3V65B

Crystal structure of agrin and lrp4 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
335
structure length
330
Chain Sequence
b'YCSQGCTFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Agrin
publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 71
structure length 330
sequence length 335
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
B PF12662 cEGF Complement Clr-like EGF-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3v65B01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3v65B02
3LI5A 3N8WB 2IVZA 4MMZB 1C5MF 1JL9A 2HQSA 3BYCA 1YUFA 2Y5HL 2VAQA 1P9JA 3G4EA 4Y71B 4MMXB 2FPBA 3SOQA 4ZHAB 3TBDA 4O5SA 1Q7FA 4CUDA 1MQ5L 1FAKL 2WPHE 2J2UB 1ADXA 2DG0A 3G4HA 3N8YA 4JYUL 1H6LA 3LI4A 2W86A 2RNLA 4M11A 1G1SA 2XBVL 4ZH8B 2IAWA 3CS7L 5D9CA 1FFMA 1C9UA 5GX5A 2P3FL 3GCXE 4JMLA 3PGHA 1JV2B 4D0FA 1IQNL 2BQ6A 2D1JB 3LN1A 2FP9A 5EGMB 2IATA 1LPZA 3Q7DA 2W2OE 1CCVA 1V04A 2P3FN 3QCWA 4YT6L 3TK5B 1SZBA 4Z6AL 2OJHA 4OTJA 1RWIA 2DG1A 3RR3A 1PRHA 4GNCA 2VWOL 4Y6DB 3SREA 4RRWA 1EQHA 2P26A 3N8VA 1HAEA 3N8YB 1B9WA 2VVCK 1IGZA 1RWLA 3ZYJB 1FAXL 1WHFA 1Z6EL 3A9GA 1A3PA 4ZLRA 4R40A 3U73A 4X8VL 2PHBB 3FBYA 3HO4A 1IQML 2WFTA 2KV4A 4JZDL 1PXXA 3H5CB 1W7XL 1CVUA 4ZXXL 4BTTA 2WG4B 3TK6B 1UZJA 1YGCL 2KL7A 1G2MB 1ZAQA 1CRZA 1DVAL 2G00L 1EAIC 2WPKE 3HO3A 5EX7A 1QFKL 2PR3B 3LN0A 3ZYIB 3SOBB 2J38B 1YO8A 3NTGA 3TZIA 2FD6A 1IP0A 1AUTL 3K9XA 3IAXA 5GX4A 1APOA 1KLOA 2IAXA 1EMOA 1O5DL 3LTGD 4GN7A 6COXA 3NJPC 1WHEA 5F1AA 1K37A 4LORA 3A9HA 2P93L 4X8SL 5IKQA 1CX2A 2Y81B 1IQJL 5D9DA 3FCSB 5D9BA 4RRYA 3HPTA 1I0UA 4A0PA 4CUEA 4A7IA 4COXA 2IAUA 3MQEA 3V64C 1N7DA 1PGEA 3EGFA 1HRFA 1BF9A 1IQLL 3S8ZA 3Q6KA 3TGFA 1P0SL 2RHPA 3KQDL 5KIRA 1J9CL 2WFXB 4JZEL 4RRZA 2VWLL 3BT1A 1F0SB 4HHQA 3S94A 1HCGB 5JB8E 1IVOC 1G1RA 2NPRA 1IQHL 2XC5L 3CENL 4TGFA 1IQFL 1FSBA 1G1TA 5JW1A 2YGOA 3S8VA 4GNBA 2WPIE 3AMRA 4CSYA 1XKBA 3ENSA 2YGPA 1ATEA 2POOA 3MDLA 2XC4L 3BPSE 2OYUP 5F19A 3ZYGA 4O1ZA 4XBMA 4DG6A 2J94B 1WU1B 1KLJL 1UZPA 2JKHL 4IMBA 1LPGA 5KN5C 2W2PE 2J95B 2VWMK 1QBIA 1APQA 2CJIB 4Y79B 2WPJE 2Y5FL 3GISX 3OLTA 2W26B 5CKMA 2VWNL 3M36L 3N8ZA 1CVWL 1JBUL 3FVZA 2FZZL 1HT8A 4BDXA 1CQEA 1HJ7A 3QH0A 5FWWA 2XBYL 3O4PA 1HX2A 5GTQA 4ISIL 2TGFA 3LIWB 5IKRA 3HS7A 4RRXA 2K2SB 1CCFA 2GVXA 1NFYB 2P3TA 2BQ7A 1HAFA 2W3KB 1C5KA 1NFWB 2P95L 2Y7ZB 3Q6TA 2F9BL 5IKVA 1LPKA 3ELAL 1CQ1A 2BOXA 4ZAEB 1QLGA 4HHOA 3R05A 1ATBA 2W2ME 1TLEA 3E5ZA 1EZQB 4IYGA 1G1QA 4XLWA 3ASIA 3NTBA 1U67A 5FDQA 4X8TL 4FM5A 1EPJA 4X8UL 3V65B 3C9AC 3U0SA 2WG3C 1MOXC 2IAPA 3M37L 2Y5GL 3IITB 5K0HB 1RFNB 1NFXB 4BXSA 2BOKL 1DQBA 1IQIL 3IJEB 4RUTA 1KLIL 2P94L 2EI6B 4XL1A 4Z0KB 4Q1UA 4OTYA 1TOZA 2WPME 1M1XB 2BQWA 1HREA 1U8CB 2MHPA 1Q4GA 2P28B 2XBXL 4D0EA 1NT0A 2WYJB 3HRPA 2XBWL 4Y76B 5I46L 4BDWA 1IJQA 4ZXYL 2EI8B 5IKTA 3KRKA 1LQDA 1XFEA 2XC0L 3P5BL 2J4IB 4JYVL 1EPHA 3DR2A 1MQ6L 3KCGL 3AMSA 3HLIA 1UZQA 1IGXA 1NQLB 2W8BA 1KIGL 1IOXA 4Y7BB 2OYEP 1COUA 3KL6B 1E1AA 1IQKL 1FF7A 5JVZA 2VVUL 3HS5A 2WPLE 4PH9A 1V3XB 2GHSA 2Y38A 4GN9A 5JBAE 1UZKA 1KSNB 1CRUA 2M74A 3SRGA 3S2KA 1F7MA 2MGRA 4HW6A 3I1CA 4NGAL 5L2ZL 2BOUA 1ATDA 5GX2A 5CISA 5E8DA 3FFGL 1LMJA 1L5GB 2UWLB 5CKNA 1X7AL 2G8SA 1GK5A 2W2QE 3GCWE 3U7UG 3KQBL 4GNAA 4Z0LA 2IARA 2W8BB 3NT1A 1CVMA 1L3YA 3BT2A 1DDXA 3TH3L 3Q6PA 1W8BL 2BMGA 3KQEL 4BXWA 5L30L 2VH6B 2W3IB 2VH0B 2VJ3A 3WW9A 3SW2A 3KQCL 2GVVA 1NZIA 1F0RB 2AYLA 3N8XA 3HS6A 1N1IA 2UWOB 3POYA 3CA7A 4M10A 4PWZA 1XDTR 2GVWA 2I9BA 2RA0L 4LMFA 4JZFL 2K2TA 1F7EA 4Y7AB 1NPEA 3LAQA 2FP8A 5JB9E 2VVVL 2I9AA 5GX3A 4E1GA 2GD4A 1YUGA 3KGGA 3KYAA 2P3UA 2P16L 5JVYA 2J34B 5JBCE 1NFUB 2V91A 2UWPB 2MGPA 1IOEL 2IAVA 3HLHA 3LC5B 1URKA 3F1SB 2P4OA 2FLGA 2BOHA 2Y80B 3Q3KB 1IQEL 1DIYA 1PFXL 2FLBL 2W2NE 4MMYB 4ISHL 1EQGA 3LTFB 2DSOA 1IQGL 4O02B 4YT7L 1FE2A 1DX5I 1PTHA 3WWAA 1NPEB 2BZ6L 3DEMA 5GX1A 2PUQL 1Z6CA 4D90A 5COXA 1PJXA 1G2LB 1CEJA 2EI7B 4AQTA 5CKQA 1EMNA 2BO2A 1EPIA 3FW0A 4CUFA 3N8WA 1EGFA 1K36A 4YZUB 2Y7XB 3LC3B 1YUKB 4BTUA 3V1SA 2Y82B 1FJSL 1HZ8A 2ISMA 5JBBE 2H9EL 1OB1C 2QE8A 2IAQA 2KB9A 3OLUA 3DASA 4NA9L 2ADXA 2FLRL 4BTIA 3F6UL 3TC9A 3SOVA 1POOA 3QMOA 1HT5A 4RS0A 4NG9L 1ATAA 2WYGB 2IAOA 4O5TA 3HO5A 4GN8A 4G1MB 2GVUA 1TPGA 3KK6A 1EBVA 4C16A 1EPGA 1XKAL 2B7DL 3CFWA 2IASA 2DDUA 2Q1JB 3LI3A 2FPCA 5L2YL
chains in the Genus database with same CATH superfamily
3LI5A 3N8WB 2IVZA 4M4VA 4MMZB 1C5MF 2H9EC 1JL9A 2HQSA 2X9MA 2YA4A 3BYCA 1YUFA 1NMCA 2HT8A 3OPZA 2Y5HL 2VAQA 1P9JA 3G4EA 4Y71B 2BATA 4MMXB 2FPBA 3SOQA 4ZHAB 3TBDA 3B7EA 4O5SA 5FNRA 1DIMA 5EO8A 4CPNA 1Q7FA 4CUDA 1WCQA 4XIKA 2Z32A 1MQ5L 1FAKL 4FPFA 2WPHE 3TI3A 4QN6A 2J2UB 1ADXA 2VW2A 3GVLA 2DG0A 2QWDA 3G4HA 1EUSA 1V0EA 4XJZA 4B7QA 4B7MA 4CPZA 3N8YA 5F9TA 4JYUL 1H6LA 4FPOB 1INYA 3LI4A 1NSDA 2W86A 1N1VA 2RNLA 1V3EA 2QWAA 4M11A 1G1SA 4WA3A 1MS8A 4FOWA 2XBVL 4ZH8B 4YZ1A 2IAWA 3CS7L 5D9CA 4XMBA 1FFMA 1C9UA 5GX5A 2P3FL 3GCXE 4JMLA 4K1HA 3PGHA 1ZGKA 4K1IA 1JV2B 1MS9A 4D0FA 2RKCA 3PJQA 4FOVA 4GU4A 1IQNL 2VK6A 1MS5A 2BQ6A 2D1JB 3LN1A 2H2NA 4I00A 1Z4XA 2FP9A 5EGMB 2IATA 2SLIA 1LPZA 3Q7DA 2W2OE 1CCVA 1V04A 2QWFA 2P3FN 3QCWA 4GDIA 4MWYA 4YT6L 1QIUA 1SZBA 3TK5B 4Z6AL 2OJHA 2BERA 5B2DA 4AGIA 4OTJA 2DYHA 1RWIA 2DG1A 4IQKA 3RR3A 3GVJA 1NNCA 3L6VA 1PRHA 4XJQA 4GNCA 2VWOL 1USRA 4Y6DB 4FVKA 3SREA 4RRWA 1EQHA 2VK5A 2P26A 3N8VA 1HAEA 3N8YB 1B9WA 4AH4A 2VVCK 4MJUA 1IGZA 1RWLA 3ZYJB 4MWVA 1X2JA 1FAXL 1Z4WA 1WHFA 1Z6EL 3A9GA 1A3PA 1W21A 5FZNA 1SO7A 3U73A 4R40A 4ZLRA 4X8VL 4CSDA 2PHBB 3FBYA 1IVCA 3GVKA 3HO4A 3ADEA 4CPYA 1IQML 2WFTA 4HZYA 2KV4A 4JZDL 2VSMA 4FPLA 1PXXA 4YZ3A 4D52B 3H5CB 1W7XL 1CVUA 2F28A 3CL0A 4Q6KA 4ZXXL 4BTTA 2WG4B 3TK6B 1UZJA 1YGCL 2KL7A 2VSKA 1E8UA 1MS3A 1S18A 2HU4A 1L7HA 2WZPP 1G2MB 1ZAQA 1CRZA 1X2RA 1DVAL 3ZGDA 2G00L 4IN4A 7NN9A 2ZB5A 1N6EA 1EAIC 1F8CA 2WPKE 3HO3A 3ALWA 5EX7A 1QFKL 2PR3B 3LN0A 3ZYIB 3SOBB 4QN5A 4CPOA 2J38B 1YO8A 1INHA 3NTGA 3TI8A 1MZ6A 3TZIA 2FD6A 2QWGA 1IP0A 3TIBA 1AUTL 3K9XA 4HZVA 2XCYA 3VNGA 2HT5A 4WA5A 2KNIA 3IAXA 2AEQA 5HUMA 1A4GA 3UC1A 5GX4A 1APOA 1KLOA 2IAXA 2F27A 1EMOA 4KS1A 4XHBA 1O5DL 3LTGD 4GN7A 4L7BA 6COXA 4UF7A 4J9TA 3BEQA 3NJPC 3O9KA 1WHEA 2AEPA 5F1AA 1K37A 4GDJA 4LORA 3A9HA 2P93L 4X8SL 5IKQA 4B7RA 4XJ8A 1CX2A 4MWQA 2BT8A 2Y81B 1IQJL 1V1HA 4HZXA 4NC5A 5D9DA 4GZOA 3FCSB 5D9BA 4RRYA 4YW4A 3HPTA 1I0UA 4A0PA 4CUEA 4A7IA 4COXA 2IAUA 3MQEA 3V64C 1N7DA 1PGEA 3EGFA 6NN9A 1HRFA 1BF9A 1IQLL 2QWEA 2VWDA 3Q6KA 3S8ZA 1W8OA 5FNUA 3TGFA 1P0SL 2RHPA 3KQDL 4CH9A 5CGJA 5KIRA 1J9CL 2WFXB 4JZEL 1NMBN 4RRZA 2XZIA 2VWLL 3BT1A 1F0SB 5HUGA 3INBA 2F26A 4HHQA 3S94A 3H73A 5HX0A 1HCGB 5JB8E 1A4QA 5JYYA 1IVOC 1G1RA 1IVFA 2NPRA 1IQHL 2XC5L 4XJAA 3CENL 4QNPA 4CHBA 4TGFA 1IQFL 1FSBA 1G1TA 4YW1A 2B8HA 5JW1A 4NCSA 4WA4A 2VW0A 2YGOA 3JU4A 3S8VA 4GNBA 3H72A 3II7A 2WPIE 3SILA 1IVDA 3AMRA 2HTQA 2QWHA 4CSYA 1XKBA 3ENSA 4GZWA 2YGPA 1ATEA 1V0FA 3MDLA 2POOA 2XC4L 3BPSE 3A71A 2F29A 2OYUP 5F19A 3ZYGA 4O1ZA 4XBMA 1B9SA 2J94B 1N6DA 3NN9A 4DG6A 2HTRA 1W0OA 3TIAA 1WU1B 3ALXA 4A94C 2BZDA 1SUUA 1KLJL 1UZPA 2JKHL 1W1XA 4IMBA 1V3CA 1LPGA 5KN5C 2W2PE 2J95B 2VWMK 4MZAA 1QBIA 2C4LA 1APQA 2CJIB 4X4AA 2H2UA 4Y79B 2WPJE 2Y5FL 1V0ZA 3GISX 1NNAA 2YDPA 3OLTA 4FOQA 2W26B 5CKMA 1MS1A 3SALA 4MWUA 2VWNL 1B9VA 1E8VA 2C4AA 3M36L 3N8ZA 1F8DA 5NN9A 1CVWL 1ZI0A 4MX0A 4GJTA 4FPJA 1JBUL 4FJ6A 1IVEA 4GB1A 1WP5A 4MZEA 1MZ5A 4AHAA 4FP3A 3FVZA 3W09A 2FZZL 1HT8A 4ZY3A 3K3AA 4KS2A 4BDXA 4GEZA 1CQEA 2W5NA 1HJ7A 4H53A 3QH0A 5FWWA 1S0IA 3K39A 3H6JA 2XBYL 2VRSA 3O4PA 1W0PA 1HX2A 5GTQA 4ISIL 2TGFA 1V3DA 3LIWB 1F8BA 1NMAN 5IKRA 3HS7A 4RRXA 2A75A 1MR5A 2K2SB 1CCFA 2W5OA 4CPLA 2GVXA 1NFYB 1N6FA 2QWJA 2P3TA 4YZ2A 2BQ7A 1HAFA 4GZQA 2W3KB 1C5KA 2YDTA 1NFWB 4YW3A 2P95L 2Y7ZB 3H71A 3Q6TA 2AH2A 2F9BL 5IKVA 1LPKA 1MS4A 3ELAL 1CQ1A 2BOXA 4ZAEB 1QLGA 1W8NA 2HT7A 3R05A 3A72A 4HHOA 1ATBA 4IFLX 2W2ME 4XMAA 4YW5A 2CMLA 1TLEA 3E5ZA 1EZQB 4MWWA 4IYGA 4ZGCA 2HTWA 4GZPA 1G1QA 1W20A 4XLWA 3D12A 1NCAN 3ASIA 3NTBA 1U67A 5FDQA 4X8TL 4FM5A 1EPJA 2QWCA 4X8UL 3V65B 3C9AC 2HTUA 3ZGCA 4M4NA 4UOUA 3U0SA 2WG3C 1MOXC 5M1ZA 2IAPA 4HZZA 3M37L 1B9TA 2Y5GL 3IITB 1NCBN 3CKZA 5K0HB 1RFNB 1USXA 1NFXB 4BXSA 4G3NA 3SANA 2BOKL 1DQBA 1IQIL 1WCSA 4XE9A 3IJEB 4RUTA 4X6KA 2BSFA 1KLIL 1OFZA 2P94L 2EI6B 4XL1A 4Z0KB 4Q1UA 4OTYA 2QWKA 1TOZA 2WPME 1M1XB 1E8TA 2BQWA 4MWXA 1HREA 4AGTA 4KS5A 1U8CB 4XJ9A 2MHPA 2QWIA 2WOZA 1Q4GA 2P28B 2XBXL 4D0EA 4XHXA 2HU0A 1NT0A 2WYJB 1L7GA 3D11A 2HORA 3HRPA 2XBWL 4Y76B 5I46L 4BDWA 1IJQA 4ZXYL 2EI8B 2JJLA 3TI6A 5IKTA 3KRKA 1LQDA 1XFEA 2XC0L 4B7JA 3P5BL 2J4IB 4JYVL 1EPHA 3DR2A 1KKEA 1MQ6L 4KS4A 3KCGL 3AMSA 4XMIA 1INVA 3HLIA 1UZQA 1N1YA 5FNTA 1IGXA 1NQLB 4K3YA 4L7CA 1LMMA 3CL2A 2W8BA 1KIGL 2HTYA 1IOXA 4Y7BB 2OYEP 1COUA 3KL6B 1E1AA 4YW2A 5HUNA 1IQKL 1FF7A 5JVZA 2VVUL 3HS5A 2VVZA 2WPLE 4ASCA 4PH9A 1V3XB 2GHSA 2Y38A 2FLUX 4GN9A 5JBAE 4QN4A 1UZKA 1KSNB 1CRUA 1EUTA 2JKBA 2M74A 2ZWAA 4JF7A 4FPGA 3SRGA 3B69A 5HUKA 3S2KA 1F7MA 2MGRA 4HW6A 3I1CA 1MS0A 4NGAL 4MWRA 5H47A 4YZ5A 4XJRA 5L2ZL 1NN2A 2BOUA 1ATDA 3NO0A 5GX2A 5CISA 5E8DA 3FFGL 2F25A 1INWA 3CYEA 1LMJA 1L5GB 2UWLB 4QN3A 5CKNA 4NN9A 1SNTA 1INFA 5F72C 3K38A 1X7AL 1MWEA 2G8SA 4MWJA 1GK5A 4HIZA 1BJIA 1XOEA 2W2QE 3GCWE 3U7UG 3KQBL 4GNAA 3TI5A 4Z0LA 2IARA 2W8BB 3NT1A 1CVMA 1L3YA 2VW1A 3BT2A 1SLLA 4FOYA 2ZB6A 1DDXA 4K1KA 3TH3L 4GZSA 3Q6PA 1W8BL 2BMGA 4BBWA 3KQEL 4BXWA 4XYXA 4SLIA 5L30L 4GU3A 2VH6B 2W3IB 2VH0B 1V3BA 2BF6A 4KS3A 3S6XA 1INXA 2VJ3A 4D4UA 4FPHA 1S0JA 3WW9A 1V2IA 3SW2A 4FP2A 4D52A 3KQCL 2GVVA 1NZIA 1KITA 1F0RB 2AYLA 2HOXA 3O9JA 3N8XA 4YY8A 3HS6A 4MC7A 4N1BA 1N1IA 2UWOB 3POYA 3CA7A 4WEGA 4M10A 2YA5A 4PWZA 1XDTR 1N1SA 2VK7A 4H52A 1VCJA 2GVWA 2I9BA 2RA0L 1L7FA 4FPCA 4LMFA 4JZFL 1Z4YA 2K2TA 1F7EA 4Y7AB 1N1TA 2SIMA 1NPEA 1IVBA 3LAQA 4XOGA 1K32A 1IUBA 2YA8A 4YZ4A 4FQ4A 1Z4VA 2FP8A 1S1DA 1A14N 5JB9E 2VVVL 2I9AA 5GX3A 4E1GA 5FZJA 3TICA 2GD4A 1YUGA 3KGGA 1INGA 4CPMA 3KYAA 2P3UA 4XILA 4DGRA 2P16L 5JVYA 1NSBA 2J34B 5JBCE 1NFUB 2V91A 2UWPB 2MGPA 1IUCA 1IOEL 2F0ZA 2IAVA 3HLHA 3LC5B 1URKA 1Z50A 2F10A 4GZTA 4MJVA 2XZJA 3F1SB 2P4OA 3K36A 2FLGA 2BOHA 1VCUA 2Y80B 3Q3KB 4FPYA 4C1YA 1IQEL 1DIYA 1PFXL 2FLBL 2W2NE 4MMYB 1SLIA 5FNSA 2BT7A 4ISHL 1EQGA 5EO7A 3LTFB 2DSOA 4D52C 1NSCA 3NSSA 4XJWA 1IQGL 4O02B 4X49A 1NCDN 2F11A 1IVGA 2XZKA 4YT7L 1FE2A 2VPJA 1DX5I 1PTHA 3WWAA 1NPEB 2BZ6L 3DEMA 2YGQA 5GX1A 2PUQL 1Z6CA 4D90A 5COXA 1NCCN 1EURA 2W20A 4XJUA 3SLIA 1PJXA 1G2LB 1DILA 4MWLA 1V1IA 1U6DX 4GZXA 1CEJA 2EI7B 4IFNX 4AQTA 4B7NA 5CKQA 4IFJA 1EMNA 2BO2A 1EPIA 3FW0A 4CUFA 3N8WA 1EGFA 2F24A 2F13A 1K36A 4YZUB 4M4UA 2Y7XB 3LC3B 1YUKB 4BTUA 3V1SA 2Y82B 1FJSL 4C1YB 1HZ8A 2FHRA 3WN7A 4FPEA 2ISMA 4HZWA 5JBBE 2H9EL 1NNBA 1OB1C 2QE8A 5FNQA 2IAQA 3TI4A 5B2CA 4M3MA 2KB9A 2F12A 3OLUA 2ZZKA 3DASA 4NA9L 2ADXA 2FLRL 4BTIA 2AGSA 3F6UL 3TC9A 3SOVA 1POOA 3QMOA 2XN4A 4XIOA 1HT5A 4RS0A 2ZW9A 4NG9L 1LK9A 1ATAA 4FZHA 4K1JA 2WYGB 4QN7A 3WDZA 2YA6A 2IAOA 4L7DA 1F8EA 4O5TA 1XOGA 3HO5A 4GN8A 4G1MB 2GVUA 4FPKA 1TPGA 3T1EA 2HTVA 3KK6A 4WEFA 1EBVA 4C16A 1Z4ZA 4X47A 2W38A 1EPGA 1XKAL 2B7DL 1EUUA 2SILA 3CFWA 2IASA 3VNHA 2DDUA 2YA7A 2Q1JB 4D8SA 3K37A 3LI3A 2FPCA 2QWBA 5L2YL
chains in the Genus database with same CATH topology
3LI5A 3N8WB 2IVZA 4MMZB 1C5MF 2H9EC 1JL9A 2HQSA 3BYCA 1YUFA 2Y5HL 2VAQA 1P9JA 3G4EA 4Y71B 4MMXB 2FPBA 3SOQA 4ZHAB 3TBDA 4O5SA 1Q7FA 4CUDA 1MQ5L 1FAKL 2WPHE 2J2UB 1ADXA 2DG0A 3G4HA 3N8YA 4JYUL 1H6LA 3LI4A 2W86A 2RNLA 4M11A 1G1SA 2XBVL 4ZH8B 2IAWA 3CS7L 5D9CA 1FFMA 1C9UA 5GX5A 2P3FL 3GCXE 4JMLA 3PGHA 1JV2B 4D0FA 1IQNL 2BQ6A 2D1JB 3LN1A 2FP9A 5EGMB 2IATA 1LPZA 3Q7DA 2W2OE 1CCVA 1V04A 2P3FN 3QCWA 4YT6L 3TK5B 1SZBA 4Z6AL 2OJHA 4OTJA 1RWIA 2DG1A 3RR3A 1PRHA 4GNCA 2VWOL 4Y6DB 3SREA 4RRWA 1EQHA 2P26A 3N8VA 1HAEA 3N8YB 1B9WA 2VVCK 1IGZA 1RWLA 3ZYJB 1FAXL 1WHFA 1Z6EL 3A9GA 1A3PA 4ZLRA 4R40A 3U73A 4X8VL 2PHBB 3FBYA 3HO4A 1IQML 2WFTA 2KV4A 4JZDL 1PXXA 3H5CB 1W7XL 1CVUA 4ZXXL 4BTTA 2WG4B 3TK6B 1UZJA 1YGCL 2KL7A 2WZPP 1G2MB 1ZAQA 1CRZA 1DVAL 2G00L 1EAIC 2WPKE 3HO3A 5EX7A 1QFKL 2PR3B 3LN0A 3ZYIB 3SOBB 2J38B 1YO8A 3NTGA 3TZIA 2FD6A 1IP0A 1AUTL 3K9XA 2KNIA 3IAXA 5GX4A 1APOA 1KLOA 2IAXA 1EMOA 1O5DL 3LTGD 4GN7A 6COXA 3NJPC 1WHEA 5F1AA 1K37A 4LORA 3A9HA 2P93L 4X8SL 5IKQA 1CX2A 2Y81B 1IQJL 5D9DA 3FCSB 5D9BA 4RRYA 3HPTA 1I0UA 4A0PA 4CUEA 4A7IA 4COXA 2IAUA 3MQEA 3V64C 1N7DA 1PGEA 3EGFA 1HRFA 1BF9A 1IQLL 3S8ZA 3Q6KA 3TGFA 1P0SL 2RHPA 3KQDL 5KIRA 1J9CL 2WFXB 4JZEL 4RRZA 2VWLL 3BT1A 1F0SB 4HHQA 3S94A 1HCGB 5JB8E 1IVOC 1G1RA 2NPRA 1IQHL 2XC5L 3CENL 4TGFA 1IQFL 1FSBA 1G1TA 5JW1A 2YGOA 3S8VA 4GNBA 2WPIE 3AMRA 4CSYA 1XKBA 3ENSA 2YGPA 1ATEA 2POOA 3MDLA 2XC4L 3BPSE 2OYUP 5F19A 3ZYGA 4O1ZA 4XBMA 4DG6A 2J94B 1WU1B 4A94C 1KLJL 1UZPA 2JKHL 4IMBA 1LPGA 5KN5C 2W2PE 2J95B 2VWMK 1QBIA 1APQA 2CJIB 4Y79B 2WPJE 2Y5FL 3GISX 3OLTA 2W26B 5CKMA 2VWNL 3M36L 3N8ZA 1CVWL 1JBUL 3FVZA 2FZZL 1HT8A 4BDXA 1CQEA 1HJ7A 3QH0A 5FWWA 2XBYL 3O4PA 1HX2A 5GTQA 4ISIL 2TGFA 3LIWB 5IKRA 3HS7A 4RRXA 2K2SB 1CCFA 2GVXA 1NFYB 2P3TA 2BQ7A 1HAFA 2W3KB 1C5KA 1NFWB 2P95L 2Y7ZB 3Q6TA 2F9BL 5IKVA 1LPKA 3ELAL 1CQ1A 2BOXA 4ZAEB 1QLGA 4HHOA 3R05A 1ATBA 2W2ME 1TLEA 3E5ZA 1EZQB 4IYGA 1G1QA 4XLWA 3ASIA 3NTBA 1U67A 5FDQA 4X8TL 4FM5A 1EPJA 4X8UL 3V65B 3C9AC 3U0SA 2WG3C 1MOXC 2IAPA 3M37L 2Y5GL 3IITB 5K0HB 1RFNB 1NFXB 4BXSA 2BOKL 1DQBA 1IQIL 3IJEB 4RUTA 1KLIL 2P94L 2EI6B 4XL1A 4Z0KB 4Q1UA 4OTYA 1TOZA 2WPME 1M1XB 2BQWA 1HREA 1U8CB 2MHPA 1Q4GA 2P28B 2XBXL 4D0EA 1NT0A 2WYJB 3HRPA 2XBWL 4Y76B 5I46L 4BDWA 1IJQA 4ZXYL 2EI8B 5IKTA 3KRKA 1LQDA 1XFEA 2XC0L 3P5BL 2J4IB 4JYVL 1EPHA 3DR2A 1MQ6L 3KCGL 3AMSA 3HLIA 1UZQA 1IGXA 1NQLB 1LMMA 2W8BA 1KIGL 1IOXA 4Y7BB 2OYEP 1COUA 3KL6B 1E1AA 1IQKL 1FF7A 5JVZA 2VVUL 3HS5A 2WPLE 4PH9A 1V3XB 2GHSA 2Y38A 4GN9A 5JBAE 1UZKA 1KSNB 1CRUA 2M74A 3SRGA 3S2KA 1F7MA 2MGRA 4HW6A 3I1CA 4NGAL 5L2ZL 2BOUA 1ATDA 5GX2A 5CISA 5E8DA 3FFGL 1LMJA 1L5GB 2UWLB 5CKNA 1X7AL 2G8SA 1GK5A 2W2QE 3GCWE 3U7UG 3KQBL 4GNAA 4Z0LA 2IARA 2W8BB 3NT1A 1CVMA 1L3YA 3BT2A 1DDXA 3TH3L 3Q6PA 1W8BL 2BMGA 3KQEL 4BXWA 5L30L 2VH6B 2W3IB 2VH0B 3S6XA 2VJ3A 3WW9A 3SW2A 3KQCL 2GVVA 1NZIA 1F0RB 2AYLA 3N8XA 3HS6A 1N1IA 2UWOB 3POYA 3CA7A 4M10A 4PWZA 1XDTR 2GVWA 2I9BA 2RA0L 4LMFA 4JZFL 2K2TA 1F7EA 4Y7AB 1NPEA 3LAQA 2FP8A 5JB9E 2VVVL 2I9AA 5GX3A 4E1GA 2GD4A 1YUGA 3KGGA 3KYAA 2P3UA 2P16L 5JVYA 2J34B 5JBCE 1NFUB 2V91A 2UWPB 2MGPA 1IOEL 2IAVA 3HLHA 3LC5B 1URKA 3F1SB 2P4OA 2FLGA 2BOHA 2Y80B 3Q3KB 1IQEL 1DIYA 1PFXL 2FLBL 2W2NE 4MMYB 4ISHL 1EQGA 3LTFB 2DSOA 1IQGL 4O02B 4YT7L 1FE2A 1DX5I 1PTHA 3WWAA 1NPEB 2BZ6L 3DEMA 2YGQA 5GX1A 2PUQL 1Z6CA 4D90A 5COXA 1PJXA 1G2LB 1CEJA 2EI7B 4AQTA 5CKQA 1EMNA 2BO2A 1EPIA 3FW0A 4CUFA 3N8WA 1EGFA 1K36A 4YZUB 2Y7XB 3LC3B 1YUKB 4BTUA 3V1SA 2Y82B 1FJSL 1HZ8A 2ISMA 5JBBE 2H9EL 1OB1C 2QE8A 2IAQA 2KB9A 3OLUA 3DASA 4NA9L 2ADXA 2FLRL 4BTIA 3F6UL 3TC9A 3SOVA 1POOA 3QMOA 1HT5A 4RS0A 4NG9L 1ATAA 2WYGB 2IAOA 4O5TA 3HO5A 4GN8A 4G1MB 2GVUA 1TPGA 3KK6A 1EBVA 4C16A 1EPGA 1XKAL 2B7DL 3CFWA 2IASA 2DDUA 2Q1JB 3LI3A 2FPCA 5L2YL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI5 A;  3N8W B;  2IVZ A;  4MMZ B;  1C5M F;  1JL9 A;  2HQS A;  3BYC A;  1YUF A;  2Y5H L;  2VAQ A;  1P9J A;  3G4E A;  4Y71 B;  4MMX B;  2FPB A;  3SOQ A;  4ZHA B;  3TBD A;  4O5S A;  1Q7F A;  4CUD A;  1MQ5 L;  1FAK L;  2WPH E;  2J2U B;  1ADX A;  2DG0 A;  3G4H A;  3N8Y A;  4JYU L;  1H6L A;  3LI4 A;  2W86 A;  2RNL A;  4M11 A;  1G1S A;  2XBV L;  4ZH8 B;  2IAW A;  3CS7 L;  5D9C A;  1FFM A;  1C9U A;  5GX5 A;  2P3F L;  3GCX E;  4JML A;  3PGH A;  1JV2 B;  4D0F A;  1IQN L;  2BQ6 A;  2D1J B;  3LN1 A;  2FP9 A;  5EGM B;  2IAT A;  1LPZ A;  3Q7D A;  2W2O E;  1CCV A;  1V04 A;  2P3F N;  3QCW A;  4YT6 L;  3TK5 B;  1SZB A;  4Z6A L;  2OJH A;  4OTJ A;  1RWI A;  2DG1 A;  3RR3 A;  1PRH A;  4GNC A;  2VWO L;  4Y6D B;  3SRE A;  4RRW A;  1EQH A;  2P26 A;  3N8V A;  1HAE A;  3N8Y B;  1B9W A;  2VVC K;  1IGZ A;  1RWL A;  3ZYJ B;  1FAX L;  1WHF A;  1Z6E L;  3A9G A;  1A3P A;  4ZLR A;  4R40 A;  3U73 A;  4X8V L;  2PHB B;  3FBY A;  3HO4 A;  1IQM L;  2WFT A;  2KV4 A;  4JZD L;  1PXX A;  3H5C B;  1W7X L;  1CVU A;  4ZXX L;  4BTT A;  2WG4 B;  3TK6 B;  1UZJ A;  1YGC L;  2KL7 A;  1G2M B;  1ZAQ A;  1CRZ A;  1DVA L;  2G00 L;  1EAI C;  2WPK E;  3HO3 A;  5EX7 A;  1QFK L;  2PR3 B;  3LN0 A;  3ZYI B;  3SOB B;  2J38 B;  1YO8 A;  3NTG A;  3TZI A;  2FD6 A;  1IP0 A;  1AUT L;  3K9X A;  3IAX A;  5GX4 A;  1APO A;  1KLO A;  2IAX A;  1EMO A;  1O5D L;  3LTG D;  4GN7 A;  6COX A;  3NJP C;  1WHE A;  5F1A A;  1K37 A;  4LOR A;  3A9H A;  2P93 L;  4X8S L;  5IKQ A;  1CX2 A;  2Y81 B;  1IQJ L;  5D9D A;  3FCS B;  5D9B A;  4RRY A;  3HPT A;  1I0U A;  4A0P A;  4CUE A;  4A7I A;  4COX A;  2IAU A;  3MQE A;  3V64 C;  1N7D A;  1PGE A;  3EGF A;  1HRF A;  1BF9 A;  1IQL L;  3S8Z A;  3Q6K A;  3TGF A;  1P0S L;  2RHP A;  3KQD L;  5KIR A;  1J9C L;  2WFX B;  4JZE L;  4RRZ A;  2VWL L;  3BT1 A;  1F0S B;  4HHQ A;  3S94 A;  1HCG B;  5JB8 E;  1IVO C;  1G1R A;  2NPR A;  1IQH L;  2XC5 L;  3CEN L;  4TGF A;  1IQF L;  1FSB A;  1G1T A;  5JW1 A;  2YGO A;  3S8V A;  4GNB A;  2WPI E;  3AMR A;  4CSY A;  1XKB A;  3ENS A;  2YGP A;  1ATE A;  2POO A;  3MDL A;  2XC4 L;  3BPS E;  2OYU P;  5F19 A;  3ZYG A;  4O1Z A;  4XBM A;  4DG6 A;  2J94 B;  1WU1 B;  1KLJ L;  1UZP A;  2JKH L;  4IMB A;  1LPG A;  5KN5 C;  2W2P E;  2J95 B;  2VWM K;  1QBI A;  1APQ A;  2CJI B;  4Y79 B;  2WPJ E;  2Y5F L;  3GIS X;  3OLT A;  2W26 B;  5CKM A;  2VWN L;  3M36 L;  3N8Z A;  1CVW L;  1JBU L;  3FVZ A;  2FZZ L;  1HT8 A;  4BDX A;  1CQE A;  1HJ7 A;  3QH0 A;  5FWW A;  2XBY L;  3O4P A;  1HX2 A;  5GTQ A;  4ISI L;  2TGF A;  3LIW B;  5IKR A;  3HS7 A;  4RRX A;  2K2S B;  1CCF A;  2GVX A;  1NFY B;  2P3T A;  2BQ7 A;  1HAF A;  2W3K B;  1C5K A;  1NFW B;  2P95 L;  2Y7Z B;  3Q6T A;  2F9B L;  5IKV A;  1LPK A;  3ELA L;  1CQ1 A;  2BOX A;  4ZAE B;  1QLG A;  4HHO A;  3R05 A;  1ATB A;  2W2M E;  1TLE A;  3E5Z A;  1EZQ B;  4IYG A;  1G1Q A;  4XLW A;  3ASI A;  3NTB A;  1U67 A;  5FDQ A;  4X8T L;  4FM5 A;  1EPJ A;  4X8U L;  3V65 B;  3C9A C;  3U0S A;  2WG3 C;  1MOX C;  2IAP A;  3M37 L;  2Y5G L;  3IIT B;  5K0H B;  1RFN B;  1NFX B;  4BXS A;  2BOK L;  1DQB A;  1IQI L;  3IJE B;  4RUT A;  1KLI L;  2P94 L;  2EI6 B;  4XL1 A;  4Z0K B;  4Q1U A;  4OTY A;  1TOZ A;  2WPM E;  1M1X B;  2BQW A;  1HRE A;  1U8C B;  2MHP A;  1Q4G A;  2P28 B;  2XBX L;  4D0E A;  1NT0 A;  2WYJ B;  3HRP A;  2XBW L;  4Y76 B;  5I46 L;  4BDW A;  1IJQ A;  4ZXY L;  2EI8 B;  5IKT A;  3KRK A;  1LQD A;  1XFE A;  2XC0 L;  3P5B L;  2J4I B;  4JYV L;  1EPH A;  3DR2 A;  1MQ6 L;  3KCG L;  3AMS A;  3HLI A;  1UZQ A;  1IGX A;  1NQL B;  2W8B A;  1KIG L;  1IOX A;  4Y7B B;  2OYE P;  1COU A;  3KL6 B;  1E1A A;  1IQK L;  1FF7 A;  5JVZ A;  2VVU L;  3HS5 A;  2WPL E;  4PH9 A;  1V3X B;  2GHS A;  2Y38 A;  4GN9 A;  5JBA E;  1UZK A;  1KSN B;  1CRU A;  2M74 A;  3SRG A;  3S2K A;  1F7M A;  2MGR A;  4HW6 A;  3I1C A;  4NGA L;  5L2Z L;  2BOU A;  1ATD A;  5GX2 A;  5CIS A;  5E8D A;  3FFG L;  1LMJ A;  1L5G B;  2UWL B;  5CKN A;  1X7A L;  2G8S A;  1GK5 A;  2W2Q E;  3GCW E;  3U7U G;  3KQB L;  4GNA A;  4Z0L A;  2IAR A;  2W8B B;  3NT1 A;  1CVM A;  1L3Y A;  3BT2 A;  1DDX A;  3TH3 L;  3Q6P A;  1W8B L;  2BMG A;  3KQE L;  4BXW A;  5L30 L;  2VH6 B;  2W3I B;  2VH0 B;  2VJ3 A;  3WW9 A;  3SW2 A;  3KQC L;  2GVV A;  1NZI A;  1F0R B;  2AYL A;  3N8X A;  3HS6 A;  1N1I A;  2UWO B;  3POY A;  3CA7 A;  4M10 A;  4PWZ A;  1XDT R;  2GVW A;  2I9B A;  2RA0 L;  4LMF A;  4JZF L;  2K2T A;  1F7E A;  4Y7A B;  1NPE A;  3LAQ A;  2FP8 A;  5JB9 E;  2VVV L;  2I9A A;  5GX3 A;  4E1G A;  2GD4 A;  1YUG A;  3KGG A;  3KYA A;  2P3U A;  2P16 L;  5JVY A;  2J34 B;  5JBC E;  1NFU B;  2V91 A;  2UWP B;  2MGP A;  1IOE L;  2IAV A;  3HLH A;  3LC5 B;  1URK A;  3F1S B;  2P4O A;  2FLG A;  2BOH A;  2Y80 B;  3Q3K B;  1IQE L;  1DIY A;  1PFX L;  2FLB L;  2W2N E;  4MMY B;  4ISH L;  1EQG A;  3LTF B;  2DSO A;  1IQG L;  4O02 B;  4YT7 L;  1FE2 A;  1DX5 I;  1PTH A;  3WWA A;  1NPE B;  2BZ6 L;  3DEM A;  5GX1 A;  2PUQ L;  1Z6C A;  4D90 A;  5COX A;  1PJX A;  1G2L B;  1CEJ A;  2EI7 B;  4AQT A;  5CKQ A;  1EMN A;  2BO2 A;  1EPI A;  3FW0 A;  4CUF A;  3N8W A;  1EGF A;  1K36 A;  4YZU B;  2Y7X B;  3LC3 B;  1YUK B;  4BTU A;  3V1S A;  2Y82 B;  1FJS L;  1HZ8 A;  2ISM A;  5JBB E;  2H9E L;  1OB1 C;  2QE8 A;  2IAQ A;  2KB9 A;  3OLU A;  3DAS A;  4NA9 L;  2ADX A;  2FLR L;  4BTI A;  3F6U L;  3TC9 A;  3SOV A;  1POO A;  3QMO A;  1HT5 A;  4RS0 A;  4NG9 L;  1ATA A;  2WYG B;  2IAO A;  4O5T A;  3HO5 A;  4GN8 A;  4G1M B;  2GVU A;  1TPG A;  3KK6 A;  1EBV A;  4C16 A;  1EPG A;  1XKA L;  2B7D L;  3CFW A;  2IAS A;  2DDU A;  2Q1J B;  3LI3 A;  2FPC A;  5L2Y L; 
#chains in the Genus database with same CATH topology
 3LI5 A;  3N8W B;  2IVZ A;  4M4V A;  4MMZ B;  1C5M F;  2H9E C;  1JL9 A;  2HQS A;  2X9M A;  2YA4 A;  3BYC A;  1YUF A;  1NMC A;  2HT8 A;  3OPZ A;  2Y5H L;  2VAQ A;  1P9J A;  3G4E A;  4Y71 B;  2BAT A;  4MMX B;  2FPB A;  3SOQ A;  4ZHA B;  3TBD A;  3B7E A;  4O5S A;  5FNR A;  1DIM A;  5EO8 A;  4CPN A;  1Q7F A;  4CUD A;  1WCQ A;  4XIK A;  2Z32 A;  1MQ5 L;  1FAK L;  4FPF A;  2WPH E;  3TI3 A;  4QN6 A;  2J2U B;  1ADX A;  2VW2 A;  3GVL A;  2DG0 A;  2QWD A;  3G4H A;  1EUS A;  1V0E A;  4XJZ A;  4B7Q A;  4B7M A;  4CPZ A;  3N8Y A;  5F9T A;  4JYU L;  1H6L A;  4FPO B;  1INY A;  3LI4 A;  1NSD A;  2W86 A;  1N1V A;  2RNL A;  1V3E A;  2QWA A;  4M11 A;  1G1S A;  4WA3 A;  1MS8 A;  4FOW A;  2XBV L;  4ZH8 B;  4YZ1 A;  2IAW A;  3CS7 L;  5D9C A;  4XMB A;  1FFM A;  1C9U A;  5GX5 A;  2P3F L;  3GCX E;  4JML A;  4K1H A;  3PGH A;  1ZGK A;  4K1I A;  1JV2 B;  1MS9 A;  4D0F A;  2RKC A;  3PJQ A;  4FOV A;  4GU4 A;  1IQN L;  2VK6 A;  1MS5 A;  2BQ6 A;  2D1J B;  3LN1 A;  2H2N A;  4I00 A;  1Z4X A;  2FP9 A;  5EGM B;  2IAT A;  2SLI A;  1LPZ A;  3Q7D A;  2W2O E;  1CCV A;  1V04 A;  2QWF A;  2P3F N;  3QCW A;  4GDI A;  4MWY A;  4YT6 L;  1QIU A;  1SZB A;  3TK5 B;  4Z6A L;  2OJH A;  2BER A;  5B2D A;  4AGI A;  4OTJ A;  2DYH A;  1RWI A;  2DG1 A;  4IQK A;  3RR3 A;  3GVJ A;  1NNC A;  3L6V A;  1PRH A;  4XJQ A;  4GNC A;  2VWO L;  1USR A;  4Y6D B;  4FVK A;  3SRE A;  4RRW A;  1EQH A;  2VK5 A;  2P26 A;  3N8V A;  1HAE A;  3N8Y B;  1B9W A;  4AH4 A;  2VVC K;  4MJU A;  1IGZ A;  1RWL A;  3ZYJ B;  4MWV A;  1X2J A;  1FAX L;  1Z4W A;  1WHF A;  1Z6E L;  3A9G A;  1A3P A;  1W21 A;  5FZN A;  1SO7 A;  3U73 A;  4R40 A;  4ZLR A;  4X8V L;  4CSD A;  2PHB B;  3FBY A;  1IVC A;  3GVK A;  3HO4 A;  3ADE A;  4CPY A;  1IQM L;  2WFT A;  4HZY A;  2KV4 A;  4JZD L;  2VSM A;  4FPL A;  1PXX A;  4YZ3 A;  4D52 B;  3H5C B;  1W7X L;  1CVU A;  2F28 A;  3CL0 A;  4Q6K A;  4ZXX L;  4BTT A;  2WG4 B;  3TK6 B;  1UZJ A;  1YGC L;  2KL7 A;  2VSK A;  1E8U A;  1MS3 A;  1S18 A;  2HU4 A;  1L7H A;  2WZP P;  1G2M B;  1ZAQ A;  1CRZ A;  1X2R A;  1DVA L;  3ZGD A;  2G00 L;  4IN4 A;  7NN9 A;  2ZB5 A;  1N6E A;  1EAI C;  1F8C A;  2WPK E;  3HO3 A;  3ALW A;  5EX7 A;  1QFK L;  2PR3 B;  3LN0 A;  3ZYI B;  3SOB B;  4QN5 A;  4CPO A;  2J38 B;  1YO8 A;  1INH A;  3NTG A;  3TI8 A;  1MZ6 A;  3TZI A;  2FD6 A;  2QWG A;  1IP0 A;  3TIB A;  1AUT L;  3K9X A;  4HZV A;  2XCY A;  3VNG A;  2HT5 A;  4WA5 A;  2KNI A;  3IAX A;  2AEQ A;  5HUM A;  1A4G A;  3UC1 A;  5GX4 A;  1APO A;  1KLO A;  2IAX A;  2F27 A;  1EMO A;  4KS1 A;  4XHB A;  1O5D L;  3LTG D;  4GN7 A;  4L7B A;  6COX A;  4UF7 A;  4J9T A;  3BEQ A;  3NJP C;  3O9K A;  1WHE A;  2AEP A;  5F1A A;  1K37 A;  4GDJ A;  4LOR A;  3A9H A;  2P93 L;  4X8S L;  5IKQ A;  4B7R A;  4XJ8 A;  1CX2 A;  4MWQ A;  2BT8 A;  2Y81 B;  1IQJ L;  1V1H A;  4HZX A;  4NC5 A;  5D9D A;  4GZO A;  3FCS B;  5D9B A;  4RRY A;  4YW4 A;  3HPT A;  1I0U A;  4A0P A;  4CUE A;  4A7I A;  4COX A;  2IAU A;  3MQE A;  3V64 C;  1N7D A;  1PGE A;  3EGF A;  6NN9 A;  1HRF A;  1BF9 A;  1IQL L;  2QWE A;  2VWD A;  3Q6K A;  3S8Z A;  1W8O A;  5FNU A;  3TGF A;  1P0S L;  2RHP A;  3KQD L;  4CH9 A;  5CGJ A;  5KIR A;  1J9C L;  2WFX B;  4JZE L;  1NMB N;  4RRZ A;  2XZI A;  2VWL L;  3BT1 A;  1F0S B;  5HUG A;  3INB A;  2F26 A;  4HHQ A;  3S94 A;  3H73 A;  5HX0 A;  1HCG B;  5JB8 E;  1A4Q A;  5JYY A;  1IVO C;  1G1R A;  1IVF A;  2NPR A;  1IQH L;  2XC5 L;  4XJA A;  3CEN L;  4QNP A;  4CHB A;  4TGF A;  1IQF L;  1FSB A;  1G1T A;  4YW1 A;  2B8H A;  5JW1 A;  4NCS A;  4WA4 A;  2VW0 A;  2YGO A;  3JU4 A;  3S8V A;  4GNB A;  3H72 A;  3II7 A;  2WPI E;  3SIL A;  1IVD A;  3AMR A;  2HTQ A;  2QWH A;  4CSY A;  1XKB A;  3ENS A;  4GZW A;  2YGP A;  1ATE A;  1V0F A;  3MDL A;  2POO A;  2XC4 L;  3BPS E;  3A71 A;  2F29 A;  2OYU P;  5F19 A;  3ZYG A;  4O1Z A;  4XBM A;  1B9S A;  2J94 B;  1N6D A;  3NN9 A;  4DG6 A;  2HTR A;  1W0O A;  3TIA A;  1WU1 B;  3ALX A;  4A94 C;  2BZD A;  1SUU A;  1KLJ L;  1UZP A;  2JKH L;  1W1X A;  4IMB A;  1V3C A;  1LPG A;  5KN5 C;  2W2P E;  2J95 B;  2VWM K;  4MZA A;  1QBI A;  2C4L A;  1APQ A;  2CJI B;  4X4A A;  2H2U A;  4Y79 B;  2WPJ E;  2Y5F L;  1V0Z A;  3GIS X;  1NNA A;  2YDP A;  3OLT A;  4FOQ A;  2W26 B;  5CKM A;  1MS1 A;  3SAL A;  4MWU A;  2VWN L;  1B9V A;  1E8V A;  2C4A A;  3M36 L;  3N8Z A;  1F8D A;  5NN9 A;  1CVW L;  1ZI0 A;  4MX0 A;  4GJT A;  4FPJ A;  1JBU L;  4FJ6 A;  1IVE A;  4GB1 A;  1WP5 A;  4MZE A;  1MZ5 A;  4AHA A;  4FP3 A;  3FVZ A;  3W09 A;  2FZZ L;  1HT8 A;  4ZY3 A;  3K3A A;  4KS2 A;  4BDX A;  4GEZ A;  1CQE A;  2W5N A;  1HJ7 A;  4H53 A;  3QH0 A;  5FWW A;  1S0I A;  3K39 A;  3H6J A;  2XBY L;  2VRS A;  3O4P A;  1W0P A;  1HX2 A;  5GTQ A;  4ISI L;  2TGF A;  1V3D A;  3LIW B;  1F8B A;  1NMA N;  5IKR A;  3HS7 A;  4RRX A;  2A75 A;  1MR5 A;  2K2S B;  1CCF A;  2W5O A;  4CPL A;  2GVX A;  1NFY B;  1N6F A;  2QWJ A;  2P3T A;  4YZ2 A;  2BQ7 A;  1HAF A;  4GZQ A;  2W3K B;  1C5K A;  2YDT A;  1NFW B;  4YW3 A;  2P95 L;  2Y7Z B;  3H71 A;  3Q6T A;  2AH2 A;  2F9B L;  5IKV A;  1LPK A;  1MS4 A;  3ELA L;  1CQ1 A;  2BOX A;  4ZAE B;  1QLG A;  1W8N A;  2HT7 A;  3R05 A;  3A72 A;  4HHO A;  1ATB A;  4IFL X;  2W2M E;  4XMA A;  4YW5 A;  2CML A;  1TLE A;  3E5Z A;  1EZQ B;  4MWW A;  4IYG A;  4ZGC A;  2HTW A;  4GZP A;  1G1Q A;  1W20 A;  4XLW A;  3D12 A;  1NCA N;  3ASI A;  3NTB A;  1U67 A;  5FDQ A;  4X8T L;  4FM5 A;  1EPJ A;  2QWC A;  4X8U L;  3V65 B;  3C9A C;  2HTU A;  3ZGC A;  4M4N A;  4UOU A;  3U0S A;  2WG3 C;  1MOX C;  5M1Z A;  2IAP A;  4HZZ A;  3M37 L;  1B9T A;  2Y5G L;  3IIT B;  1NCB N;  3CKZ A;  5K0H B;  1RFN B;  1USX A;  1NFX B;  4BXS A;  4G3N A;  3SAN A;  2BOK L;  1DQB A;  1IQI L;  1WCS A;  4XE9 A;  3IJE B;  4RUT A;  4X6K A;  2BSF A;  1KLI L;  1OFZ A;  2P94 L;  2EI6 B;  4XL1 A;  4Z0K B;  4Q1U A;  4OTY A;  2QWK A;  1TOZ A;  2WPM E;  1M1X B;  1E8T A;  2BQW A;  4MWX A;  1HRE A;  4AGT A;  4KS5 A;  1U8C B;  4XJ9 A;  2MHP A;  2QWI A;  2WOZ A;  1Q4G A;  2P28 B;  2XBX L;  4D0E A;  4XHX A;  2HU0 A;  1NT0 A;  2WYJ B;  1L7G A;  3D11 A;  2HOR A;  3HRP A;  2XBW L;  4Y76 B;  5I46 L;  4BDW A;  1IJQ A;  4ZXY L;  2EI8 B;  2JJL A;  3TI6 A;  5IKT A;  3KRK A;  1LQD A;  1XFE A;  2XC0 L;  4B7J A;  3P5B L;  2J4I B;  4JYV L;  1EPH A;  3DR2 A;  1KKE A;  1MQ6 L;  4KS4 A;  3KCG L;  3AMS A;  4XMI A;  1INV A;  3HLI A;  1UZQ A;  1N1Y A;  5FNT A;  1IGX A;  1NQL B;  4K3Y A;  4L7C A;  1LMM A;  3CL2 A;  2W8B A;  1KIG L;  2HTY A;  1IOX A;  4Y7B B;  2OYE P;  1COU A;  3KL6 B;  1E1A A;  4YW2 A;  5HUN A;  1IQK L;  1FF7 A;  5JVZ A;  2VVU L;  3HS5 A;  2VVZ A;  2WPL E;  4ASC A;  4PH9 A;  1V3X B;  2GHS A;  2Y38 A;  2FLU X;  4GN9 A;  5JBA E;  4QN4 A;  1UZK A;  1KSN B;  1CRU A;  1EUT A;  2JKB A;  2M74 A;  2ZWA A;  4JF7 A;  4FPG A;  3SRG A;  3B69 A;  5HUK A;  3S2K A;  1F7M A;  2MGR A;  4HW6 A;  3I1C A;  1MS0 A;  4NGA L;  4MWR A;  5H47 A;  4YZ5 A;  4XJR A;  5L2Z L;  1NN2 A;  2BOU A;  1ATD A;  3NO0 A;  5GX2 A;  5CIS A;  5E8D A;  3FFG L;  2F25 A;  1INW A;  3CYE A;  1LMJ A;  1L5G B;  2UWL B;  4QN3 A;  5CKN A;  4NN9 A;  1SNT A;  1INF A;  5F72 C;  3K38 A;  1X7A L;  1MWE A;  2G8S A;  4MWJ A;  1GK5 A;  4HIZ A;  1BJI A;  1XOE A;  2W2Q E;  3GCW E;  3U7U G;  3KQB L;  4GNA A;  3TI5 A;  4Z0L A;  2IAR A;  2W8B B;  3NT1 A;  1CVM A;  1L3Y A;  2VW1 A;  3BT2 A;  1SLL A;  4FOY A;  2ZB6 A;  1DDX A;  4K1K A;  3TH3 L;  4GZS A;  3Q6P A;  1W8B L;  2BMG A;  4BBW A;  3KQE L;  4BXW A;  4XYX A;  4SLI A;  5L30 L;  4GU3 A;  2VH6 B;  2W3I B;  2VH0 B;  1V3B A;  2BF6 A;  4KS3 A;  3S6X A;  1INX A;  2VJ3 A;  4D4U A;  4FPH A;  1S0J A;  3WW9 A;  1V2I A;  3SW2 A;  4FP2 A;  4D52 A;  3KQC L;  2GVV A;  1NZI A;  1KIT A;  1F0R B;  2AYL A;  2HOX A;  3O9J A;  3N8X A;  4YY8 A;  3HS6 A;  4MC7 A;  4N1B A;  1N1I A;  2UWO B;  3POY A;  3CA7 A;  4WEG A;  4M10 A;  2YA5 A;  4PWZ A;  1XDT R;  1N1S A;  2VK7 A;  4H52 A;  1VCJ A;  2GVW A;  2I9B A;  2RA0 L;  1L7F A;  4FPC A;  4LMF A;  4JZF L;  1Z4Y A;  2K2T A;  1F7E A;  4Y7A B;  1N1T A;  2SIM A;  1NPE A;  1IVB A;  3LAQ A;  4XOG A;  1K32 A;  1IUB A;  2YA8 A;  4YZ4 A;  4FQ4 A;  1Z4V A;  2FP8 A;  1S1D A;  1A14 N;  5JB9 E;  2VVV L;  2I9A A;  5GX3 A;  4E1G A;  5FZJ A;  3TIC A;  2GD4 A;  1YUG A;  3KGG A;  1ING A;  4CPM A;  3KYA A;  2P3U A;  4XIL A;  4DGR A;  2P16 L;  5JVY A;  1NSB A;  2J34 B;  5JBC E;  1NFU B;  2V91 A;  2UWP B;  2MGP A;  1IUC A;  1IOE L;  2F0Z A;  2IAV A;  3HLH A;  3LC5 B;  1URK A;  1Z50 A;  2F10 A;  4GZT A;  4MJV A;  2XZJ A;  3F1S B;  2P4O A;  3K36 A;  2FLG A;  2BOH A;  1VCU A;  2Y80 B;  3Q3K B;  4FPY A;  4C1Y A;  1IQE L;  1DIY A;  1PFX L;  2FLB L;  2W2N E;  4MMY B;  1SLI A;  5FNS A;  2BT7 A;  4ISH L;  1EQG A;  5EO7 A;  3LTF B;  2DSO A;  4D52 C;  1NSC A;  3NSS A;  4XJW A;  1IQG L;  4O02 B;  4X49 A;  1NCD N;  2F11 A;  1IVG A;  2XZK A;  4YT7 L;  1FE2 A;  2VPJ A;  1DX5 I;  1PTH A;  3WWA A;  1NPE B;  2BZ6 L;  3DEM A;  2YGQ A;  5GX1 A;  2PUQ L;  1Z6C A;  4D90 A;  5COX A;  1NCC N;  1EUR A;  2W20 A;  4XJU A;  3SLI A;  1PJX A;  1G2L B;  1DIL A;  4MWL A;  1V1I A;  1U6D X;  4GZX A;  1CEJ A;  2EI7 B;  4IFN X;  4AQT A;  4B7N A;  5CKQ A;  4IFJ A;  1EMN A;  2BO2 A;  1EPI A;  3FW0 A;  4CUF A;  3N8W A;  1EGF A;  2F24 A;  2F13 A;  1K36 A;  4YZU B;  4M4U A;  2Y7X B;  3LC3 B;  1YUK B;  4BTU A;  3V1S A;  2Y82 B;  1FJS L;  4C1Y B;  1HZ8 A;  2FHR A;  3WN7 A;  4FPE A;  2ISM A;  4HZW A;  5JBB E;  2H9E L;  1NNB A;  1OB1 C;  2QE8 A;  5FNQ A;  2IAQ A;  3TI4 A;  5B2C A;  4M3M A;  2KB9 A;  2F12 A;  3OLU A;  2ZZK A;  3DAS A;  4NA9 L;  2ADX A;  2FLR L;  4BTI A;  2AGS A;  3F6U L;  3TC9 A;  3SOV A;  1POO A;  3QMO A;  2XN4 A;  4XIO A;  1HT5 A;  4RS0 A;  2ZW9 A;  4NG9 L;  1LK9 A;  1ATA A;  4FZH A;  4K1J A;  2WYG B;  4QN7 A;  3WDZ A;  2YA6 A;  2IAO A;  4L7D A;  1F8E A;  4O5T A;  1XOG A;  3HO5 A;  4GN8 A;  4G1M B;  2GVU A;  4FPK A;  1TPG A;  3T1E A;  2HTV A;  3KK6 A;  4WEF A;  1EBV A;  4C16 A;  1Z4Z A;  4X47 A;  2W38 A;  1EPG A;  1XKA L;  2B7D L;  1EUU A;  2SIL A;  3CFW A;  2IAS A;  3VNH A;  2DDU A;  2YA7 A;  2Q1J B;  4D8S A;  3K37 A;  3LI3 A;  2FPC A;  2QWB A;  5L2Y L; 
#chains in the Genus database with same CATH homology
 3LI5 A;  3N8W B;  2IVZ A;  4MMZ B;  1C5M F;  2H9E C;  1JL9 A;  2HQS A;  3BYC A;  1YUF A;  2Y5H L;  2VAQ A;  1P9J A;  3G4E A;  4Y71 B;  4MMX B;  2FPB A;  3SOQ A;  4ZHA B;  3TBD A;  4O5S A;  1Q7F A;  4CUD A;  1MQ5 L;  1FAK L;  2WPH E;  2J2U B;  1ADX A;  2DG0 A;  3G4H A;  3N8Y A;  4JYU L;  1H6L A;  3LI4 A;  2W86 A;  2RNL A;  4M11 A;  1G1S A;  2XBV L;  4ZH8 B;  2IAW A;  3CS7 L;  5D9C A;  1FFM A;  1C9U A;  5GX5 A;  2P3F L;  3GCX E;  4JML A;  3PGH A;  1JV2 B;  4D0F A;  1IQN L;  2BQ6 A;  2D1J B;  3LN1 A;  2FP9 A;  5EGM B;  2IAT A;  1LPZ A;  3Q7D A;  2W2O E;  1CCV A;  1V04 A;  2P3F N;  3QCW A;  4YT6 L;  3TK5 B;  1SZB A;  4Z6A L;  2OJH A;  4OTJ A;  1RWI A;  2DG1 A;  3RR3 A;  1PRH A;  4GNC A;  2VWO L;  4Y6D B;  3SRE A;  4RRW A;  1EQH A;  2P26 A;  3N8V A;  1HAE A;  3N8Y B;  1B9W A;  2VVC K;  1IGZ A;  1RWL A;  3ZYJ B;  1FAX L;  1WHF A;  1Z6E L;  3A9G A;  1A3P A;  4ZLR A;  4R40 A;  3U73 A;  4X8V L;  2PHB B;  3FBY A;  3HO4 A;  1IQM L;  2WFT A;  2KV4 A;  4JZD L;  1PXX A;  3H5C B;  1W7X L;  1CVU A;  4ZXX L;  4BTT A;  2WG4 B;  3TK6 B;  1UZJ A;  1YGC L;  2KL7 A;  2WZP P;  1G2M B;  1ZAQ A;  1CRZ A;  1DVA L;  2G00 L;  1EAI C;  2WPK E;  3HO3 A;  5EX7 A;  1QFK L;  2PR3 B;  3LN0 A;  3ZYI B;  3SOB B;  2J38 B;  1YO8 A;  3NTG A;  3TZI A;  2FD6 A;  1IP0 A;  1AUT L;  3K9X A;  2KNI A;  3IAX A;  5GX4 A;  1APO A;  1KLO A;  2IAX A;  1EMO A;  1O5D L;  3LTG D;  4GN7 A;  6COX A;  3NJP C;  1WHE A;  5F1A A;  1K37 A;  4LOR A;  3A9H A;  2P93 L;  4X8S L;  5IKQ A;  1CX2 A;  2Y81 B;  1IQJ L;  5D9D A;  3FCS B;  5D9B A;  4RRY A;  3HPT A;  1I0U A;  4A0P A;  4CUE A;  4A7I A;  4COX A;  2IAU A;  3MQE A;  3V64 C;  1N7D A;  1PGE A;  3EGF A;  1HRF A;  1BF9 A;  1IQL L;  3S8Z A;  3Q6K A;  3TGF A;  1P0S L;  2RHP A;  3KQD L;  5KIR A;  1J9C L;  2WFX B;  4JZE L;  4RRZ A;  2VWL L;  3BT1 A;  1F0S B;  4HHQ A;  3S94 A;  1HCG B;  5JB8 E;  1IVO C;  1G1R A;  2NPR A;  1IQH L;  2XC5 L;  3CEN L;  4TGF A;  1IQF L;  1FSB A;  1G1T A;  5JW1 A;  2YGO A;  3S8V A;  4GNB A;  2WPI E;  3AMR A;  4CSY A;  1XKB A;  3ENS A;  2YGP A;  1ATE A;  2POO A;  3MDL A;  2XC4 L;  3BPS E;  2OYU P;  5F19 A;  3ZYG A;  4O1Z A;  4XBM A;  4DG6 A;  2J94 B;  1WU1 B;  4A94 C;  1KLJ L;  1UZP A;  2JKH L;  4IMB A;  1LPG A;  5KN5 C;  2W2P E;  2J95 B;  2VWM K;  1QBI A;  1APQ A;  2CJI B;  4Y79 B;  2WPJ E;  2Y5F L;  3GIS X;  3OLT A;  2W26 B;  5CKM A;  2VWN L;  3M36 L;  3N8Z A;  1CVW L;  1JBU L;  3FVZ A;  2FZZ L;  1HT8 A;  4BDX A;  1CQE A;  1HJ7 A;  3QH0 A;  5FWW A;  2XBY L;  3O4P A;  1HX2 A;  5GTQ A;  4ISI L;  2TGF A;  3LIW B;  5IKR A;  3HS7 A;  4RRX A;  2K2S B;  1CCF A;  2GVX A;  1NFY B;  2P3T A;  2BQ7 A;  1HAF A;  2W3K B;  1C5K A;  1NFW B;  2P95 L;  2Y7Z B;  3Q6T A;  2F9B L;  5IKV A;  1LPK A;  3ELA L;  1CQ1 A;  2BOX A;  4ZAE B;  1QLG A;  4HHO A;  3R05 A;  1ATB A;  2W2M E;  1TLE A;  3E5Z A;  1EZQ B;  4IYG A;  1G1Q A;  4XLW A;  3ASI A;  3NTB A;  1U67 A;  5FDQ A;  4X8T L;  4FM5 A;  1EPJ A;  4X8U L;  3V65 B;  3C9A C;  3U0S A;  2WG3 C;  1MOX C;  2IAP A;  3M37 L;  2Y5G L;  3IIT B;  5K0H B;  1RFN B;  1NFX B;  4BXS A;  2BOK L;  1DQB A;  1IQI L;  3IJE B;  4RUT A;  1KLI L;  2P94 L;  2EI6 B;  4XL1 A;  4Z0K B;  4Q1U A;  4OTY A;  1TOZ A;  2WPM E;  1M1X B;  2BQW A;  1HRE A;  1U8C B;  2MHP A;  1Q4G A;  2P28 B;  2XBX L;  4D0E A;  1NT0 A;  2WYJ B;  3HRP A;  2XBW L;  4Y76 B;  5I46 L;  4BDW A;  1IJQ A;  4ZXY L;  2EI8 B;  5IKT A;  3KRK A;  1LQD A;  1XFE A;  2XC0 L;  3P5B L;  2J4I B;  4JYV L;  1EPH A;  3DR2 A;  1MQ6 L;  3KCG L;  3AMS A;  3HLI A;  1UZQ A;  1IGX A;  1NQL B;  1LMM A;  2W8B A;  1KIG L;  1IOX A;  4Y7B B;  2OYE P;  1COU A;  3KL6 B;  1E1A A;  1IQK L;  1FF7 A;  5JVZ A;  2VVU L;  3HS5 A;  2WPL E;  4PH9 A;  1V3X B;  2GHS A;  2Y38 A;  4GN9 A;  5JBA E;  1UZK A;  1KSN B;  1CRU A;  2M74 A;  3SRG A;  3S2K A;  1F7M A;  2MGR A;  4HW6 A;  3I1C A;  4NGA L;  5L2Z L;  2BOU A;  1ATD A;  5GX2 A;  5CIS A;  5E8D A;  3FFG L;  1LMJ A;  1L5G B;  2UWL B;  5CKN A;  1X7A L;  2G8S A;  1GK5 A;  2W2Q E;  3GCW E;  3U7U G;  3KQB L;  4GNA A;  4Z0L A;  2IAR A;  2W8B B;  3NT1 A;  1CVM A;  1L3Y A;  3BT2 A;  1DDX A;  3TH3 L;  3Q6P A;  1W8B L;  2BMG A;  3KQE L;  4BXW A;  5L30 L;  2VH6 B;  2W3I B;  2VH0 B;  3S6X A;  2VJ3 A;  3WW9 A;  3SW2 A;  3KQC L;  2GVV A;  1NZI A;  1F0R B;  2AYL A;  3N8X A;  3HS6 A;  1N1I A;  2UWO B;  3POY A;  3CA7 A;  4M10 A;  4PWZ A;  1XDT R;  2GVW A;  2I9B A;  2RA0 L;  4LMF A;  4JZF L;  2K2T A;  1F7E A;  4Y7A B;  1NPE A;  3LAQ A;  2FP8 A;  5JB9 E;  2VVV L;  2I9A A;  5GX3 A;  4E1G A;  2GD4 A;  1YUG A;  3KGG A;  3KYA A;  2P3U A;  2P16 L;  5JVY A;  2J34 B;  5JBC E;  1NFU B;  2V91 A;  2UWP B;  2MGP A;  1IOE L;  2IAV A;  3HLH A;  3LC5 B;  1URK A;  3F1S B;  2P4O A;  2FLG A;  2BOH A;  2Y80 B;  3Q3K B;  1IQE L;  1DIY A;  1PFX L;  2FLB L;  2W2N E;  4MMY B;  4ISH L;  1EQG A;  3LTF B;  2DSO A;  1IQG L;  4O02 B;  4YT7 L;  1FE2 A;  1DX5 I;  1PTH A;  3WWA A;  1NPE B;  2BZ6 L;  3DEM A;  2YGQ A;  5GX1 A;  2PUQ L;  1Z6C A;  4D90 A;  5COX A;  1PJX A;  1G2L B;  1CEJ A;  2EI7 B;  4AQT A;  5CKQ A;  1EMN A;  2BO2 A;  1EPI A;  3FW0 A;  4CUF A;  3N8W A;  1EGF A;  1K36 A;  4YZU B;  2Y7X B;  3LC3 B;  1YUK B;  4BTU A;  3V1S A;  2Y82 B;  1FJS L;  1HZ8 A;  2ISM A;  5JBB E;  2H9E L;  1OB1 C;  2QE8 A;  2IAQ A;  2KB9 A;  3OLU A;  3DAS A;  4NA9 L;  2ADX A;  2FLR L;  4BTI A;  3F6U L;  3TC9 A;  3SOV A;  1POO A;  3QMO A;  1HT5 A;  4RS0 A;  4NG9 L;  1ATA A;  2WYG B;  2IAO A;  4O5T A;  3HO5 A;  4GN8 A;  4G1M B;  2GVU A;  1TPG A;  3KK6 A;  1EBV A;  4C16 A;  1EPG A;  1XKA L;  2B7D L;  3CFW A;  2IAS A;  2DDU A;  2Q1J B;  3LI3 A;  2FPC A;  5L2Y L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...