMA 4CUEA 4RUTA 2RHPA 5GX1A 1FJSL 5IKRA 3HO4A 2BZ6L 3LI5A 2WG4B 2FPCA 1EMNA 1IVOC 1YUGA 4Z0KB 2GHSA 1HT5A 1PRHA 1HJ7A 1PJXA 1IQFL 1C5KA 4R40A 3LN1A 1RWLA 4FM5A 4X8TL 4Y7BB 2ADXA 3BT2A 2P3UA 1EZQB 5CISA 1TPGA 1CQ1A 5D9DA 1IQNL 3IJEB 4HHQA 1UZJA 5F19A 4PWZA 3ENSA 3FCSB 1FAKL 4BDXA 4COXA 1APQA 1SZBA 2RNLA 5GX4A 2EI6B 3TC9A 3HRPA 2W2ME 3NTGA 1L3YA 3S2KA 4RS0A 4MMYB 4Z0LA 2WPKE 1W7XL 2IAPA 2Y7ZB 3KL6B 1IQHL 2IAXA 5CKMA 2PHBB 5D9BA 4LMFA 2POOA 1EQGA 3OLUA 5FDQA 2IAOA 5L2YL 3S8VA 1F0RB 5EX7A 2JKHL 2K2SB 1NFWB 1L5GB 1LPGA 1EQHA 2Y82B 1G1QA 1NPEB 3HS5A 1C5MF 1JV2B 2I9AA 2FP8A 1QLGA 1IQML 1ADXA 3WWAA 4CUFA 4GN7A 1H6LA 3MQEA 3TH3L 1PFXL 3N8WA 1CRUA 5IKTA 2VJ3A 2D1JB 3PGHA 2W3KB 1URKA 1CEJA 2P93L 1HT8A 1KLIL 3BT1A 1U67A 2WFXB 2WPME 1COUA 1CCFA 3CFWA 3SOQA 3TK6B 2P95L 1F7EA 2BMGA 5EGMB 5GX5A 2XC4L 3IAXA 1JBUL 3G4HA 3I1CA 2J2UB 4NG9L 4XL1A 3FFGL 1HZ8A 1CX2A 3U7UG 3S8ZA 4HHOA 3ASIA 2MGPA 1F7MA 3IITB 3SOBB 2DSOA 1QFKL 4D90A 1YO8A 2RA0L 1FAXL 1IQKL 2KV4A 2Y5HL 3LC5B 3AMSA 6COXA 2YGOA 3HPTA 4OTYA 4ISHL 4IYGA 2XBWL 2Y38A 4BXWA 2P26A 4JZDL 3LTFB 1IGZA 2WPHE 2J95B 1APOA 5L2ZL 2K2TA 4JYUL 1DIYA 3U73A 2OJHA 2GVVA 2EI7B 2GVXA 3BPSE 4BTIA 3SOVA 2VVVL 3CENL 3Q7DA 1AUTL 3KQDL 1LMJA 2FD6A 4RRXA 2I9BA 4BXSA 2BQWA 1MQ6L 3KQEL 3LIWB 1IP0A 3F1SB 2P4OA 1YUKB 2FLRL 4Y71B 2BOXA 4BTTA 2XBVL 2MGRA 1HAFA 1IQIL 1ZAQA 4GNAA 2QE8A 5CKNA 3S94A 1PTHA 4MMXB 3DEMA 4Q1UA 2W2NE 1NQLB 4X8VL 2IARA 1KSNB 2VWOL 1CRZA 1BF9A 3P5BL 2IAVA 2WPJE 4C16A 1JL9A 2BQ6A
chains in the Genus database with same CATH superfamily
5JBBE 3V65B 3F6UL 2VK5A 2P3FN 3KK6A 1Z4ZA 3JU4A 1X2JA 4XHXA 2FLBL 1CQEA 2F26A 2FPBA 4MWLA 3K39A 4XJ9A 2P3TA 3U0SA 4GB1A 2VWMK 3O4PA 5F1AA 2MHPA 4QN6A 3SREA 4Y6DB 4YZUB 1FSBA 4FOQA 4K1HA 1SUUA 4FPGA 2HTVA 2WPIE 1L7GA 1TLEA 4AHAA 3SALA 4G1MB 4NGAL 2YA5A 3TZIA 2QWEA 1FF7A 3N8ZA 1XKBA 2J34B 2F28A 5HX0A 4SLIA 4XJZA 1Q4GA 4XE9A 1A4QA 3TI3A 1B9SA 2W8BA 2QWAA 3NJPC 2Y80B 2YA4A 4IFJA 4XJ8A 2RKCA 1K32A 3Q6TA 2VH6B 4XIOA 2BSFA 2IASA 4GN8A 1G1TA 4B7MA 4FOYA 4XILA 1M1XB 4OTJA 2CMLA 4ISIL 1N1YA 4IFNX 3GCWE 1INVA 4CSYA 1HRFA 4E1GA 2WZPP 1WHFA 2YGPA 2GVUA 4FPOB 1V3BA 4O5TA 2GVWA 2UWPB 5JW1A 4FPYA 1UZQA 3LC3B 3Q6PA 1YUFA 1QBIA 2BOKL 4Z6AL 3BYCA 4X49A 4B7RA 1EPIA 2BQ7A 2BERA 4D8SA 5CGJA 1KITA 3PJQA 4AGIA 4D0EA 2XZIA 3GISX 2Y5FL 4X8UL 2UWOB 2H2UA 1IQEL 2M74A 4C1YB 1N1IA 4ZXXL 4X8SL 2F10A 2HQSA 3ELAL 3Q3KB 4GNCA 3VNHA 1RFNB 1USXA 1INFA 3N8WB 1NZIA 3N8YA 2F9BL 1DQBA 2QWGA 1N7DA 4ZXYL 2NPRA 2FP9A 5K0HB 3Q6KA 2TGFA 5IKQA 2P3FL 1W20A 3ZYIB 1P0SL 2OYUP 4HIZA 1WU1B 2XBYL 1DIMA 2P94L 4CPZA 4JZEL 1MS3A 1ATEA 1EUTA 1MS4A 4FPJA 1DVAL 3ZYJB 2VWDA 1A3PA 4CPYA 5GX2A 4XIKA 2JKBA 5JB8E 4K1JA 4M10A 5JVZA 1G1RA 2P28B 2DG0A 4D0FA 1NMBN 5B2CA 4FP2A 4YZ1A 5JBCE 4XJAA 4X47A 1FE2A 2UWLB 4GZQA 1C9UA 5HUKA 3AMRA 1B9WA 3GVLA 1NNBA 5I46L 1MR5A 1NN2A 4FPEA 2VK7A 4GN9A 5FNRA 1OB1C 1X2RA 1CVWL 3CA7A 3KCGL 3OLTA 1Z50A 1NCBN 1V1HA 3LN0A 4M11A 3LAQA 1L7HA 3B7EA 2QWFA 1XKAL 3R05A 4Q6KA 3QH0A 3ALXA 1IVCA 1G2MB 2BF6A 2W2OE 1INXA 2HOXA 4RRYA 3SRGA 1V04A 1POOA 2PUQL 3KQBL 5JB9E 1E8UA 4GEZA 2ZZKA 4KS5A 3TICA 2W20A 1ZI0A 1NFUB 1Q7FA 1KLOA 1KKEA 1EUSA 4MWYA 1LPKA 1HREA 1Z6EL 1A4GA 2Y5GL 4Y79B 1KIGL 4WEFA 2W86A 5GX3A 4FPFA 1EAIC 5NN9A 2VSKA 3KRKA 1MS9A 1NMCA 4GZXA 4XJUA 5E8DA 4AQTA 4RRWA 1IJQA 2WYGB 3RR3A 3V64C 2VW0A 2XZKA 1EPJA 2HT7A 1K36A 2BOUA 1HX2A 1SLLA 3H73A 3H71A 2IAUA 3CL0A 3TK5B 2PR3B 1N1VA 4XMBA 2KL7A 3KQCL 1CCVA 1V3EA 1S0IA 2V91A 2WFTA 4M4UA 4UF7A 2WYJB 4CHBA 2QWHA 4O5SA 3V1SA 4MMZB 2VW1A 5FZNA 3KYAA 3ZYGA 1EUUA 1ATBA 1N6DA 4CUDA 2F24A 1Z6CA 1ATAA 1V0FA 4KS1A 2Q1JB 4ZAEB 2HT5A 4YT6L 1E1AA 2W5NA 1J9CL 3GVJA 4JF7A 3HO5A 4JYVL 4B7QA 3LI3A 3HS7A 1K37A 1YGCL 1IVBA 1LMMA 1LK9A 4YT7L 1IVEA 2YA6A 4CPOA 4CPNA 1EURA 4KS2A 3H72A 1CVUA 1IQJL 5KIRA 3HS6A 4XLWA 1EPHA 5COXA 1LQDA 2IATA 5HUMA 3HLIA 2VVUL 5CKQA 2WOZA 3ZGDA 4KS4A 4O02B 4NCSA 2AH2A 2XBXL 2YA7A 4CH9A 2ZB5A 2VSMA 2J94B 1W0PA 3NT1A 4Y76B 1IUCA 3TIAA 2FZZL 1ATDA 3G4EA 1FFMA 2W26B 2W2PE 1G1SA 3QMOA 2HORA 3SW2A 3A9HA 1O5DL 4O1ZA 4GZOA 1INWA 1NNCA 1NCCN 2B7DL 4YW2A 2J38B 4FOVA 6NN9A 4GZSA 5D9CA 2H9EL 3DR2A 1EBVA 4D52A 1U8CB 4WA5A 2XC0L 3K38A 1MOXC 2BT8A 2W2QE 3N8XA 1N1TA 4FPHA 3WN7A 1NPEA 3H6JA 1V3XB 4DGRA 1N6EA 5F9TA 2EI8B 4HW6A 1A14N 1NSDA 4DG6A 3M37L 4MJVA 1W21A 4LORA 3K37A 4XJWA 1P9JA 2VAQA 4L7DA 1MS1A 1NFYB 1X7AL 2HTRA 4GNBA 2Y81B 3ALWA 1PXXA 1F0SB 1EGFA 1HCGB 1LPZA 4PH9A 3M36L 4A0PA 5FWWA 4RRZA 4XBMA 4FOWA 2W8BB 1NT0A 4AH4A 5HUNA 1DX5I 1HAEA 1IQLL 3FVZA 4YW4A 3GCXE 3MDLA 1EMOA 2VVCK 1V2IA 5GTQA 1WCSA 4JMLA 2ISMA 2VK6A 2J4IB 4A7IA 3TGFA 1F8BA 3A72A 1V1IA 4Y7AB 3A71A 4TGFA 3SLIA 4FQ4A 1UZPA 2KB9A 3II7A 2BZDA 3NTBA 2Y7XB 2G8SA 3POYA 2HU4A 2WG3C 4YZ3A 1PGEA 1MWEA 2XC5L 1IGXA 4NA9L 3K9XA 1DDXA 4FJ6A 3EGFA 1MQ5L 3CS7L 3NO0A 2G00L 2F27A 1IUBA 4FPLA 1TOZA 2KNIA 3CL2A 1G2LB 4MZEA 1ZGKA 5JVYA 4QN7A 3INBA 3D11A 3A9GA 3TI5A 4M3MA 1USRA 3FW0A 4FVKA 5JBAE 4FPCA 2GD4A 1F8CA 2XN4A 3NN9A 3N8YB 4FP3A 3TI8A 2XCYA 2VWLL 1WHEA 4IN4A 1SO7A 1W8BL 2FLGA 1NCDN 1F8EA 1EPGA 2YA8A 3LTGD 2VWNL 2VH0B 4BTUA 4HZVA 4BDWA 2BO2A 2CJIB 1NCAN 1XFEA 1F8DA 1IOEL 4XMAA 4MZAA 3WW9A 4M4VA 3KGGA 2AYLA 2YDPA 1IQGL 1W1XA 2IVZA 4GDIA 1RWIA 5L30L 1UZKA 2P16L 4ZH8B 1NMAN 2IAWA 1NNAA 4G3NA 4QN3A 3K36A 3N8VA 4ZGCA 4ZHAB 3DASA 1MS5A 2BOHA 4YZ5A 3QCWA 4IMBA 2W3IB 1W8OA 4ZLRA 2WPLE 1XDTR 3C9AC 1IOXA 3TI6A 3FBYA 3HLHA 1I0UA 2IAQA 4MWRA 5FNSA 2OYEP 2C4AA 2DG1A 4JZFL 3T1EA 5KN5C 3HO3A 1NFXB 3TBDA 1KLJL 1NSCA 3H5CB 2DDUA 5IKVA 3E5ZA 1GK5A 2FHRA 3CKZA 2SIMA 3LI4A 4QN4A 1CVMA 4CUEA 4RUTA 2RHPA 2BATA 5GX1A 3OPZA 4WA3A 1FJSL 5FNUA 5IKRA 3HO4A 2VW2A 4J9TA 1IVGA 2BZ6L 3LI5A 2WG4B 2FPCA 2F11A 1EMNA 1IVOC 5M1ZA 2HTYA 1YUGA 4Z0KB 2GHSA 4L7BA 4X4AA 1HT5A 2X9MA 1PRHA 1HJ7A 1PJXA 1IQFL 1C5KA 4R40A 5FZJA 3LN1A 1RWLA 1XOGA 4FM5A 4X8TL 4Y7BB 2ADXA 3BT2A 3VNGA 2YDTA 4CSDA 3TIBA 2P3UA 1INGA 3B69A 4YW5A 2QWIA 1EZQB 5CISA 1TPGA 1WP5A 4NN9A 1CQ1A 4XJQA 5D9DA 1IQNL 3IJEB 4UOUA 4HHQA 1SLIA 1UZJA 5F19A 4PWZA 3ENSA 4YZ4A 1V3DA 3FCSB 2SILA 1FAKL 4BDXA 4COXA 4HZXA 1DILA 4N1BA 1APQA 4YW3A 4WEGA 1OFZA 1SZBA 2RNLA 4GU3A 5GX4A 2H2NA 2EI6B 3TC9A 3WDZA 3HRPA 2Z32A 1VCUA 2W2ME 3NTGA 1L3YA 4H53A 3S2KA 4L7CA 4XJRA 4RS0A 4MMYB 1Z4WA 4M4NA 4MWUA 4Z0LA 5EO8A 4YW1A 2WPKE 1NSBA 1W7XL 2IAPA 2Y7ZB 2BT7A 3KL6B 1IQHL 2IAXA 5CKMA 4D4UA 2PHBB 4IFLX 5D9BA 4HZWA 3BEQA 4LMFA 1IVFA 4GJTA 4WA4A 4FPKA 1N1SA 2POOA 1EQGA 3OLUA 4ASCA 2YGQA 5FDQA 2ZW9A 2IAOA 5L2YL 2C4LA 3S8VA 1F0RB 2VVZA 5EX7A 2JKHL 3O9KA 2W5OA 1QIUA 2K2SB 1NFWB 1L5GB 4MWJA 5FNTA 4D52B 5B2DA 1LPGA 1EQHA 2Y82B 4MX0A 1G1QA 1NPEB 1MS8A 3HS5A 5JYYA 1C5MF 3SANA 1JV2B 2I9AA 1Z4YA 2FP8A 4QN5A 5FNQA 1E8TA 4B7JA 1QLGA 1IQML 1ADXA 3O9JA 4MWWA 3WWAA 4CUFA 2DYHA 4C1YA 4GN7A 2F25A 1H6LA 3MQEA 3TH3L 1PFXL 2A75A 3N8WA 4MWXA 1CRUA 5IKTA 2VJ3A 2QWDA 5H47A 2D1JB 1E8VA 2QWKA 2QWCA 1INYA 2HU0A 2ZB6A 3PGHA 2W3KB 2AEQA 7NN9A 3NSSA 1URKA 1CEJA 1INHA 4A94C 2P93L 2HTWA 1IVDA 1HT8A 1KLIL 3BT1A 1U67A 5HUGA 2WFXB 2WPME 1COUA 1V0ZA 2F0ZA 1CCFA 4YZ2A 4D52C 2QWJA 3CFWA 3ZGCA 1S18A 3SOQA 3TK6B 2P95L 1F7EA 2BMGA 4K1IA 2SLIA 1MZ6A 4NC5A 4BBWA 5EGMB 3CYEA 5GX5A 2XC4L 1W8NA 4CPMA 2AEPA 3IAXA 2HT8A 1JBUL 4H52A 3G4HA 4HZYA 4YY8A 3I1CA 2J2UB 4NG9L 4XL1A 1U6DX 3D12A 3FFGL 1V3CA 2AGSA 1HZ8A 2H9EC 1CX2A 3U7UG 2B8HA 3ADEA 3UC1A 3S8ZA 4HHOA 3ASIA 2MGPA 1F7MA 3IITB 3SOBB 2DSOA 3S6XA 4CPLA 1QFKL 4D90A 3GVKA 1YO8A 2RA0L 4IQKA 1Z4XA 4MWVA 1MZ5A 1FAXL 1IQKL 2KV4A 2Y5HL 3LC5B 5EO7A 2HTUA 3AMSA 2QWBA 4XYXA 2VRSA 6COXA 1VCJA 3K3AA 2YGOA 3HPTA 4OTYA 4ISHL 4IYGA 2XBWL 4QNPA 2Y38A 4BXWA 2P26A 4JZDL 3LTFB 1IGZA 2W38A 2WPHE 1S0JA 2J95B 1APOA 5L2ZL 2K2TA 4JYUL 2ZWAA 1DIYA 3U73A 2OJHA 2GVVA 4ZY3A 2EI7B 4I00A 2VPJA 2GVXA 4XOGA 1S1DA 4GZWA 3BPSE 4BTIA 3SOVA 2VVVL 3CENL 4K3YA 2HTQA 3Q7DA 4XMIA 1AUTL 4KS3A 3KQDL 1B9VA 1LMJA 2FD6A 4GZPA 4FZHA 2JJLA 4RRXA 1N6FA 2F29A 2I9BA 4BXSA 1XOEA 2BQWA 1MQ6L 3KQEL 3LIWB 1V0EA 2FLUX 1IP0A 1B9TA 3F1SB 4GU4A 3TI4A 2P4OA 1YUKB 2FLRL 4Y71B 1SNTA 3SILA 2BOXA 4BTTA 4MC7A 2XBVL 3L6VA 4B7NA 2MGRA 1HAFA 1IQIL 1ZAQA 1WCQA 4XHBA 1L7FA 4GNAA 1MS0A 2XZJA 1Z4VA 2QE8A 5F72C 5CKNA 3S94A 2F12A 4HZZA 1BJIA 1PTHA 4MMXB 3DEMA 4Q1UA 2W2NE 4AGTA 1NQLB 4X8VL 4MJUA 2IARA 2F13A 4X6KA 4MWQA 1KSNB 2VWOL 1W0OA 4GDJA 1CRZA 4GZTA 3W09A 1BF9A 3P5BL 4K1KA 2IAVA 2WPJE 4C16A 1JL9A 2BQ6A
chains in the Genus database with same CATH topology
5JBBE 3V65B 3F6UL 2P3FN 3KK6A 2FLBL 1CQEA 2FPBA 2P3TA 3U0SA 2VWMK 3O4PA 5F1AA 2MHPA 3SREA 4Y6DB 4YZUB 1FSBA 2WPIE 1TLEA 4G1MB 4NGAL 3TZIA 1FF7A 3N8ZA 1XKBA 2J34B 1Q4GA 2W8BA 3NJPC 2Y80B 3Q6TA 2VH6B 2IASA 4GN8A 1G1TA 1M1XB 4OTJA 4ISIL 3GCWE 4CSYA 1HRFA 4E1GA 2WZPP 1WHFA 2YGPA 2GVUA 4O5TA 2GVWA 2UWPB 5JW1A 1UZQA 3LC3B 3Q6PA 1YUFA 1QBIA 2BOKL 4Z6AL 3BYCA 1EPIA 2BQ7A 4D0EA 3GISX 2Y5FL 4X8UL 2UWOB 1IQEL 2M74A 1N1IA 4ZXXL 4X8SL 2HQSA 3ELAL 3Q3KB 4GNCA 1RFNB 3N8WB 3N8YA 1NZIA 2F9BL 1DQBA 1N7DA 4ZXYL 2NPRA 2FP9A 5K0HB 3Q6KA 2TGFA 5IKQA 2P3FL 3ZYIB 1P0SL 2OYUP 1WU1B 2XBYL 2P94L 4JZEL 1ATEA 1DVAL 3ZYJB 1A3PA 5GX2A 5JB8E 4M10A 5JVZA 1G1RA 2P28B 2DG0A 4D0FA 5JBCE 1FE2A 2UWLB 1C9UA 3AMRA 1B9WA 5I46L 4GN9A 1OB1C 1CVWL 3CA7A 3KCGL 3OLTA 3LN0A 4M11A 3LAQA 1XKAL 3R05A 3QH0A 1G2MB 2W2OE 4RRYA 3SRGA 1V04A 1POOA 2PUQL 3KQBL 5JB9E 1NFUB 1Q7FA 1KLOA 1LPKA 1HREA 1Z6EL 2Y5GL 4Y79B 1KIGL 2W86A 5GX3A 1EAIC 3KRKA 5E8DA 4AQTA 4RRWA 1IJQA 2WYGB 3RR3A 3V64C 1EPJA 1K36A 2BOUA 1HX2A 2IAUA 3TK5B 2PR3B 2KL7A 3KQCL 1CCVA 2V91A 2WFTA 2WYJB 4O5SA 3V1SA 4MMZB 3KYAA 3ZYGA 1ATBA 4CUDA 1Z6CA 1ATAA 2Q1JB 4ZAEB 4YT6L 1E1AA 1J9CL 3HO5A 4JYVL 3LI3A 3HS7A 1K37A 1YGCL 1LMMA 4YT7L 1CVUA 1IQJL 5KIRA 3HS6A 4XLWA 1EPHA 5COXA 1LQDA 2IATA 3HLIA 2VVUL 5CKQA 4O02B 2XBXL 2J94B 3NT1A 4Y76B 2FZZL 1ATDA 3G4EA 1FFMA 2W26B 2W2PE 1G1SA 3QMOA 3SW2A 3A9HA 1O5DL 4O1ZA 2B7DL 2J38B 5D9CA 2H9EL 3DR2A 1EBVA 1U8CB 2XC0L 1MOXC 2W2QE 3N8XA 1NPEA 1V3XB 2EI8B 4HW6A 4DG6A 3M37L 4LORA 1P9JA 2VAQA 1NFYB 1X7AL 4GNBA 2Y81B 1PXXA 1F0SB 1EGFA 1HCGB 1LPZA 4PH9A 3M36L 4A0PA 5FWWA 4RRZA 4XBMA 2W8BB 1NT0A 1DX5I 1HAEA 1IQLL 3FVZA 3GCXE 3MDLA 1EMOA 2VVCK 5GTQA 4JMLA 2ISMA 2J4IB 4A7IA 3TGFA 4Y7AB 4TGFA 1UZPA 2KB9A 3NTBA 2Y7XB 2G8SA 3POYA 2WG3C 1PGEA 2XC5L 1IGXA 4NA9L 1DDXA 3K9XA 3EGFA 1MQ5L 3CS7L 2G00L 1TOZA 2KNIA 1G2LB 5JVYA 3A9GA 3FW0A 5JBAE 2GD4A 3N8YB 2VWLL 1WHEA 1W8BL 2FLGA 1EPGA 3LTGD 2VWNL 2VH0B 4BTUA 4BDWA 2BO2A 2CJIB 1XFEA 1IOEL 3WW9A 3KGGA 2AYLA 1IQGL 2IVZA 1RWIA 5L30L 1UZKA 2P16L 4ZH8B 2IAWA 3N8VA 4ZHAB 3DASA 2BOHA 3QCWA 4IMBA 2W3IB 4ZLRA 2WPLE 1XDTR 3C9AC 1IOXA 3FBYA 3HLHA 1I0UA 2IAQA 2OYEP 2DG1A 4JZFL 5KN5C 3HO3A 1NFXB 3TBDA 1KLJL 3H5CB 2DDUA 5IKVA 3E5ZA 1GK5A 3LI4A 1CVMA 4CUEA 4RUTA 2RHPA 5GX1A 1FJSL 5IKRA 3HO4A 2BZ6L 3LI5A 2WG4B 2FPCA 1EMNA 1IVOC 1YUGA 4Z0KB 2GHSA 1HT5A 1PRHA 1HJ7A 1PJXA 1IQFL 1C5KA 4R40A 3LN1A 1RWLA 4FM5A 4X8TL 4Y7BB 2ADXA 3BT2A 2P3UA 1EZQB 5CISA 1TPGA 1CQ1A 5D9DA 1IQNL 3IJEB 4HHQA 1UZJA 5F19A 4PWZA 3ENSA 3FCSB 1FAKL 4BDXA 4COXA 1APQA 1SZBA 2RNLA 5GX4A 2EI6B 3TC9A 3HRPA 2W2ME 3NTGA 1L3YA 3S2KA 4RS0A 4MMYB 4Z0LA 2WPKE 1W7XL 2IAPA 2Y7ZB 3KL6B 1IQHL 2IAXA 5CKMA 2PHBB 5D9BA 4LMFA 2POOA 1EQGA 3OLUA 2YGQA 5FDQA 2IAOA 5L2YL 3S8VA 1F0RB 5EX7A 2JKHL 2K2SB 1NFWB 1L5GB 1LPGA 1EQHA 2Y82B 1G1QA 1NPEB 3HS5A 1C5MF 1JV2B 2I9AA 2FP8A 1QLGA 1IQML 1ADXA 3WWAA 4CUFA 4GN7A 1H6LA 3MQEA 3TH3L 1PFXL 3N8WA 1CRUA 5IKTA 2VJ3A 2D1JB 3PGHA 2W3KB 1URKA 1CEJA 4A94C 2P93L 1HT8A 1KLIL 3BT1A 1U67A 2WFXB 2WPME 1COUA 1CCFA 3CFWA 3SOQA 3TK6B 2P95L 1F7EA 2BMGA 5EGMB 5GX5A 2XC4L 3IAXA 1JBUL 3G4HA 3I1CA 2J2UB 4NG9L 4XL1A 3FFGL 1HZ8A 2H9EC 1CX2A 3U7UG 3S8ZA 4HHOA 3ASIA 2MGPA 1F7MA 3IITB 3SOBB 2DSOA 3S6XA 1QFKL 4D90A 1YO8A 2RA0L 1FAXL 1IQKL 2KV4A 2Y5HL 3LC5B 3AMSA 6COXA 2YGOA 3HPTA 4OTYA 4ISHL 4IYGA 2XBWL 2Y38A 4BXWA 2P26A 4JZDL 3LTFB 1IGZA 2WPHE 2J95B 1APOA 5L2ZL 2K2TA 4JYUL 1DIYA 3U73A 2OJHA 2GVVA 2EI7B 2GVXA 3BPSE 4BTIA 3SOVA 2VVVL 3CENL 3Q7DA 1AUTL 3KQDL 1LMJA 2FD6A 4RRXA 2I9BA 4BXSA 2BQWA 1MQ6L 3KQEL 3LIWB 1IP0A 3F1SB 2P4OA 1YUKB 2FLRL 4Y71B 2BOXA 4BTTA 2XBVL 2MGRA 1HAFA 1IQIL 1ZAQA 4GNAA 2QE8A 5CKNA 3S94A 1PTHA 4MMXB 3DEMA 4Q1UA 2W2NE 1NQLB 4X8VL 2IARA 1KSNB 2VWOL 1CRZA 1BF9A 3P5BL 2IAVA 2WPJE 4C16A 1JL9A 2BQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JBB E;  3V65 B;  3F6U L;  2P3F N;  3KK6 A;  2FLB L;  1CQE A;  2FPB A;  2P3T A;  3U0S A;  2VWM K;  3O4P A;  5F1A A;  2MHP A;  3SRE A;  4Y6D B;  4YZU B;  1FSB A;  2WPI E;  1TLE A;  4G1M B;  4NGA L;  3TZI A;  1FF7 A;  3N8Z A;  1XKB A;  2J34 B;  1Q4G A;  2W8B A;  3NJP C;  2Y80 B;  3Q6T A;  2VH6 B;  2IAS A;  4GN8 A;  1G1T A;  1M1X B;  4OTJ A;  4ISI L;  3GCW E;  4CSY A;  1HRF A;  4E1G A;  2GVU A;  1WHF A;  2YGP A;  4O5T A;  2GVW A;  2UWP B;  5JW1 A;  1UZQ A;  3LC3 B;  3Q6P A;  1YUF A;  1QBI A;  2BOK L;  4Z6A L;  3BYC A;  1EPI A;  2BQ7 A;  4D0E A;  3GIS X;  2Y5F L;  4X8U L;  2UWO B;  1IQE L;  2M74 A;  1N1I A;  4ZXX L;  4X8S L;  2HQS A;  3ELA L;  3Q3K B;  4GNC A;  1RFN B;  3N8W B;  3N8Y A;  1NZI A;  2F9B L;  1DQB A;  1N7D A;  4ZXY L;  2NPR A;  2FP9 A;  5K0H B;  3Q6K A;  2TGF A;  5IKQ A;  2P3F L;  3ZYI B;  1P0S L;  2OYU P;  1WU1 B;  2XBY L;  2P94 L;  4JZE L;  1ATE A;  1DVA L;  3ZYJ B;  1A3P A;  5GX2 A;  5JB8 E;  4M10 A;  5JVZ A;  1G1R A;  2P28 B;  2DG0 A;  4D0F A;  5JBC E;  1FE2 A;  2UWL B;  1C9U A;  3AMR A;  1B9W A;  5I46 L;  4GN9 A;  1OB1 C;  1CVW L;  3CA7 A;  3KCG L;  3OLT A;  3LN0 A;  4M11 A;  3LAQ A;  1XKA L;  3R05 A;  3QH0 A;  1G2M B;  2W2O E;  4RRY A;  3SRG A;  1V04 A;  1POO A;  2PUQ L;  3KQB L;  5JB9 E;  1NFU B;  1Q7F A;  1KLO A;  1LPK A;  1HRE A;  1Z6E L;  2Y5G L;  4Y79 B;  1KIG L;  2W86 A;  5GX3 A;  1EAI C;  3KRK A;  5E8D A;  4AQT A;  4RRW A;  1IJQ A;  2WYG B;  3RR3 A;  3V64 C;  1EPJ A;  1K36 A;  2BOU A;  1HX2 A;  2IAU A;  3TK5 B;  2PR3 B;  2KL7 A;  3KQC L;  1CCV A;  2V91 A;  2WFT A;  2WYJ B;  4O5S A;  3V1S A;  4MMZ B;  3KYA A;  3ZYG A;  1ATB A;  4CUD A;  1Z6C A;  1ATA A;  2Q1J B;  4ZAE B;  4YT6 L;  1E1A A;  1J9C L;  3HO5 A;  4JYV L;  3LI3 A;  3HS7 A;  1K37 A;  1YGC L;  4YT7 L;  1CVU A;  1IQJ L;  5KIR A;  3HS6 A;  4XLW A;  1EPH A;  5COX A;  1LQD A;  2IAT A;  3HLI A;  2VVU L;  5CKQ A;  4O02 B;  2XBX L;  2J94 B;  3NT1 A;  4Y76 B;  2FZZ L;  1ATD A;  3G4E A;  1FFM A;  2W26 B;  2W2P E;  1G1S A;  3QMO A;  3SW2 A;  3A9H A;  1O5D L;  4O1Z A;  2B7D L;  2J38 B;  5D9C A;  2H9E L;  3DR2 A;  1EBV A;  1U8C B;  2XC0 L;  1MOX C;  2W2Q E;  3N8X A;  1NPE A;  1V3X B;  2EI8 B;  4HW6 A;  4DG6 A;  3M37 L;  4LOR A;  1P9J A;  2VAQ A;  1NFY B;  1X7A L;  4GNB A;  2Y81 B;  1PXX A;  1F0S B;  1EGF A;  1HCG B;  1LPZ A;  4PH9 A;  3M36 L;  4A0P A;  5FWW A;  4RRZ A;  4XBM A;  2W8B B;  1NT0 A;  1DX5 I;  1HAE A;  1IQL L;  3FVZ A;  3GCX E;  3MDL A;  1EMO A;  2VVC K;  5GTQ A;  4JML A;  2ISM A;  2J4I B;  4A7I A;  3TGF A;  4Y7A B;  4TGF A;  1UZP A;  2KB9 A;  3NTB A;  2Y7X B;  2G8S A;  3POY A;  2WG3 C;  1PGE A;  2XC5 L;  1IGX A;  4NA9 L;  1DDX A;  3K9X A;  3EGF A;  1MQ5 L;  3CS7 L;  2G00 L;  1TOZ A;  1G2L B;  5JVY A;  3A9G A;  3FW0 A;  5JBA E;  2GD4 A;  3N8Y B;  2VWL L;  1WHE A;  1W8B L;  2FLG A;  1EPG A;  3LTG D;  2VWN L;  2VH0 B;  4BTU A;  4BDW A;  2BO2 A;  2CJI B;  1XFE A;  1IOE L;  3WW9 A;  3KGG A;  2AYL A;  1IQG L;  2IVZ A;  1RWI A;  5L30 L;  1UZK A;  2P16 L;  4ZH8 B;  2IAW A;  3N8V A;  4ZHA B;  3DAS A;  2BOH A;  3QCW A;  4IMB A;  2W3I B;  4ZLR A;  2WPL E;  1XDT R;  3C9A C;  1IOX A;  3FBY A;  3HLH A;  1I0U A;  2IAQ A;  2OYE P;  2DG1 A;  4JZF L;  5KN5 C;  3HO3 A;  1NFX B;  3TBD A;  1KLJ L;  3H5C B;  2DDU A;  5IKV A;  3E5Z A;  1GK5 A;  3LI4 A;  1CVM A;  4CUE A;  4RUT A;  2RHP A;  5GX1 A;  1FJS L;  5IKR A;  3HO4 A;  2BZ6 L;  3LI5 A;  2WG4 B;  2FPC A;  1EMN A;  1IVO C;  1YUG A;  4Z0K B;  2GHS A;  1HT5 A;  1PRH A;  1HJ7 A;  1PJX A;  1IQF L;  1C5K A;  4R40 A;  3LN1 A;  1RWL A;  4FM5 A;  4X8T L;  4Y7B B;  2ADX A;  3BT2 A;  2P3U A;  1EZQ B;  5CIS A;  1TPG A;  1CQ1 A;  5D9D A;  1IQN L;  3IJE B;  4HHQ A;  1UZJ A;  5F19 A;  4PWZ A;  3ENS A;  3FCS B;  1FAK L;  4BDX A;  4COX A;  1APQ A;  1SZB A;  2RNL A;  5GX4 A;  2EI6 B;  3TC9 A;  3HRP A;  2W2M E;  3NTG A;  1L3Y A;  3S2K A;  4RS0 A;  4MMY B;  4Z0L A;  2WPK E;  1W7X L;  2IAP A;  2Y7Z B;  3KL6 B;  1IQH L;  2IAX A;  5CKM A;  2PHB B;  5D9B A;  4LMF A;  2POO A;  1EQG A;  3OLU A;  5FDQ A;  2IAO A;  5L2Y L;  3S8V A;  1F0R B;  5EX7 A;  2JKH L;  2K2S B;  1NFW B;  1L5G B;  1LPG A;  1EQH A;  2Y82 B;  1G1Q A;  1NPE B;  3HS5 A;  1C5M F;  1JV2 B;  2I9A A;  2FP8 A;  1QLG A;  1IQM L;  1ADX A;  3WWA A;  4CUF A;  4GN7 A;  1H6L A;  3MQE A;  3TH3 L;  1PFX L;  3N8W A;  1CRU A;  5IKT A;  2VJ3 A;  2D1J B;  3PGH A;  2W3K B;  1URK A;  1CEJ A;  2P93 L;  1HT8 A;  1KLI L;  3BT1 A;  1U67 A;  2WFX B;  2WPM E;  1COU A;  1CCF A;  3CFW A;  3SOQ A;  3TK6 B;  2P95 L;  1F7E A;  2BMG A;  5EGM B;  5GX5 A;  2XC4 L;  3IAX A;  1JBU L;  3G4H A;  3I1C A;  2J2U B;  4NG9 L;  4XL1 A;  3FFG L;  1HZ8 A;  1CX2 A;  3U7U G;  3S8Z A;  4HHO A;  3ASI A;  2MGP A;  1F7M A;  3IIT B;  3SOB B;  2DSO A;  1QFK L;  4D90 A;  1YO8 A;  2RA0 L;  1FAX L;  1IQK L;  2KV4 A;  2Y5H L;  3LC5 B;  3AMS A;  6COX A;  2YGO A;  3HPT A;  4OTY A;  4ISH L;  4IYG A;  2XBW L;  2Y38 A;  4BXW A;  2P26 A;  4JZD L;  3LTF B;  1IGZ A;  2WPH E;  2J95 B;  1APO A;  5L2Z L;  2K2T A;  4JYU L;  1DIY A;  3U73 A;  2OJH A;  2GVV A;  2EI7 B;  2GVX A;  3BPS E;  4BTI A;  3SOV A;  2VVV L;  3CEN L;  3Q7D A;  1AUT L;  3KQD L;  1LMJ A;  2FD6 A;  4RRX A;  2I9B A;  4BXS A;  2BQW A;  1MQ6 L;  3KQE L;  3LIW B;  1IP0 A;  3F1S B;  2P4O A;  1YUK B;  2FLR L;  4Y71 B;  2BOX A;  4BTT A;  2XBV L;  2MGR A;  1HAF A;  1IQI L;  1ZAQ A;  4GNA A;  2QE8 A;  5CKN A;  3S94 A;  1PTH A;  4MMX B;  3DEM A;  4Q1U A;  2W2N E;  1NQL B;  4X8V L;  2IAR A;  1KSN B;  2VWO L;  1CRZ A;  1BF9 A;  3P5B L;  2IAV A;  2WPJ E;  4C16 A;  1JL9 A;  2BQ6 A; 
#chains in the Genus database with same CATH topology
 5JBB E;  3V65 B;  3F6U L;  2VK5 A;  2P3F N;  3KK6 A;  1Z4Z A;  3JU4 A;  1X2J A;  4XHX A;  2FLB L;  1CQE A;  2F26 A;  2FPB A;  4MWL A;  3K39 A;  4XJ9 A;  2P3T A;  3U0S A;  4GB1 A;  2VWM K;  3O4P A;  5F1A A;  2MHP A;  4QN6 A;  3SRE A;  4Y6D B;  4YZU B;  1FSB A;  4FOQ A;  4K1H A;  1SUU A;  4FPG A;  2HTV A;  2WPI E;  1L7G A;  1TLE A;  4AHA A;  3SAL A;  4G1M B;  4NGA L;  2YA5 A;  3TZI A;  2QWE A;  1FF7 A;  3N8Z A;  1XKB A;  2J34 B;  2F28 A;  5HX0 A;  4SLI A;  4XJZ A;  1Q4G A;  4XE9 A;  1A4Q A;  3TI3 A;  1B9S A;  2W8B A;  2QWA A;  3NJP C;  2Y80 B;  2YA4 A;  4IFJ A;  4XJ8 A;  2RKC A;  1K32 A;  3Q6T A;  2VH6 B;  4XIO A;  2BSF A;  2IAS A;  4GN8 A;  1G1T A;  4B7M A;  4FOY A;  4XIL A;  1M1X B;  4OTJ A;  2CML A;  4ISI L;  1N1Y A;  4IFN X;  3GCW E;  1INV A;  4CSY A;  1HRF A;  4E1G A;  2WZP P;  1WHF A;  2YGP A;  2GVU A;  4FPO B;  1V3B A;  4O5T A;  2GVW A;  2UWP B;  5JW1 A;  4FPY A;  1UZQ A;  3LC3 B;  3Q6P A;  1YUF A;  1QBI A;  2BOK L;  4Z6A L;  3BYC A;  4X49 A;  4B7R A;  1EPI A;  2BQ7 A;  2BER A;  4D8S A;  5CGJ A;  1KIT A;  3PJQ A;  4AGI A;  4D0E A;  2XZI A;  3GIS X;  2Y5F L;  4X8U L;  2UWO B;  2H2U A;  1IQE L;  2M74 A;  4C1Y B;  1N1I A;  4ZXX L;  4X8S L;  2F10 A;  2HQS A;  3ELA L;  3Q3K B;  4GNC A;  3VNH A;  1RFN B;  1USX A;  1INF A;  3N8W B;  1NZI A;  3N8Y A;  2F9B L;  1DQB A;  2QWG A;  1N7D A;  4ZXY L;  2NPR A;  2FP9 A;  5K0H B;  3Q6K A;  2TGF A;  5IKQ A;  2P3F L;  1W20 A;  3ZYI B;  1P0S L;  2OYU P;  4HIZ A;  1WU1 B;  2XBY L;  1DIM A;  2P94 L;  4CPZ A;  4JZE L;  1MS3 A;  1ATE A;  1EUT A;  1MS4 A;  4FPJ A;  1DVA L;  3ZYJ B;  2VWD A;  1A3P A;  4CPY A;  5GX2 A;  4XIK A;  2JKB A;  5JB8 E;  4K1J A;  4M10 A;  5JVZ A;  1G1R A;  2P28 B;  2DG0 A;  4D0F A;  1NMB N;  5B2C A;  4FP2 A;  4YZ1 A;  5JBC E;  4XJA A;  4X47 A;  1FE2 A;  2UWL B;  4GZQ A;  1C9U A;  5HUK A;  3AMR A;  1B9W A;  3GVL A;  1NNB A;  5I46 L;  1MR5 A;  1NN2 A;  4FPE A;  2VK7 A;  4GN9 A;  5FNR A;  1OB1 C;  1X2R A;  1CVW L;  3CA7 A;  3KCG L;  3OLT A;  1Z50 A;  1NCB N;  1V1H A;  3LN0 A;  4M11 A;  3LAQ A;  1L7H A;  3B7E A;  2QWF A;  1XKA L;  3R05 A;  4Q6K A;  3QH0 A;  3ALX A;  1IVC A;  1G2M B;  2BF6 A;  2W2O E;  1INX A;  2HOX A;  4RRY A;  3SRG A;  1V04 A;  1POO A;  2PUQ L;  3KQB L;  5JB9 E;  1E8U A;  4GEZ A;  2ZZK A;  4KS5 A;  3TIC A;  2W20 A;  1ZI0 A;  1NFU B;  1Q7F A;  1KLO A;  1KKE A;  1EUS A;  4MWY A;  1LPK A;  1HRE A;  1Z6E L;  1A4G A;  2Y5G L;  4Y79 B;  1KIG L;  4WEF A;  2W86 A;  5GX3 A;  4FPF A;  1EAI C;  5NN9 A;  2VSK A;  3KRK A;  1MS9 A;  1NMC A;  4GZX A;  4XJU A;  5E8D A;  4AQT A;  4RRW A;  1IJQ A;  2WYG B;  3RR3 A;  3V64 C;  2VW0 A;  2XZK A;  1EPJ A;  2HT7 A;  1K36 A;  2BOU A;  1HX2 A;  1SLL A;  3H73 A;  3H71 A;  2IAU A;  3CL0 A;  3TK5 B;  2PR3 B;  1N1V A;  4XMB A;  2KL7 A;  3KQC L;  1CCV A;  1V3E A;  1S0I A;  2V91 A;  2WFT A;  4M4U A;  4UF7 A;  2WYJ B;  4CHB A;  2QWH A;  4O5S A;  3V1S A;  4MMZ B;  2VW1 A;  5FZN A;  3KYA A;  3ZYG A;  1EUU A;  1ATB A;  1N6D A;  4CUD A;  2F24 A;  1Z6C A;  1ATA A;  1V0F A;  4KS1 A;  2Q1J B;  4ZAE B;  2HT5 A;  4YT6 L;  1E1A A;  2W5N A;  1J9C L;  3GVJ A;  4JF7 A;  3HO5 A;  4JYV L;  4B7Q A;  3LI3 A;  3HS7 A;  1K37 A;  1YGC L;  1IVB A;  1LMM A;  1LK9 A;  4YT7 L;  1IVE A;  2YA6 A;  4CPO A;  4CPN A;  1EUR A;  4KS2 A;  3H72 A;  1CVU A;  1IQJ L;  5KIR A;  3HS6 A;  4XLW A;  1EPH A;  5COX A;  1LQD A;  2IAT A;  5HUM A;  3HLI A;  2VVU L;  5CKQ A;  2WOZ A;  3ZGD A;  4KS4 A;  4O02 B;  4NCS A;  2AH2 A;  2XBX L;  2YA7 A;  4CH9 A;  2ZB5 A;  2VSM A;  2J94 B;  1W0P A;  3NT1 A;  4Y76 B;  1IUC A;  3TIA A;  2FZZ L;  1ATD A;  3G4E A;  1FFM A;  2W26 B;  2W2P E;  1G1S A;  3QMO A;  2HOR A;  3SW2 A;  3A9H A;  1O5D L;  4O1Z A;  4GZO A;  1INW A;  1NNC A;  1NCC N;  2B7D L;  4YW2 A;  2J38 B;  4FOV A;  6NN9 A;  4GZS A;  5D9C A;  2H9E L;  3DR2 A;  1EBV A;  4D52 A;  1U8C B;  4WA5 A;  2XC0 L;  3K38 A;  1MOX C;  2BT8 A;  2W2Q E;  3N8X A;  1N1T A;  4FPH A;  3WN7 A;  1NPE A;  3H6J A;  1V3X B;  4DGR A;  1N6E A;  5F9T A;  2EI8 B;  4HW6 A;  1A14 N;  1NSD A;  4DG6 A;  3M37 L;  4MJV A;  1W21 A;  4LOR A;  3K37 A;  4XJW A;  1P9J A;  2VAQ A;  4L7D A;  1MS1 A;  1NFY B;  1X7A L;  2HTR A;  4GNB A;  2Y81 B;  3ALW A;  1PXX A;  1F0S B;  1EGF A;  1HCG B;  1LPZ A;  4PH9 A;  3M36 L;  4A0P A;  5FWW A;  4RRZ A;  4XBM A;  4FOW A;  2W8B B;  1NT0 A;  4AH4 A;  5HUN A;  1DX5 I;  1HAE A;  1IQL L;  3FVZ A;  4YW4 A;  3GCX E;  3MDL A;  1EMO A;  2VVC K;  1V2I A;  5GTQ A;  1WCS A;  4JML A;  2ISM A;  2VK6 A;  2J4I B;  4A7I A;  3TGF A;  1F8B A;  3A72 A;  1V1I A;  4Y7A B;  3A71 A;  4TGF A;  3SLI A;  4FQ4 A;  1UZP A;  2KB9 A;  3II7 A;  2BZD A;  3NTB A;  2Y7X B;  2G8S A;  3POY A;  2HU4 A;  2WG3 C;  4YZ3 A;  1PGE A;  1MWE A;  2XC5 L;  1IGX A;  4NA9 L;  3K9X A;  1DDX A;  4FJ6 A;  3EGF A;  1MQ5 L;  3CS7 L;  3NO0 A;  2G00 L;  2F27 A;  1IUB A;  4FPL A;  1TOZ A;  2KNI A;  3CL2 A;  1G2L B;  4MZE A;  1ZGK A;  5JVY A;  4QN7 A;  3INB A;  3D11 A;  3A9G A;  3TI5 A;  4M3M A;  1USR A;  3FW0 A;  4FVK A;  5JBA E;  4FPC A;  2GD4 A;  1F8C A;  2XN4 A;  3NN9 A;  3N8Y B;  4FP3 A;  3TI8 A;  2XCY A;  2VWL L;  1WHE A;  4IN4 A;  1SO7 A;  1W8B L;  2FLG A;  1NCD N;  1F8E A;  1EPG A;  2YA8 A;  3LTG D;  2VWN L;  2VH0 B;  4BTU A;  4HZV A;  4BDW A;  2BO2 A;  2CJI B;  1NCA N;  1XFE A;  1F8D A;  1IOE L;  4XMA A;  4MZA A;  3WW9 A;  4M4V A;  3KGG A;  2AYL A;  2YDP A;  1IQG L;  1W1X A;  2IVZ A;  4GDI A;  1RWI A;  5L30 L;  1UZK A;  2P16 L;  4ZH8 B;  1NMA N;  2IAW A;  1NNA A;  4G3N A;  4QN3 A;  3K36 A;  3N8V A;  4ZGC A;  4ZHA B;  3DAS A;  1MS5 A;  2BOH A;  4YZ5 A;  3QCW A;  4IMB A;  2W3I B;  1W8O A;  4ZLR A;  2WPL E;  1XDT R;  3C9A C;  1IOX A;  3TI6 A;  3FBY A;  3HLH A;  1I0U A;  2IAQ A;  4MWR A;  5FNS A;  2OYE P;  2C4A A;  2DG1 A;  4JZF L;  3T1E A;  5KN5 C;  3HO3 A;  1NFX B;  3TBD A;  1KLJ L;  1NSC A;  3H5C B;  2DDU A;  5IKV A;  3E5Z A;  1GK5 A;  2FHR A;  3CKZ A;  2SIM A;  3LI4 A;  4QN4 A;  1CVM A;  4CUE A;  4RUT A;  2RHP A;  2BAT A;  5GX1 A;  3OPZ A;  4WA3 A;  1FJS L;  5FNU A;  5IKR A;  3HO4 A;  2VW2 A;  4J9T A;  1IVG A;  2BZ6 L;  3LI5 A;  2WG4 B;  2FPC A;  2F11 A;  1EMN A;  1IVO C;  5M1Z A;  2HTY A;  1YUG A;  4Z0K B;  2GHS A;  4L7B A;  4X4A A;  1HT5 A;  2X9M A;  1PRH A;  1HJ7 A;  1PJX A;  1IQF L;  1C5K A;  4R40 A;  5FZJ A;  3LN1 A;  1RWL A;  1XOG A;  4FM5 A;  4X8T L;  4Y7B B;  2ADX A;  3BT2 A;  3VNG A;  2YDT A;  4CSD A;  3TIB A;  2P3U A;  1ING A;  3B69 A;  4YW5 A;  2QWI A;  1EZQ B;  5CIS A;  1TPG A;  1WP5 A;  4NN9 A;  1CQ1 A;  4XJQ A;  5D9D A;  1IQN L;  3IJE B;  4UOU A;  4HHQ A;  1SLI A;  1UZJ A;  5F19 A;  4PWZ A;  3ENS A;  4YZ4 A;  1V3D A;  3FCS B;  2SIL A;  1FAK L;  4BDX A;  4COX A;  4HZX A;  1DIL A;  4N1B A;  1APQ A;  4YW3 A;  4WEG A;  1OFZ A;  1SZB A;  2RNL A;  4GU3 A;  5GX4 A;  2H2N A;  2EI6 B;  3TC9 A;  3WDZ A;  3HRP A;  2Z32 A;  1VCU A;  2W2M E;  3NTG A;  1L3Y A;  4H53 A;  3S2K A;  4L7C A;  4XJR A;  4RS0 A;  4MMY B;  1Z4W A;  4M4N A;  4MWU A;  4Z0L A;  5EO8 A;  4YW1 A;  2WPK E;  1NSB A;  1W7X L;  2IAP A;  2Y7Z B;  2BT7 A;  3KL6 B;  1IQH L;  2IAX A;  5CKM A;  4D4U A;  2PHB B;  4IFL X;  5D9B A;  4HZW A;  3BEQ A;  4LMF A;  1IVF A;  4GJT A;  4WA4 A;  4FPK A;  1N1S A;  2POO A;  1EQG A;  3OLU A;  4ASC A;  2YGQ A;  5FDQ A;  2ZW9 A;  2IAO A;  5L2Y L;  2C4L A;  3S8V A;  1F0R B;  2VVZ A;  5EX7 A;  2JKH L;  3O9K A;  2W5O A;  1QIU A;  2K2S B;  1NFW B;  1L5G B;  4MWJ A;  5FNT A;  4D52 B;  5B2D A;  1LPG A;  1EQH A;  2Y82 B;  4MX0 A;  1G1Q A;  1NPE B;  1MS8 A;  3HS5 A;  5JYY A;  1C5M F;  3SAN A;  1JV2 B;  2I9A A;  1Z4Y A;  2FP8 A;  4QN5 A;  5FNQ A;  1E8T A;  4B7J A;  1QLG A;  1IQM L;  1ADX A;  3O9J A;  4MWW A;  3WWA A;  4CUF A;  2DYH A;  4C1Y A;  4GN7 A;  2F25 A;  1H6L A;  3MQE A;  3TH3 L;  1PFX L;  2A75 A;  3N8W A;  4MWX A;  1CRU A;  5IKT A;  2VJ3 A;  2QWD A;  5H47 A;  2D1J B;  1E8V A;  2QWK A;  2QWC A;  1INY A;  2HU0 A;  2ZB6 A;  3PGH A;  2W3K B;  2AEQ A;  7NN9 A;  3NSS A;  1URK A;  1CEJ A;  1INH A;  4A94 C;  2P93 L;  2HTW A;  1IVD A;  1HT8 A;  1KLI L;  3BT1 A;  1U67 A;  5HUG A;  2WFX B;  2WPM E;  1COU A;  1V0Z A;  2F0Z A;  1CCF A;  4YZ2 A;  4D52 C;  2QWJ A;  3CFW A;  3ZGC A;  1S18 A;  3SOQ A;  3TK6 B;  2P95 L;  1F7E A;  2BMG A;  4K1I A;  2SLI A;  1MZ6 A;  4NC5 A;  4BBW A;  5EGM B;  3CYE A;  5GX5 A;  2XC4 L;  1W8N A;  4CPM A;  2AEP A;  3IAX A;  2HT8 A;  1JBU L;  4H52 A;  3G4H A;  4HZY A;  4YY8 A;  3I1C A;  2J2U B;  4NG9 L;  4XL1 A;  1U6D X;  3D12 A;  3FFG L;  1V3C A;  2AGS A;  1HZ8 A;  2H9E C;  1CX2 A;  3U7U G;  2B8H A;  3ADE A;  3UC1 A;  3S8Z A;  4HHO A;  3ASI A;  2MGP A;  1F7M A;  3IIT B;  3SOB B;  2DSO A;  3S6X A;  4CPL A;  1QFK L;  4D90 A;  3GVK A;  1YO8 A;  2RA0 L;  4IQK A;  1Z4X A;  4MWV A;  1MZ5 A;  1FAX L;  1IQK L;  2KV4 A;  2Y5H L;  3LC5 B;  5EO7 A;  2HTU A;  3AMS A;  2QWB A;  4XYX A;  2VRS A;  6COX A;  1VCJ A;  3K3A A;  2YGO A;  3HPT A;  4OTY A;  4ISH L;  4IYG A;  2XBW L;  4QNP A;  2Y38 A;  4BXW A;  2P26 A;  4JZD L;  3LTF B;  1IGZ A;  2W38 A;  2WPH E;  1S0J A;  2J95 B;  1APO A;  5L2Z L;  2K2T A;  4JYU L;  2ZWA A;  1DIY A;  3U73 A;  2OJH A;  2GVV A;  4ZY3 A;  2EI7 B;  4I00 A;  2VPJ A;  2GVX A;  4XOG A;  1S1D A;  4GZW A;  3BPS E;  4BTI A;  3SOV A;  2VVV L;  3CEN L;  4K3Y A;  2HTQ A;  3Q7D A;  4XMI A;  1AUT L;  4KS3 A;  3KQD L;  1B9V A;  1LMJ A;  2FD6 A;  4GZP A;  4FZH A;  2JJL A;  4RRX A;  1N6F A;  2F29 A;  2I9B A;  4BXS A;  1XOE A;  2BQW A;  1MQ6 L;  3KQE L;  3LIW B;  1V0E A;  2FLU X;  1IP0 A;  1B9T A;  3F1S B;  4GU4 A;  3TI4 A;  2P4O A;  1YUK B;  2FLR L;  4Y71 B;  1SNT A;  3SIL A;  2BOX A;  4BTT A;  4MC7 A;  2XBV L;  3L6V A;  4B7N A;  2MGR A;  1HAF A;  1IQI L;  1ZAQ A;  1WCQ A;  4XHB A;  1L7F A;  4GNA A;  1MS0 A;  2XZJ A;  1Z4V A;  2QE8 A;  5F72 C;  5CKN A;  3S94 A;  2F12 A;  4HZZ A;  1BJI A;  1PTH A;  4MMX B;  3DEM A;  4Q1U A;  2W2N E;  4AGT A;  1NQL B;  4X8V L;  4MJU A;  2IAR A;  2F13 A;  4X6K A;  4MWQ A;  1KSN B;  2VWO L;  1W0O A;  4GDJ A;  1CRZ A;  4GZT A;  3W09 A;  1BF9 A;  3P5B L;  4K1K A;  2IAV A;  2WPJ E;  4C16 A;  1JL9 A;  2BQ6 A; 
#chains in the Genus database with same CATH homology
 5JBB E;  3V65 B;  3F6U L;  2P3F N;  3KK6 A;  2FLB L;  1CQE A;  2FPB A;  2P3T A;  3U0S A;  2VWM K;  3O4P A;  5F1A A;  2MHP A;  3SRE A;  4Y6D B;  4YZU B;  1FSB A;  2WPI E;  1TLE A;  4G1M B;  4NGA L;  3TZI A;  1FF7 A;  3N8Z A;  1XKB A;  2J34 B;  1Q4G A;  2W8B A;  3NJP C;  2Y80 B;  3Q6T A;  2VH6 B;  2IAS A;  4GN8 A;  1G1T A;  1M1X B;  4OTJ A;  4ISI L;  3GCW E;  4CSY A;  1HRF A;  4E1G A;  2WZP P;  1WHF A;  2YGP A;  2GVU A;  4O5T A;  2GVW A;  2UWP B;  5JW1 A;  1UZQ A;  3LC3 B;  3Q6P A;  1YUF A;  1QBI A;  2BOK L;  4Z6A L;  3BYC A;  1EPI A;  2BQ7 A;  4D0E A;  3GIS X;  2Y5F L;  4X8U L;  2UWO B;  1IQE L;  2M74 A;  1N1I A;  4ZXX L;  4X8S L;  2HQS A;  3ELA L;  3Q3K B;  4GNC A;  1RFN B;  3N8W B;  3N8Y A;  1NZI A;  2F9B L;  1DQB A;  1N7D A;  4ZXY L;  2NPR A;  2FP9 A;  5K0H B;  3Q6K A;  2TGF A;  5IKQ A;  2P3F L;  3ZYI B;  1P0S L;  2OYU P;  1WU1 B;  2XBY L;  2P94 L;  4JZE L;  1ATE A;  1DVA L;  3ZYJ B;  1A3P A;  5GX2 A;  5JB8 E;  4M10 A;  5JVZ A;  1G1R A;  2P28 B;  2DG0 A;  4D0F A;  5JBC E;  1FE2 A;  2UWL B;  1C9U A;  3AMR A;  1B9W A;  5I46 L;  4GN9 A;  1OB1 C;  1CVW L;  3CA7 A;  3KCG L;  3OLT A;  3LN0 A;  4M11 A;  3LAQ A;  1XKA L;  3R05 A;  3QH0 A;  1G2M B;  2W2O E;  4RRY A;  3SRG A;  1V04 A;  1POO A;  2PUQ L;  3KQB L;  5JB9 E;  1NFU B;  1Q7F A;  1KLO A;  1LPK A;  1HRE A;  1Z6E L;  2Y5G L;  4Y79 B;  1KIG L;  2W86 A;  5GX3 A;  1EAI C;  3KRK A;  5E8D A;  4AQT A;  4RRW A;  1IJQ A;  2WYG B;  3RR3 A;  3V64 C;  1EPJ A;  1K36 A;  2BOU A;  1HX2 A;  2IAU A;  3TK5 B;  2PR3 B;  2KL7 A;  3KQC L;  1CCV A;  2V91 A;  2WFT A;  2WYJ B;  4O5S A;  3V1S A;  4MMZ B;  3KYA A;  3ZYG A;  1ATB A;  4CUD A;  1Z6C A;  1ATA A;  2Q1J B;  4ZAE B;  4YT6 L;  1E1A A;  1J9C L;  3HO5 A;  4JYV L;  3LI3 A;  3HS7 A;  1K37 A;  1YGC L;  1LMM A;  4YT7 L;  1CVU A;  1IQJ L;  5KIR A;  3HS6 A;  4XLW A;  1EPH A;  5COX A;  1LQD A;  2IAT A;  3HLI A;  2VVU L;  5CKQ A;  4O02 B;  2XBX L;  2J94 B;  3NT1 A;  4Y76 B;  2FZZ L;  1ATD A;  3G4E A;  1FFM A;  2W26 B;  2W2P E;  1G1S A;  3QMO A;  3SW2 A;  3A9H A;  1O5D L;  4O1Z A;  2B7D L;  2J38 B;  5D9C A;  2H9E L;  3DR2 A;  1EBV A;  1U8C B;  2XC0 L;  1MOX C;  2W2Q E;  3N8X A;  1NPE A;  1V3X B;  2EI8 B;  4HW6 A;  4DG6 A;  3M37 L;  4LOR A;  1P9J A;  2VAQ A;  1NFY B;  1X7A L;  4GNB A;  2Y81 B;  1PXX A;  1F0S B;  1EGF A;  1HCG B;  1LPZ A;  4PH9 A;  3M36 L;  4A0P A;  5FWW A;  4RRZ A;  4XBM A;  2W8B B;  1NT0 A;  1DX5 I;  1HAE A;  1IQL L;  3FVZ A;  3GCX E;  3MDL A;  1EMO A;  2VVC K;  5GTQ A;  4JML A;  2ISM A;  2J4I B;  4A7I A;  3TGF A;  4Y7A B;  4TGF A;  1UZP A;  2KB9 A;  3NTB A;  2Y7X B;  2G8S A;  3POY A;  2WG3 C;  1PGE A;  2XC5 L;  1IGX A;  4NA9 L;  1DDX A;  3K9X A;  3EGF A;  1MQ5 L;  3CS7 L;  2G00 L;  1TOZ A;  2KNI A;  1G2L B;  5JVY A;  3A9G A;  3FW0 A;  5JBA E;  2GD4 A;  3N8Y B;  2VWL L;  1WHE A;  1W8B L;  2FLG A;  1EPG A;  3LTG D;  2VWN L;  2VH0 B;  4BTU A;  4BDW A;  2BO2 A;  2CJI B;  1XFE A;  1IOE L;  3WW9 A;  3KGG A;  2AYL A;  1IQG L;  2IVZ A;  1RWI A;  5L30 L;  1UZK A;  2P16 L;  4ZH8 B;  2IAW A;  3N8V A;  4ZHA B;  3DAS A;  2BOH A;  3QCW A;  4IMB A;  2W3I B;  4ZLR A;  2WPL E;  1XDT R;  3C9A C;  1IOX A;  3FBY A;  3HLH A;  1I0U A;  2IAQ A;  2OYE P;  2DG1 A;  4JZF L;  5KN5 C;  3HO3 A;  1NFX B;  3TBD A;  1KLJ L;  3H5C B;  2DDU A;  5IKV A;  3E5Z A;  1GK5 A;  3LI4 A;  1CVM A;  4CUE A;  4RUT A;  2RHP A;  5GX1 A;  1FJS L;  5IKR A;  3HO4 A;  2BZ6 L;  3LI5 A;  2WG4 B;  2FPC A;  1EMN A;  1IVO C;  1YUG A;  4Z0K B;  2GHS A;  1HT5 A;  1PRH A;  1HJ7 A;  1PJX A;  1IQF L;  1C5K A;  4R40 A;  3LN1 A;  1RWL A;  4FM5 A;  4X8T L;  4Y7B B;  2ADX A;  3BT2 A;  2P3U A;  1EZQ B;  5CIS A;  1TPG A;  1CQ1 A;  5D9D A;  1IQN L;  3IJE B;  4HHQ A;  1UZJ A;  5F19 A;  4PWZ A;  3ENS A;  3FCS B;  1FAK L;  4BDX A;  4COX A;  1APQ A;  1SZB A;  2RNL A;  5GX4 A;  2EI6 B;  3TC9 A;  3HRP A;  2W2M E;  3NTG A;  1L3Y A;  3S2K A;  4RS0 A;  4MMY B;  4Z0L A;  2WPK E;  1W7X L;  2IAP A;  2Y7Z B;  3KL6 B;  1IQH L;  2IAX A;  5CKM A;  2PHB B;  5D9B A;  4LMF A;  2POO A;  1EQG A;  3OLU A;  2YGQ A;  5FDQ A;  2IAO A;  5L2Y L;  3S8V A;  1F0R B;  5EX7 A;  2JKH L;  2K2S B;  1NFW B;  1L5G B;  1LPG A;  1EQH A;  2Y82 B;  1G1Q A;  1NPE B;  3HS5 A;  1C5M F;  1JV2 B;  2I9A A;  2FP8 A;  1QLG A;  1IQM L;  1ADX A;  3WWA A;  4CUF A;  4GN7 A;  1H6L A;  3MQE A;  3TH3 L;  1PFX L;  3N8W A;  1CRU A;  5IKT A;  2VJ3 A;  2D1J B;  3PGH A;  2W3K B;  1URK A;  1CEJ A;  4A94 C;  2P93 L;  1HT8 A;  1KLI L;  3BT1 A;  1U67 A;  2WFX B;  2WPM E;  1COU A;  1CCF A;  3CFW A;  3SOQ A;  3TK6 B;  2P95 L;  1F7E A;  2BMG A;  5EGM B;  5GX5 A;  2XC4 L;  3IAX A;  1JBU L;  3G4H A;  3I1C A;  2J2U B;  4NG9 L;  4XL1 A;  3FFG L;  1HZ8 A;  2H9E C;  1CX2 A;  3U7U G;  3S8Z A;  4HHO A;  3ASI A;  2MGP A;  1F7M A;  3IIT B;  3SOB B;  2DSO A;  3S6X A;  1QFK L;  4D90 A;  1YO8 A;  2RA0 L;  1FAX L;  1IQK L;  2KV4 A;  2Y5H L;  3LC5 B;  3AMS A;  6COX A;  2YGO A;  3HPT A;  4OTY A;  4ISH L;  4IYG A;  2XBW L;  2Y38 A;  4BXW A;  2P26 A;  4JZD L;  3LTF B;  1IGZ A;  2WPH E;  2J95 B;  1APO A;  5L2Z L;  2K2T A;  4JYU L;  1DIY A;  3U73 A;  2OJH A;  2GVV A;  2EI7 B;  2GVX A;  3BPS E;  4BTI A;  3SOV A;  2VVV L;  3CEN L;  3Q7D A;  1AUT L;  3KQD L;  1LMJ A;  2FD6 A;  4RRX A;  2I9B A;  4BXS A;  2BQW A;  1MQ6 L;  3KQE L;  3LIW B;  1IP0 A;  3F1S B;  2P4O A;  1YUK B;  2FLR L;  4Y71 B;  2BOX A;  4BTT A;  2XBV L;  2MGR A;  1HAF A;  1IQI L;  1ZAQ A;  4GNA A;  2QE8 A;  5CKN A;  3S94 A;  1PTH A;  4MMX B;  3DEM A;  4Q1U A;  2W2N E;  1NQL B;  4X8V L;  2IAR A;  1KSN B;  2VWO L;  1CRZ A;  1BF9 A;  3P5B L;  2IAV A;  2WPJ E;  4C16 A;  1JL9 A;  2BQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...