3V65B

Crystal structure of agrin and lrp4 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
335
structure length
330
Chain Sequence
YCSQGCTFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Agrin
publication title Structural basis of agrin-LRP4-MuSK signaling.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 71
structure length 330
sequence length 335
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
B PF12662 cEGF Complement Clr-like EGF-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3v65B01
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3v65B02
1TPGA 1UZQA 3SREA 3A9HA 4Q1UA 3GISX 3GCWE 1U8CB 2YGOA 1NFXB 4D0EA 1EAIC 3SOBB 3PGHA 4M11A 2BOHA 5KIRA 1QLGA 5GX3A 3FFGL 2Y80B 3ZYJB 1ATDA 4D0FA 1K36A 1WU1B 1XKBA 4Y71B 5JBCE 1O5DL 3BYCA 1C5MF 2RA0L 1JV2B 2WYGB 4Z6AL 3M37L 1APQA 1HAFA 1LQDA 3N8YA 2BO2A 1LPGA 2OYUP 4O5SA 3H5CB 3HO4A 2P4OA 1CRZA 3K9XA 2DG1A 3CFWA 4JZEL 3ZYGA 5CISA 1URKA 2EI7B 3HO5A 4NGAL 3TH3L 1CEJA 4HHOA 1KSNB 2W26B 1SZBA 1EPHA 3LC5B 1CVUA 2B7DL 1F0SB 3M36L 1IVOC 6COXA 1NFUB 3KL6B 3SOQA 2W2PE 3BT1A 4FM5A 1APOA 4ISIL 3HS6A 4YZUB 3N8YB 5JBBE 2W2QE 2WFXB 3FVZA 3Q6PA 3MDLA 2D1JB 1EPJA 2WPKE 3OLUA 1UZKA 5KN5C 3P5BL 4RRZA 1YGCL 1PTHA 4O1ZA 2FPCA 1IJQA 1EZQB 2WPIE 5JB9E 2W2OE 2Q1JB 2BQWA 2XBXL 4Y76B 1IQML 2Y5FL 5CKQA 3MQEA 1RWIA 1NPEA 2GVUA 1IQGL 2KB9A 1EGFA 2W3IB 1LPKA 3ZYIB 3F1SB 1G1QA 1NT0A 3LAQA 3TK6B 4ZAEB 3ENSA 4XLWA 2VWNL 1K37A 2UWLB 1XKAL 2XC0L 4BTUA 4Y6DB 4CUFA 2VH6B 1L3YA 3A9GA 2IAXA 2P95L 5K0HB 2GD4A 1EQGA 4O02B 2J38B 3OLTA 3U0SA 5GX5A 5GX4A 4ZH8B 5L2YL 3AMSA 1WHFA 1L5GB 1CVWL 1NPEB 4Z0LA 1P9JA 2K2SB 3LI5A 1CCVA 2P3FL 1GK5A 3FCSB 1ATEA 3LIWB 4PWZA 3SOVA 2XC5L 2IASA 1EPIA 1AUTL 3HS7A 1Z6CA 1LMJA 3KGGA 4XL1A 2F9BL 4OTJA 2DDUA 3LI4A 4YT6L 4ZLRA 2JKHL 2WPJE 1F7EA 1G1SA 4HW6A 2WPME 2PR3B 3NTBA 1IOEL 3V64C 2P94L 1PXXA 3V1SA 2J4IB 3NJPC 2ADXA 4Y79B 1EBVA 4Z0KB 3Q7DA 2FLRL 4RRYA 5F1AA 1LPZA 2BZ6L 2IAVA 1COUA 5E8DA 2FPBA 2GVXA 3KK6A 3WW9A 2Y5GL 1YUGA 3TK5B 2MGPA 3QCWA 4CUEA 3TC9A 2DG0A 4RRXA 1IP0A 1IQLL 3LI3A 1NQLB 5JW1A 1HAEA 5JVYA 1CX2A 1U67A 4JMLA 2MGRA 1KLIL 1ATAA 1EMNA 1XFEA 3C9AC 1HT5A 1UZJA 3NT1A 2CJIB 2KL7A 1JBUL 2WG3C 3N8XA 3IJEB 3I1CA 4JZDL 2P28B 1IQJL 3CS7L 2Y38A 4MMZB 1FE2A 3FW0A 2PHBB 1EMOA 2BMGA 2P26A 4PH9A 4X8VL 1A3PA 3HLIA 2I9BA 4M10A 3NTGA 4BDWA 4MMYB 4CUDA 1CVMA 2QE8A 4BDXA 1QBIA 2UWOB 1B9WA 2W2ME 2TGFA 3CENL 1P0SL 3R05A 3EGFA 3HLHA 5IKQA 5JBAE 1NZIA 1IQNL 2OJHA 2VVVL 1M1XB 1FJSL 3TZIA 1HCGB 4GNCA 3DEMA 1MQ6L 2GVVA 2H9EL 1F0RB 1JL9A 2UWPB 2IAQA 2Y81B 1IGXA 2HQSA 3N8ZA 2BOXA 3E5ZA 3S8ZA 2VH0B 1OB1C 2IAUA 1Z6EL 2IVZA 3LN1A 4JYUL 3U73A 3HPTA 3Q6KA 3DASA 4RS0A 2FD6A 2XBWL 2WG4B 4DG6A 4ISHL 2XC4L 5FWWA 1YUKB 1DDXA 2FP8A 3Q6TA 1FAXL 3IITB 2V91A 2VVUL 1MQ5L 1RWLA 3LC3B 1HREA 2W3KB 2WPLE 3S8VA 2J2UB 4Y7AB 2GHSA 5CKNA 3HO3A 1DX5I 4IYGA 2VJ3A 5I46L 1IQHL 2DSOA 1KLOA 1IOXA 2Y82B 1EPGA 5L2ZL 3S94A 4GN9A 2WFTA 1Q7FA 2P16L 3IAXA 4O5TA 1BF9A 2XBYL 3TGFA 1IQFL 5IKVA 2IAWA 1PJXA 2RHPA 3ASIA 1N7DA 4Y7BB 4R40A 4A7IA 1DVAL 1CQ1A 1I0UA 2J94B 1HT8A 4X8SL 3LTGD 2G00L 4D90A 4IMBA 2IAPA 4OTYA 2P3UA 1G2LB 3S2KA 2P3FN 1N1IA 1XDTR 1FSBA 3N8WA 4GNBA 3KQEL 1HZ8A 1NFWB 4ZXXL 2VWOL 1TLEA 4JZFL 1IQEL 2MHPA 2IAOA 4HHQA 4X8UL 4AQTA 4ZXYL 4YT7L 2WYJB 4CSYA 2I9AA 2ISMA 5FDQA 5EGMB 4GN8A 5L30L 3KQBL 3KQCL 1IGZA 1G2MB 1IQIL 2M74A 1V04A 3KCGL 2VVCK 1X7AL 3CA7A 3FBYA 1Q4GA 3DR2A 5GTQA 1PRHA 2W2NE 2P93L 3U7UG 5D9BA 1YUFA 2Y7XB 3N8WB 1C9UA 2W8BA 2NPRA 3ELAL 2EI8B 4COXA 3QH0A 1ATBA 2IATA 5IKRA 1FFMA 4G1MB 4ZHAB 3O4PA 3TBDA 1C5KA 2BOUA 1ZAQA 3BPSE 1CQEA 4BTTA 4X8TL 3G4HA 1PFXL 1W7XL 2VAQA 3KRKA 4RUTA 5IKTA 1PGEA 5F19A 5D9CA 4GN7A 2BQ6A 5JVZA 2W8BB 3LN0A 2Y5HL 1G1TA 1V3XB 4RRWA 3V65B 1FF7A 4A0PA 1RFNB 2AYLA 2J95B 2FLBL 4BXWA 2PUQL 1TOZA 1UZPA 3Q3KB 3KYAA 2FP9A 4E1GA 4GNAA 4XBMA 4JYVL 4NG9L 2YGPA 2FLGA 3SRGA 2K2TA 5COXA 3POYA 2Y7ZB 1QFKL 5JB8E 4NA9L 5GX1A 1ADXA 1WHEA 1KIGL 1DQBA 1CCFA 3F6UL 3LTFB 1KLJL 1J9CL 2XBVL 5GX2A 2RNLA 4LORA 5CKMA 2BOKL 1G1RA 2GVWA 3N8VA 2OYEP 3SW2A 3HRPA 5D9DA 3AMRA 4BTIA 4C16A 1NFYB 3HS5A 4LMFA 2P3TA 3G4EA 2EI6B 4MMXB 1EQHA 1H6LA 1HJ7A 5EX7A 1IQKL 3QMOA 1E1AA 1YO8A 2W86A 1F7MA 3GCXE 2J34B 3KQDL 1FAKL 1DIYA 2KV4A 4TGFA 2G8SA 1HX2A 4BXSA 3RR3A 2VWLL 1CRUA 1W8BL 3WWAA 2WPHE 2POOA 3BT2A 2BQ7A 1POOA 1MOXC 1HRFA 2VWMK 2IARA 2FZZL
chains in the Genus database with same CATH superfamily
2VPJA 1TPGA 4FJ6A 1UZQA 5EO8A 3SREA 3A9HA 3TI5A 4Q1UA 3NN9A 3GISX 3GCWE 4CPOA 4K1JA 1V3DA 4M4NA 2VVZA 5FNTA 1U8CB 2BT7A 2YGOA 4FP3A 4ZY3A 3TI8A 1NFXB 4D0EA 1EAIC 3SOBB 3PGHA 4M11A 2BOHA 5KIRA 1S18A 1QLGA 5GX3A 4ZGCA 3FFGL 4FPGA 2Y80B 1NCAN 3ZYJB 5FNRA 4XOGA 5EO7A 5F9TA 1ATDA 4CPMA 4D0FA 1K36A 4B7MA 1WU1B 1XKBA 4Y71B 5JBCE 1O5DL 2SLIA 3BYCA 1C5MF 1IVGA 1L7HA 3D12A 3O9KA 4AH4A 2BSFA 2RA0L 1JV2B 2WYGB 2AEPA 2F25A 4K1HA 4Z6AL 4MWJA 3M37L 4XHXA 4XILA 1APQA 1HAFA 1LQDA 3N8YA 3PJQA 4GZQA 4WEGA 2B8HA 2BO2A 1LPGA 2OYUP 4O5SA 3H5CB 1NMAN 2YA5A 3HO4A 2P4OA 1CRZA 4CSDA 3K9XA 2DG1A 2W5OA 3CFWA 4X6KA 4JZEL 1QIUA 3ZYGA 5CISA 1URKA 2EI7B 3HO5A 4NGAL 3TH3L 4MJUA 1CEJA 1EUSA 4HHOA 2SIMA 3TICA 5EX7A 1B9TA 1KSNB 2W26B 2HU4A 3ALWA 4GZTA 3W09A 3NO0A 1SZBA 1EPHA 3LC5B 4MC7A 1CVUA 2B7DL 2F12A 4MX0A 1F0SB 1V1IA 3M36L 1IVOC 4B7NA 4NN9A 5FZJA 3L6VA 2HT7A 6COXA 1NFUB 4HIZA 3KL6B 3SOQA 4XJZA 2W2PE 3BT1A 4FM5A 4HZWA 1APOA 4ISIL 2C4AA 3HS6A 4YZUB 3N8YB 5JBBE 4MZAA 2W2QE 2WFXB 3FVZA 3Q6PA 1LMMA 3MDLA 4FP2A 2D1JB 1EPJA 2WPKE 3OLUA 1UZKA 5KN5C 5HUNA 3P5BL 4RRZA 1YGCL 1PTHA 4O1ZA 1NCCN 1IJQA 1EZQB 2WPIE 2FPCA 3GVJA 4FPYA 5JB9E 4IN4A 2W2OE 2F10A 1MR5A 2W5NA 5FNQA 4C1YA 2Q1JB 3UC1A 2BQWA 2XBXL 4Y76B 1IQML 2Y5FL 5CKQA 3MQEA 1IUBA 1NPEA 1RWIA 2GVUA 1IQGL 2HTUA 1Z50A 2KB9A 1EGFA 2W3IB 1LPKA 3D11A 3ZYIB 3F1SB 1G1QA 2QWCA 1NT0A 3LAQA 5H47A 3TK6B 4ZAEB 3ENSA 4YZ3A 4XLWA 3A71A 3VNHA 2VWNL 1N1TA 1K37A 2UWLB 1XKAL 2XC0L 4BTUA 4XHBA 4GJTA 4MWVA 4ASCA 1A4GA 4HZVA 2YA8A 4Y6DB 4CUFA 3K37A 4YZ1A 3SALA 4MWYA 1NSDA 4J9TA 2VH6B 1L3YA 4YW5A 3A9GA 2IAXA 2P95L 5K0HB 2GD4A 4FPCA 4N1BA 4D4UA 1EQGA 4O02B 2J38B 3OLTA 2JJLA 3U0SA 4C1YB 5GX5A 5GX4A 4ZH8B 5L2YL 4CPLA 3AMSA 2AGSA 4L7CA 1KKEA 1WHFA 1L5GB 1CVWL 1NPEB 4Z0LA 2JKBA 1P9JA 2K2SB 3LI5A 5M1ZA 1CCVA 1MS0A 2P3FL 1GK5A 3FCSB 3CL2A 4XIOA 1ATEA 4YW1A 4YW4A 4XJAA 4XIKA 3LIWB 5CGJA 2F24A 4MWXA 3SOVA 4PWZA 2XC5L 1N6EA 1L7FA 2IASA 2H9EC 1B9SA 1EPIA 1AUTL 3HS7A 1VCUA 1Z6CA 4CPYA 1LMJA 2KNIA 2QWFA 3KGGA 4CPNA 5FNUA 4XL1A 5FNSA 2F9BL 2QWGA 4OTJA 2DDUA 3LI4A 5HUGA 4KS3A 4YT6L 3O9JA 2JKHL 2WPJE 1F7EA 4ZLRA 4GDIA 1G1SA 4HW6A 2WPME 3B69A 2PR3B 1IVBA 4BBWA 3NTBA 4M3MA 2VRSA 1IOEL 3V64C 2P94L 3JU4A 3H71A 4XJRA 1PXXA 4XJUA 3V1SA 2XN4A 2J4IB 3NJPC 3SANA 2ADXA 4Y79B 1EBVA 1V1HA 2VW2A 4Z0KB 1EUUA 3Q7DA 1N6DA 2FLRL 4RRYA 5F1AA 3K36A 2Z32A 1INWA 1LPZA 2BZ6L 1XOGA 4QNPA 3ZGCA 2QWHA 2IAVA 1NNBA 1COUA 5E8DA 1Z4YA 2FPBA 2QWJA 2XCYA 1USRA 2GVXA 3KK6A 4K1KA 2Y5GL 4NC5A 1YUGA 3TK5B 2MGPA 3QCWA 4CUEA 3II7A 2DG0A 3TC9A 1MS4A 5JYYA 1EURA 1F8DA 4XJ9A 1V3CA 4RRXA 1IP0A 4D52A 1IQLL 3GVKA 3LI3A 1MZ5A 1NQLB 5JW1A 1HAEA 4MWWA 5JVYA 1INFA 1CX2A 4YZ5A 1U67A 4JMLA 2MGRA 1V0EA 1KLIL 1ATAA 1EMNA 1XFEA 3C9AC 1HT5A 1UZJA 3NT1A 2CJIB 3H72A 2ZB6A 2KL7A 1JBUL 2WG3C 3N8XA 1N1VA 2HTYA 4QN6A 7NN9A 4FPJA 3IJEB 3I1CA 4JZDL 1U6DX 2P28B 2VK5A 4M4VA 4XJQA 4D52C 4HZYA 2A75A 1IQJL 2H2UA 4MZEA 2W38A 2YA6A 3CS7L 4CPZA 4X49A 2Y38A 4MMZB 1FE2A 3FW0A 2PHBB 1EMOA 1X2RA 2BMGA 1NSCA 4FQ4A 2P26A 4PH9A 4X8VL 2VSKA 1SLIA 4KS1A 3ZGDA 1A3PA 3HLIA 4D52B 3BEQA 2QWAA 2I9BA 4M10A 3NTGA 4BDWA 4MMYB 4FZHA 3WDZA 4CUDA 1CVMA 1MS5A 3S6XA 2QE8A 4BDXA 2XZIA 3WW9A 1QBIA 4IQKA 2UWOB 3CL0A 4FOVA 4GDJA 4GEZA 1B9WA 2W2ME 2TGFA 3CENL 1P0SL 4GU3A 3R05A 3EGFA 1WP5A 1N6FA 2HTVA 3T1EA 3TI4A 3HLHA 4DGRA 5IKQA 5JBAE 3H6JA 1NNCA 1NZIA 1IQNL 1SNTA 1IUCA 2C4LA 4FPEA 2OJHA 2VVVL 1M1XB 3B7EA 1FJSL 3TZIA 1HCGB 3TIBA 2ZZKA 4GNCA 3DEMA 1MQ6L 2GVVA 2H9EL 4X47A 1F0RB 1JL9A 2UWPB 2IAQA 2Y81B 1DIMA 1IGXA 2HQSA 2VK6A 4CH9A 3N8ZA 1W20A 2BOXA 3E5ZA 5HUMA 3S8ZA 2VH0B 1OB1C 2IAUA 1Z6EL 1NCDN 2FHRA 2IVZA 3LN1A 4JYUL 3U73A 1S1DA 4HZZA 2VWDA 4MWRA 3HPTA 3Q6KA 5B2CA 2DYHA 4RS0A 3DASA 2FD6A 2XBWL 2WG4B 1E8TA 2F0ZA 1E8UA 4FOQA 4DG6A 4ISHL 2XC4L 5FWWA 2F29A 1YUKB 2VW0A 2W20A 3TI3A 4L7DA 1DDXA 4AGIA 1VCJA 2FP8A 3Q6TA 4WA3A 1FAXL 1NMCA 3IITB 2V91A 2VVUL 1KITA 1MQ5L 1RWLA 2BATA 3TIAA 1MWEA 4GU4A 3LC3B 1SLLA 1HREA 2W3KB 2WPLE 4IFLX 3S8VA 4B7QA 2J2UB 2VW1A 4Y7AB 1W8OA 2GHSA 4XJWA 2HTWA 1V2IA 2WOZA 5CKNA 1L7GA 2AEQA 2BF6A 2X9MA 1MS9A 3HO3A 1DX5I 4IYGA 2VJ3A 4A94C 5I46L 2RKCA 4WA4A 1IQHL 5F72C 2XZKA 1NCBN 2DSOA 1IVCA 4MJVA 1KLOA 3SILA 1IOXA 2Y82B 2QWBA 1EPGA 5L2ZL 3S94A 4GN9A 5HUKA 1IVFA 2QWIA 2WFTA 1Q7FA 4I00A 2P16L 3IAXA 4O5TA 1BF9A 2XBYL 1SO7A 4K1IA 3TGFA 1IQFL 1Z4VA 2HU0A 5IKVA 2IAWA 3TI6A 1PJXA 4FPFA 1A14N 1INXA 2BERA 4FOYA 2ZW9A 4K3YA 3H73A 2RHPA 3GVLA 4KS5A 3ASIA 1N7DA 4Y7BB 2F26A 4R40A 4QN4A 4A7IA 1DVAL 1CQ1A 1I0UA 2YA7A 2XZJA 2J94B 4XMAA 4CHBA 2H2NA 1HT8A 4GZSA 4YZ2A 4X8SL 6NN9A 1ZGKA 3LTGD 2WZPP 4D8SA 4XMIA 3ADEA 2G00L 4D90A 4IMBA 2IAPA 1MS8A 4OTYA 2P3UA 1G2LB 3S2KA 4WA5A 2P3FN 1N1IA 1XDTR 1FSBA 3N8WA 4GNBA 3KQEL 3CYEA 1V0ZA 4FVKA 1BJIA 1HZ8A 1NFWB 1Z4XA 4ZXXL 2VWOL 2YA4A 1TLEA 4JZFL 2CMLA 2YDPA 2BT8A 4H53A 1INVA 1IQEL 2MHPA 2QWKA 4JF7A 2IAOA 1USXA 4HHQA 4YW2A 4X8UL 4AQTA 4ZXYL 4FPHA 4FPKA 2F27A 4YT7L 1B9VA 4QN7A 2WYJB 4CSYA 1K32A 2I9AA 2ISMA 4FPLA 4MWLA 4KS2A 5FDQA 2HOXA 4Q6KA 1WCQA 5EGMB 4XMBA 4GN8A 5L30L 3KQBL 3KQCL 1IGZA 1G2MB 1XOEA 1IQIL 2M74A 1W0PA 2HT5A 1V04A 1INYA 3KCGL 2VVCK 1X7AL 3CA7A 3FBYA 1Q4GA 3DR2A 4H52A 5GTQA 1PRHA 2W2NE 2P93L 3U7UG 3OPZA 5D9BA 1YUFA 2Y7XB 3N8WB 1NN2A 2FLUX 1C9UA 2HT8A 2QWDA 3VNGA 1MS3A 2W8BA 2NPRA 1F8BA 4L7BA 5NN9A 2QWEA 3ELAL 2EI8B 4COXA 3QH0A 1EUTA 3WN7A 1ATBA 2IATA 1NSBA 1S0JA 4FOWA 4GZXA 4FPOB 4KS4A 1V3BA 5IKRA 1FFMA 2YGQA 2F11A 5HX0A 4G1MB 4ZHAB 1SUUA 3O4PA 3TBDA 1C5KA 4IFNX 2BOUA 4YW3A 1ZAQA 3BPSE 1CQEA 4BTTA 4YY8A 4X8TL 2YDTA 1S0IA 4AGTA 1WCSA 3G4HA 1PFXL 1W7XL 2VAQA 4NCSA 3KRKA 4RUTA 5IKTA 1PGEA 4G3NA 1LK9A 5F19A 1MS1A 2ZB5A 2BQ6A 4GN7A 5JVZA 2W8BB 5D9CA 3LN0A 2Y5HL 1G1TA 1V3XB 4RRWA 3V65B 1FF7A 4WEFA 4A0PA 2SILA 1N1SA 1RFNB 3SLIA 2AYLA 4B7RA 2VK7A 2J95B 2FLBL 4BXWA 3CKZA 1MZ6A 2HTRA 4MWUA 4XE9A 3K39A 1INGA 1N1YA 1IVEA 2PUQL 1TOZA 1UZPA 3Q3KB 3KYAA 4M4UA 3K3AA 2FP9A 4E1GA 4GNAA 4XBMA 4JYVL 4NG9L 4GZOA 4MWQA 2YGPA 2FLGA 4UOUA 3SRGA 2K2TA 1V0FA 5COXA 1V3EA 4GB1A 3POYA 5FZNA 4QN3A 1OFZA 2Y7ZB 1Z4ZA 3K38A 1F8EA 2VSMA 1QFKL 5JB8E 1INHA 4NA9L 1W0OA 1ADXA 4UF7A 5GX1A 1WHEA 4AHAA 1KIGL 1DQBA 4HZXA 1CCFA 3F6UL 1E8VA 3LTFB 1W1XA 1KLJL 1J9CL 2XBVL 4GZWA 2RNLA 4YZ4A 4B7JA 4LORA 5CKMA 2ZWAA 2HTQA 2BOKL 1G1RA 2GVWA 2F28A 3N8VA 2OYEP 3SW2A 3HRPA 3INBA 1IVDA 5D9DA 3AMRA 4BTIA 4C16A 1NFYB 1W8NA 4XJ8A 1NMBN 3HS5A 4LMFA 2P3TA 1NNAA 1A4QA 2EI6B 4MMXB 1EQHA 3G4EA 3A72A 4XYXA 1H6LA 1HJ7A 4X4AA 1IQKL 3QMOA 1E1AA 1ZI0A 3ALXA 1YO8A 4SLIA 5B2DA 2W86A 1F7MA 3GCXE 2J34B 3KQDL 1F8CA 1FAKL 1DIYA 1Z4WA 2BZDA 4IFJA 5GX2A 2KV4A 1W21A 4GZPA 4TGFA 2G8SA 1HX2A 4QN5A 4BXSA 2F13A 3RR3A 1X2JA 2VWLL 1CRUA 1W8BL 2HORA 1DILA 3WWAA 2WPHE 2POOA 3BT2A 2BQ7A 1POOA 1MOXC 1HRFA 3NSSA 2VWMK 2IARA 2AH2A 2FZZL
chains in the Genus database with same CATH topology
1TPGA 1UZQA 3SREA 3A9HA 4Q1UA 3GISX 3GCWE 1U8CB 2YGOA 1NFXB 4D0EA 1EAIC 3SOBB 3PGHA 4M11A 2BOHA 5KIRA 1QLGA 5GX3A 3FFGL 2Y80B 3ZYJB 1ATDA 4D0FA 1K36A 1WU1B 1XKBA 4Y71B 5JBCE 1O5DL 3BYCA 1C5MF 2RA0L 1JV2B 2WYGB 4Z6AL 3M37L 1APQA 1HAFA 1LQDA 3N8YA 2BO2A 1LPGA 2OYUP 4O5SA 3H5CB 3HO4A 2P4OA 1CRZA 3K9XA 2DG1A 3CFWA 4JZEL 3ZYGA 5CISA 1URKA 2EI7B 3HO5A 4NGAL 3TH3L 1CEJA 4HHOA 1KSNB 2W26B 1SZBA 1EPHA 3LC5B 1CVUA 2B7DL 1F0SB 3M36L 1IVOC 6COXA 1NFUB 3KL6B 3SOQA 2W2PE 3BT1A 4FM5A 1APOA 4ISIL 3HS6A 4YZUB 3N8YB 5JBBE 2W2QE 2WFXB 3FVZA 3Q6PA 1LMMA 3MDLA 2D1JB 1EPJA 2WPKE 3OLUA 1UZKA 5KN5C 3P5BL 4RRZA 1YGCL 1PTHA 4O1ZA 2FPCA 1IJQA 1EZQB 2WPIE 5JB9E 2W2OE 2Q1JB 2BQWA 2XBXL 4Y76B 1IQML 2Y5FL 5CKQA 3MQEA 1RWIA 1NPEA 2GVUA 1IQGL 2KB9A 1EGFA 2W3IB 1LPKA 3ZYIB 3F1SB 1G1QA 1NT0A 3LAQA 3TK6B 4ZAEB 3ENSA 4XLWA 2VWNL 1K37A 2UWLB 1XKAL 2XC0L 4BTUA 4Y6DB 4CUFA 2VH6B 1L3YA 3A9GA 2IAXA 2P95L 5K0HB 2GD4A 1EQGA 4O02B 2J38B 3OLTA 3U0SA 5GX5A 5GX4A 4ZH8B 5L2YL 3AMSA 1WHFA 1L5GB 1CVWL 1NPEB 4Z0LA 1P9JA 2K2SB 3LI5A 1CCVA 2P3FL 1GK5A 3FCSB 1ATEA 3LIWB 4PWZA 3SOVA 2XC5L 2IASA 2H9EC 1EPIA 1AUTL 3HS7A 1Z6CA 1LMJA 2KNIA 3KGGA 4XL1A 2F9BL 4OTJA 2DDUA 3LI4A 4YT6L 4ZLRA 2JKHL 2WPJE 1F7EA 1G1SA 4HW6A 2WPME 2PR3B 3NTBA 1IOEL 3V64C 2P94L 1PXXA 3V1SA 2J4IB 3NJPC 2ADXA 4Y79B 1EBVA 4Z0KB 3Q7DA 2FLRL 4RRYA 5F1AA 1LPZA 2BZ6L 2IAVA 1COUA 5E8DA 2FPBA 2GVXA 3KK6A 3WW9A 2Y5GL 1YUGA 3TK5B 2MGPA 3QCWA 4CUEA 3TC9A 2DG0A 4RRXA 1IP0A 1IQLL 3LI3A 1NQLB 5JW1A 1HAEA 5JVYA 1CX2A 1U67A 4JMLA 2MGRA 1KLIL 1ATAA 1EMNA 1XFEA 3C9AC 1HT5A 1UZJA 3NT1A 2CJIB 2KL7A 1JBUL 2WG3C 3N8XA 3IJEB 3I1CA 4JZDL 2P28B 1IQJL 3CS7L 2Y38A 4MMZB 1FE2A 3FW0A 2PHBB 1EMOA 2BMGA 2P26A 4PH9A 4X8VL 1A3PA 3HLIA 2I9BA 4M10A 3NTGA 4BDWA 4MMYB 4CUDA 1CVMA 3S6XA 2QE8A 4BDXA 1QBIA 2UWOB 1B9WA 2W2ME 2TGFA 3CENL 1P0SL 3R05A 3EGFA 3HLHA 5IKQA 5JBAE 1NZIA 1IQNL 2OJHA 2VVVL 1M1XB 1FJSL 3TZIA 1HCGB 4GNCA 3DEMA 1MQ6L 2GVVA 2H9EL 1F0RB 1JL9A 2UWPB 2IAQA 2Y81B 1IGXA 2HQSA 3N8ZA 2BOXA 3E5ZA 3S8ZA 2VH0B 1OB1C 2IAUA 1Z6EL 2IVZA 3LN1A 4JYUL 3U73A 3HPTA 3Q6KA 3DASA 4RS0A 2FD6A 2XBWL 2WG4B 4DG6A 4ISHL 2XC4L 5FWWA 1YUKB 1DDXA 2FP8A 3Q6TA 1FAXL 3IITB 2V91A 2VVUL 1MQ5L 1RWLA 3LC3B 1HREA 2W3KB 2WPLE 3S8VA 2J2UB 4Y7AB 2GHSA 5CKNA 3HO3A 1DX5I 4IYGA 2VJ3A 4A94C 5I46L 1IQHL 2DSOA 1KLOA 1IOXA 2Y82B 1EPGA 5L2ZL 3S94A 4GN9A 2WFTA 1Q7FA 2P16L 3IAXA 4O5TA 1BF9A 2XBYL 3TGFA 1IQFL 5IKVA 2IAWA 1PJXA 2RHPA 3ASIA 1N7DA 4Y7BB 4R40A 4A7IA 1DVAL 1CQ1A 1I0UA 2J94B 1HT8A 4X8SL 3LTGD 2WZPP 2G00L 4D90A 4IMBA 2IAPA 4OTYA 2P3UA 1G2LB 3S2KA 2P3FN 1N1IA 1XDTR 1FSBA 3N8WA 4GNBA 3KQEL 1HZ8A 1NFWB 4ZXXL 2VWOL 1TLEA 4JZFL 1IQEL 2MHPA 2IAOA 4HHQA 4X8UL 4AQTA 4ZXYL 4YT7L 2WYJB 4CSYA 2I9AA 2ISMA 5FDQA 5EGMB 4GN8A 5L30L 3KQBL 3KQCL 1IGZA 1G2MB 1IQIL 2M74A 1V04A 3KCGL 2VVCK 1X7AL 3CA7A 3FBYA 1Q4GA 3DR2A 5GTQA 1PRHA 2W2NE 2P93L 3U7UG 5D9BA 1YUFA 2Y7XB 3N8WB 1C9UA 2W8BA 2NPRA 3ELAL 2EI8B 4COXA 3QH0A 1ATBA 2IATA 5IKRA 1FFMA 2YGQA 4G1MB 4ZHAB 3O4PA 3TBDA 1C5KA 2BOUA 1ZAQA 3BPSE 1CQEA 4BTTA 4X8TL 3G4HA 1PFXL 1W7XL 2VAQA 3KRKA 4RUTA 5IKTA 1PGEA 5F19A 5D9CA 4GN7A 2BQ6A 5JVZA 2W8BB 3LN0A 2Y5HL 1G1TA 1V3XB 4RRWA 3V65B 1FF7A 4A0PA 1RFNB 2AYLA 2J95B 2FLBL 4BXWA 2PUQL 1TOZA 1UZPA 3Q3KB 3KYAA 2FP9A 4E1GA 4GNAA 4XBMA 4JYVL 4NG9L 2YGPA 2FLGA 3SRGA 2K2TA 5COXA 3POYA 2Y7ZB 1QFKL 5JB8E 4NA9L 5GX1A 1ADXA 1WHEA 1KIGL 1DQBA 1CCFA 3F6UL 3LTFB 1KLJL 1J9CL 2XBVL 5GX2A 2RNLA 4LORA 5CKMA 2BOKL 1G1RA 2GVWA 3N8VA 2OYEP 3SW2A 3HRPA 5D9DA 3AMRA 4BTIA 4C16A 1NFYB 3HS5A 4LMFA 2P3TA 3G4EA 2EI6B 4MMXB 1EQHA 1H6LA 1HJ7A 5EX7A 1IQKL 3QMOA 1E1AA 1YO8A 2W86A 1F7MA 3GCXE 2J34B 3KQDL 1FAKL 1DIYA 2KV4A 4TGFA 2G8SA 1HX2A 4BXSA 3RR3A 2VWLL 1CRUA 1W8BL 3WWAA 2WPHE 2POOA 3BT2A 2BQ7A 1POOA 1MOXC 1HRFA 2VWMK 2IARA 2FZZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TPG A;  1UZQ A;  3SRE A;  3A9H A;  4Q1U A;  3GIS X;  3GCW E;  1U8C B;  2YGO A;  1NFX B;  4D0E A;  1EAI C;  3SOB B;  3PGH A;  4M11 A;  2BOH A;  5KIR A;  1QLG A;  5GX3 A;  3FFG L;  2Y80 B;  3ZYJ B;  1ATD A;  4D0F A;  1K36 A;  1WU1 B;  1XKB A;  4Y71 B;  5JBC E;  1O5D L;  3BYC A;  1C5M F;  2RA0 L;  1JV2 B;  2WYG B;  4Z6A L;  3M37 L;  1APQ A;  1HAF A;  1LQD A;  3N8Y A;  2BO2 A;  1LPG A;  2OYU P;  4O5S A;  3H5C B;  3HO4 A;  2P4O A;  1CRZ A;  3K9X A;  2DG1 A;  3CFW A;  4JZE L;  3ZYG A;  5CIS A;  1URK A;  2EI7 B;  3HO5 A;  4NGA L;  3TH3 L;  1CEJ A;  4HHO A;  1KSN B;  2W26 B;  1SZB A;  1EPH A;  3LC5 B;  1CVU A;  2B7D L;  1F0S B;  3M36 L;  1IVO C;  6COX A;  1NFU B;  3KL6 B;  3SOQ A;  2W2P E;  3BT1 A;  4FM5 A;  1APO A;  4ISI L;  3HS6 A;  4YZU B;  3N8Y B;  5JBB E;  2W2Q E;  2WFX B;  3FVZ A;  3Q6P A;  3MDL A;  2D1J B;  1EPJ A;  2WPK E;  3OLU A;  1UZK A;  5KN5 C;  3P5B L;  4RRZ A;  1YGC L;  1PTH A;  4O1Z A;  2FPC A;  1IJQ A;  1EZQ B;  2WPI E;  5JB9 E;  2W2O E;  2Q1J B;  2BQW A;  2XBX L;  4Y76 B;  1IQM L;  2Y5F L;  5CKQ A;  3MQE A;  1RWI A;  1NPE A;  2GVU A;  1IQG L;  2KB9 A;  1EGF A;  2W3I B;  1LPK A;  3ZYI B;  3F1S B;  1G1Q A;  1NT0 A;  3LAQ A;  3TK6 B;  4ZAE B;  3ENS A;  4XLW A;  2VWN L;  1K37 A;  2UWL B;  1XKA L;  2XC0 L;  4BTU A;  4Y6D B;  4CUF A;  2VH6 B;  1L3Y A;  3A9G A;  2IAX A;  2P95 L;  5K0H B;  2GD4 A;  1EQG A;  4O02 B;  2J38 B;  3OLT A;  3U0S A;  5GX5 A;  5GX4 A;  4ZH8 B;  5L2Y L;  3AMS A;  1WHF A;  1L5G B;  1CVW L;  1NPE B;  4Z0L A;  1P9J A;  2K2S B;  3LI5 A;  1CCV A;  2P3F L;  1GK5 A;  3FCS B;  1ATE A;  3LIW B;  4PWZ A;  3SOV A;  2XC5 L;  2IAS A;  1EPI A;  1AUT L;  3HS7 A;  1Z6C A;  1LMJ A;  3KGG A;  4XL1 A;  2F9B L;  4OTJ A;  2DDU A;  3LI4 A;  4YT6 L;  4ZLR A;  2JKH L;  2WPJ E;  1F7E A;  1G1S A;  4HW6 A;  2WPM E;  2PR3 B;  3NTB A;  1IOE L;  3V64 C;  2P94 L;  1PXX A;  3V1S A;  2J4I B;  3NJP C;  2ADX A;  4Y79 B;  1EBV A;  4Z0K B;  3Q7D A;  2FLR L;  4RRY A;  5F1A A;  1LPZ A;  2BZ6 L;  2IAV A;  1COU A;  5E8D A;  2FPB A;  2GVX A;  3KK6 A;  3WW9 A;  2Y5G L;  1YUG A;  3TK5 B;  2MGP A;  3QCW A;  4CUE A;  3TC9 A;  2DG0 A;  4RRX A;  1IP0 A;  1IQL L;  3LI3 A;  1NQL B;  5JW1 A;  1HAE A;  5JVY A;  1CX2 A;  1U67 A;  4JML A;  2MGR A;  1KLI L;  1ATA A;  1EMN A;  1XFE A;  3C9A C;  1HT5 A;  1UZJ A;  3NT1 A;  2CJI B;  2KL7 A;  1JBU L;  2WG3 C;  3N8X A;  3IJE B;  3I1C A;  4JZD L;  2P28 B;  1IQJ L;  3CS7 L;  2Y38 A;  4MMZ B;  1FE2 A;  3FW0 A;  2PHB B;  1EMO A;  2BMG A;  2P26 A;  4PH9 A;  4X8V L;  1A3P A;  3HLI A;  2I9B A;  4M10 A;  3NTG A;  4BDW A;  4MMY B;  4CUD A;  1CVM A;  2QE8 A;  4BDX A;  1QBI A;  2UWO B;  1B9W A;  2W2M E;  2TGF A;  3CEN L;  1P0S L;  3R05 A;  3EGF A;  3HLH A;  5IKQ A;  5JBA E;  1NZI A;  1IQN L;  2OJH A;  2VVV L;  1M1X B;  1FJS L;  3TZI A;  1HCG B;  4GNC A;  3DEM A;  1MQ6 L;  2GVV A;  2H9E L;  1F0R B;  1JL9 A;  2UWP B;  2IAQ A;  2Y81 B;  1IGX A;  2HQS A;  3N8Z A;  2BOX A;  3E5Z A;  3S8Z A;  2VH0 B;  1OB1 C;  2IAU A;  1Z6E L;  2IVZ A;  3LN1 A;  4JYU L;  3U73 A;  3HPT A;  3Q6K A;  3DAS A;  4RS0 A;  2FD6 A;  2XBW L;  2WG4 B;  4DG6 A;  4ISH L;  2XC4 L;  5FWW A;  1YUK B;  1DDX A;  2FP8 A;  3Q6T A;  1FAX L;  3IIT B;  2V91 A;  2VVU L;  1MQ5 L;  1RWL A;  3LC3 B;  1HRE A;  2W3K B;  2WPL E;  3S8V A;  2J2U B;  4Y7A B;  2GHS A;  5CKN A;  3HO3 A;  1DX5 I;  4IYG A;  2VJ3 A;  5I46 L;  1IQH L;  2DSO A;  1KLO A;  1IOX A;  2Y82 B;  1EPG A;  5L2Z L;  3S94 A;  4GN9 A;  2WFT A;  1Q7F A;  2P16 L;  3IAX A;  4O5T A;  1BF9 A;  2XBY L;  3TGF A;  1IQF L;  5IKV A;  2IAW A;  1PJX A;  2RHP A;  3ASI A;  1N7D A;  4Y7B B;  4R40 A;  4A7I A;  1DVA L;  1CQ1 A;  1I0U A;  2J94 B;  1HT8 A;  4X8S L;  3LTG D;  2G00 L;  4D90 A;  4IMB A;  2IAP A;  4OTY A;  2P3U A;  1G2L B;  3S2K A;  2P3F N;  1N1I A;  1XDT R;  1FSB A;  3N8W A;  4GNB A;  3KQE L;  1HZ8 A;  1NFW B;  4ZXX L;  2VWO L;  1TLE A;  4JZF L;  1IQE L;  2MHP A;  2IAO A;  4HHQ A;  4X8U L;  4AQT A;  4ZXY L;  4YT7 L;  2WYJ B;  4CSY A;  2I9A A;  2ISM A;  5FDQ A;  5EGM B;  4GN8 A;  5L30 L;  3KQB L;  3KQC L;  1IGZ A;  1G2M B;  1IQI L;  2M74 A;  1V04 A;  3KCG L;  2VVC K;  1X7A L;  3CA7 A;  3FBY A;  1Q4G A;  3DR2 A;  5GTQ A;  1PRH A;  2W2N E;  2P93 L;  3U7U G;  5D9B A;  1YUF A;  2Y7X B;  3N8W B;  1C9U A;  2W8B A;  2NPR A;  3ELA L;  2EI8 B;  4COX A;  3QH0 A;  1ATB A;  2IAT A;  5IKR A;  1FFM A;  4G1M B;  4ZHA B;  3O4P A;  3TBD A;  1C5K A;  2BOU A;  1ZAQ A;  3BPS E;  1CQE A;  4BTT A;  4X8T L;  3G4H A;  1PFX L;  1W7X L;  2VAQ A;  3KRK A;  4RUT A;  5IKT A;  1PGE A;  5F19 A;  5D9C A;  4GN7 A;  2BQ6 A;  5JVZ A;  2W8B B;  3LN0 A;  2Y5H L;  1G1T A;  1V3X B;  4RRW A;  3V65 B;  1FF7 A;  4A0P A;  1RFN B;  2AYL A;  2J95 B;  2FLB L;  4BXW A;  2PUQ L;  1TOZ A;  1UZP A;  3Q3K B;  3KYA A;  2FP9 A;  4E1G A;  4GNA A;  4XBM A;  4JYV L;  4NG9 L;  2YGP A;  2FLG A;  3SRG A;  2K2T A;  5COX A;  3POY A;  2Y7Z B;  1QFK L;  5JB8 E;  4NA9 L;  5GX1 A;  1ADX A;  1WHE A;  1KIG L;  1DQB A;  1CCF A;  3F6U L;  3LTF B;  1KLJ L;  1J9C L;  2XBV L;  5GX2 A;  2RNL A;  4LOR A;  5CKM A;  2BOK L;  1G1R A;  2GVW A;  3N8V A;  2OYE P;  3SW2 A;  3HRP A;  5D9D A;  3AMR A;  4BTI A;  4C16 A;  1NFY B;  3HS5 A;  4LMF A;  2P3T A;  3G4E A;  2EI6 B;  4MMX B;  1EQH A;  1H6L A;  1HJ7 A;  5EX7 A;  1IQK L;  3QMO A;  1E1A A;  1YO8 A;  2W86 A;  1F7M A;  3GCX E;  2J34 B;  3KQD L;  1FAK L;  1DIY A;  2KV4 A;  4TGF A;  2G8S A;  1HX2 A;  4BXS A;  3RR3 A;  2VWL L;  1CRU A;  1W8B L;  3WWA A;  2WPH E;  2POO A;  3BT2 A;  2BQ7 A;  1POO A;  1MOX C;  1HRF A;  2VWM K;  2IAR A;  2FZZ L; 
#chains in the Genus database with same CATH topology
 2VPJ A;  1TPG A;  4FJ6 A;  1UZQ A;  5EO8 A;  3SRE A;  3A9H A;  3TI5 A;  4Q1U A;  3NN9 A;  3GIS X;  3GCW E;  4CPO A;  4K1J A;  1V3D A;  4M4N A;  2VVZ A;  5FNT A;  1U8C B;  2BT7 A;  2YGO A;  4FP3 A;  4ZY3 A;  3TI8 A;  1NFX B;  4D0E A;  1EAI C;  3SOB B;  3PGH A;  4M11 A;  2BOH A;  5KIR A;  1S18 A;  1QLG A;  5GX3 A;  4ZGC A;  3FFG L;  4FPG A;  2Y80 B;  1NCA N;  3ZYJ B;  5FNR A;  4XOG A;  5EO7 A;  5F9T A;  1ATD A;  4CPM A;  4D0F A;  1K36 A;  4B7M A;  1WU1 B;  1XKB A;  4Y71 B;  5JBC E;  1O5D L;  2SLI A;  3BYC A;  1C5M F;  1IVG A;  1L7H A;  3D12 A;  3O9K A;  4AH4 A;  2BSF A;  2RA0 L;  1JV2 B;  2WYG B;  2AEP A;  2F25 A;  4K1H A;  4Z6A L;  4MWJ A;  3M37 L;  4XHX A;  4XIL A;  1APQ A;  1HAF A;  1LQD A;  3N8Y A;  3PJQ A;  4GZQ A;  4WEG A;  2B8H A;  2BO2 A;  1LPG A;  2OYU P;  4O5S A;  3H5C B;  1NMA N;  2YA5 A;  3HO4 A;  2P4O A;  1CRZ A;  4CSD A;  3K9X A;  2DG1 A;  2W5O A;  3CFW A;  4X6K A;  4JZE L;  1QIU A;  3ZYG A;  5CIS A;  1URK A;  2EI7 B;  3HO5 A;  4NGA L;  3TH3 L;  4MJU A;  1CEJ A;  1EUS A;  4HHO A;  2SIM A;  3TIC A;  5EX7 A;  1B9T A;  1KSN B;  2W26 B;  2HU4 A;  3ALW A;  4GZT A;  3W09 A;  3NO0 A;  1SZB A;  1EPH A;  3LC5 B;  4MC7 A;  1CVU A;  2B7D L;  2F12 A;  4MX0 A;  1F0S B;  1V1I A;  3M36 L;  1IVO C;  4B7N A;  4NN9 A;  5FZJ A;  3L6V A;  2HT7 A;  6COX A;  1NFU B;  4HIZ A;  3KL6 B;  3SOQ A;  4XJZ A;  2W2P E;  3BT1 A;  4FM5 A;  4HZW A;  1APO A;  4ISI L;  2C4A A;  3HS6 A;  4YZU B;  3N8Y B;  5JBB E;  4MZA A;  2W2Q E;  2WFX B;  3FVZ A;  3Q6P A;  1LMM A;  3MDL A;  4FP2 A;  2D1J B;  1EPJ A;  2WPK E;  3OLU A;  1UZK A;  5KN5 C;  5HUN A;  3P5B L;  4RRZ A;  1YGC L;  1PTH A;  4O1Z A;  1NCC N;  1IJQ A;  1EZQ B;  2WPI E;  2FPC A;  3GVJ A;  4FPY A;  5JB9 E;  4IN4 A;  2W2O E;  2F10 A;  1MR5 A;  2W5N A;  5FNQ A;  4C1Y A;  2Q1J B;  3UC1 A;  2BQW A;  2XBX L;  4Y76 B;  1IQM L;  2Y5F L;  5CKQ A;  3MQE A;  1IUB A;  1NPE A;  1RWI A;  2GVU A;  1IQG L;  2HTU A;  1Z50 A;  2KB9 A;  1EGF A;  2W3I B;  1LPK A;  3D11 A;  3ZYI B;  3F1S B;  1G1Q A;  2QWC A;  1NT0 A;  3LAQ A;  5H47 A;  3TK6 B;  4ZAE B;  3ENS A;  4YZ3 A;  4XLW A;  3A71 A;  3VNH A;  2VWN L;  1N1T A;  1K37 A;  2UWL B;  1XKA L;  2XC0 L;  4BTU A;  4XHB A;  4GJT A;  4MWV A;  4ASC A;  1A4G A;  4HZV A;  2YA8 A;  4Y6D B;  4CUF A;  3K37 A;  4YZ1 A;  3SAL A;  4MWY A;  1NSD A;  4J9T A;  2VH6 B;  1L3Y A;  4YW5 A;  3A9G A;  2IAX A;  2P95 L;  5K0H B;  2GD4 A;  4FPC A;  4N1B A;  4D4U A;  1EQG A;  4O02 B;  2J38 B;  3OLT A;  2JJL A;  3U0S A;  4C1Y B;  5GX5 A;  5GX4 A;  4ZH8 B;  5L2Y L;  4CPL A;  3AMS A;  2AGS A;  4L7C A;  1KKE A;  1WHF A;  1L5G B;  1CVW L;  1NPE B;  4Z0L A;  2JKB A;  1P9J A;  2K2S B;  3LI5 A;  5M1Z A;  1CCV A;  1MS0 A;  2P3F L;  1GK5 A;  3FCS B;  3CL2 A;  4XIO A;  1ATE A;  4YW1 A;  4YW4 A;  4XJA A;  4XIK A;  3LIW B;  5CGJ A;  2F24 A;  4MWX A;  3SOV A;  4PWZ A;  2XC5 L;  1N6E A;  1L7F A;  2IAS A;  2H9E C;  1B9S A;  1EPI A;  1AUT L;  3HS7 A;  1VCU A;  1Z6C A;  4CPY A;  1LMJ A;  2KNI A;  2QWF A;  3KGG A;  4CPN A;  5FNU A;  4XL1 A;  5FNS A;  2F9B L;  2QWG A;  4OTJ A;  2DDU A;  3LI4 A;  5HUG A;  4KS3 A;  4YT6 L;  3O9J A;  2JKH L;  2WPJ E;  1F7E A;  4ZLR A;  4GDI A;  1G1S A;  4HW6 A;  2WPM E;  3B69 A;  2PR3 B;  1IVB A;  4BBW A;  3NTB A;  4M3M A;  2VRS A;  1IOE L;  3V64 C;  2P94 L;  3JU4 A;  3H71 A;  4XJR A;  1PXX A;  4XJU A;  3V1S A;  2XN4 A;  2J4I B;  3NJP C;  3SAN A;  2ADX A;  4Y79 B;  1EBV A;  1V1H A;  2VW2 A;  4Z0K B;  1EUU A;  3Q7D A;  1N6D A;  2FLR L;  4RRY A;  5F1A A;  3K36 A;  2Z32 A;  1INW A;  1LPZ A;  2BZ6 L;  1XOG A;  4QNP A;  3ZGC A;  2QWH A;  2IAV A;  1NNB A;  1COU A;  5E8D A;  1Z4Y A;  2FPB A;  2QWJ A;  2XCY A;  1USR A;  2GVX A;  3KK6 A;  4K1K A;  2Y5G L;  4NC5 A;  1YUG A;  3TK5 B;  2MGP A;  3QCW A;  4CUE A;  3II7 A;  2DG0 A;  3TC9 A;  1MS4 A;  5JYY A;  1EUR A;  1F8D A;  4XJ9 A;  1V3C A;  4RRX A;  1IP0 A;  4D52 A;  1IQL L;  3GVK A;  3LI3 A;  1MZ5 A;  1NQL B;  5JW1 A;  1HAE A;  4MWW A;  5JVY A;  1INF A;  1CX2 A;  4YZ5 A;  1U67 A;  4JML A;  2MGR A;  1V0E A;  1KLI L;  1ATA A;  1EMN A;  1XFE A;  3C9A C;  1HT5 A;  1UZJ A;  3NT1 A;  2CJI B;  3H72 A;  2ZB6 A;  2KL7 A;  1JBU L;  2WG3 C;  3N8X A;  1N1V A;  2HTY A;  4QN6 A;  7NN9 A;  4FPJ A;  3IJE B;  3I1C A;  4JZD L;  1U6D X;  2P28 B;  2VK5 A;  4M4V A;  4XJQ A;  4D52 C;  4HZY A;  2A75 A;  1IQJ L;  2H2U A;  4MZE A;  2W38 A;  2YA6 A;  3CS7 L;  4CPZ A;  4X49 A;  2Y38 A;  4MMZ B;  1FE2 A;  3FW0 A;  2PHB B;  1EMO A;  1X2R A;  2BMG A;  1NSC A;  4FQ4 A;  2P26 A;  4PH9 A;  4X8V L;  2VSK A;  1SLI A;  4KS1 A;  3ZGD A;  1A3P A;  3HLI A;  4D52 B;  3BEQ A;  2QWA A;  2I9B A;  4M10 A;  3NTG A;  4BDW A;  4MMY B;  4FZH A;  3WDZ A;  4CUD A;  1CVM A;  1MS5 A;  3S6X A;  2QE8 A;  4BDX A;  2XZI A;  3WW9 A;  1QBI A;  4IQK A;  2UWO B;  3CL0 A;  4FOV A;  4GDJ A;  4GEZ A;  1B9W A;  2W2M E;  2TGF A;  3CEN L;  1P0S L;  4GU3 A;  3R05 A;  3EGF A;  1WP5 A;  1N6F A;  2HTV A;  3T1E A;  3TI4 A;  3HLH A;  4DGR A;  5IKQ A;  5JBA E;  3H6J A;  1NNC A;  1NZI A;  1IQN L;  1SNT A;  1IUC A;  2C4L A;  4FPE A;  2OJH A;  2VVV L;  1M1X B;  3B7E A;  1FJS L;  3TZI A;  1HCG B;  3TIB A;  2ZZK A;  4GNC A;  3DEM A;  1MQ6 L;  2GVV A;  2H9E L;  4X47 A;  1F0R B;  1JL9 A;  2UWP B;  2IAQ A;  2Y81 B;  1DIM A;  1IGX A;  2HQS A;  2VK6 A;  4CH9 A;  3N8Z A;  1W20 A;  2BOX A;  3E5Z A;  5HUM A;  3S8Z A;  2VH0 B;  1OB1 C;  2IAU A;  1Z6E L;  1NCD N;  2FHR A;  2IVZ A;  3LN1 A;  4JYU L;  3U73 A;  1S1D A;  4HZZ A;  2VWD A;  4MWR A;  3HPT A;  3Q6K A;  5B2C A;  2DYH A;  4RS0 A;  3DAS A;  2FD6 A;  2XBW L;  2WG4 B;  1E8T A;  2F0Z A;  1E8U A;  4FOQ A;  4DG6 A;  4ISH L;  2XC4 L;  5FWW A;  2F29 A;  1YUK B;  2VW0 A;  2W20 A;  3TI3 A;  4L7D A;  1DDX A;  4AGI A;  1VCJ A;  2FP8 A;  3Q6T A;  4WA3 A;  1FAX L;  1NMC A;  3IIT B;  2V91 A;  2VVU L;  1KIT A;  1MQ5 L;  1RWL A;  2BAT A;  3TIA A;  1MWE A;  4GU4 A;  3LC3 B;  1SLL A;  1HRE A;  2W3K B;  2WPL E;  4IFL X;  3S8V A;  4B7Q A;  2J2U B;  2VW1 A;  4Y7A B;  1W8O A;  2GHS A;  4XJW A;  2HTW A;  1V2I A;  2WOZ A;  5CKN A;  1L7G A;  2AEQ A;  2BF6 A;  2X9M A;  1MS9 A;  3HO3 A;  1DX5 I;  4IYG A;  2VJ3 A;  4A94 C;  5I46 L;  2RKC A;  4WA4 A;  1IQH L;  5F72 C;  2XZK A;  1NCB N;  2DSO A;  1IVC A;  4MJV A;  1KLO A;  3SIL A;  1IOX A;  2Y82 B;  2QWB A;  1EPG A;  5L2Z L;  3S94 A;  4GN9 A;  5HUK A;  1IVF A;  2QWI A;  2WFT A;  1Q7F A;  4I00 A;  2P16 L;  3IAX A;  4O5T A;  1BF9 A;  2XBY L;  1SO7 A;  4K1I A;  3TGF A;  1IQF L;  1Z4V A;  2HU0 A;  5IKV A;  2IAW A;  3TI6 A;  1PJX A;  4FPF A;  1A14 N;  1INX A;  2BER A;  4FOY A;  2ZW9 A;  4K3Y A;  3H73 A;  2RHP A;  3GVL A;  4KS5 A;  3ASI A;  1N7D A;  4Y7B B;  2F26 A;  4R40 A;  4QN4 A;  4A7I A;  1DVA L;  1CQ1 A;  1I0U A;  2YA7 A;  2XZJ A;  2J94 B;  4XMA A;  4CHB A;  2H2N A;  1HT8 A;  4GZS A;  4YZ2 A;  4X8S L;  6NN9 A;  1ZGK A;  3LTG D;  2WZP P;  4D8S A;  4XMI A;  3ADE A;  2G00 L;  4D90 A;  4IMB A;  2IAP A;  1MS8 A;  4OTY A;  2P3U A;  1G2L B;  3S2K A;  4WA5 A;  2P3F N;  1N1I A;  1XDT R;  1FSB A;  3N8W A;  4GNB A;  3KQE L;  3CYE A;  1V0Z A;  4FVK A;  1BJI A;  1HZ8 A;  1NFW B;  1Z4X A;  4ZXX L;  2VWO L;  2YA4 A;  1TLE A;  4JZF L;  2CML A;  2YDP A;  2BT8 A;  4H53 A;  1INV A;  1IQE L;  2MHP A;  2QWK A;  4JF7 A;  2IAO A;  1USX A;  4HHQ A;  4YW2 A;  4X8U L;  4AQT A;  4ZXY L;  4FPH A;  4FPK A;  2F27 A;  4YT7 L;  1B9V A;  4QN7 A;  2WYJ B;  4CSY A;  1K32 A;  2I9A A;  2ISM A;  4FPL A;  4MWL A;  4KS2 A;  5FDQ A;  2HOX A;  4Q6K A;  1WCQ A;  5EGM B;  4XMB A;  4GN8 A;  5L30 L;  3KQB L;  3KQC L;  1IGZ A;  1G2M B;  1XOE A;  1IQI L;  2M74 A;  1W0P A;  2HT5 A;  1V04 A;  1INY A;  3KCG L;  2VVC K;  1X7A L;  3CA7 A;  3FBY A;  1Q4G A;  3DR2 A;  4H52 A;  5GTQ A;  1PRH A;  2W2N E;  2P93 L;  3U7U G;  3OPZ A;  5D9B A;  1YUF A;  2Y7X B;  3N8W B;  1NN2 A;  2FLU X;  1C9U A;  2HT8 A;  2QWD A;  3VNG A;  1MS3 A;  2W8B A;  2NPR A;  1F8B A;  4L7B A;  5NN9 A;  2QWE A;  3ELA L;  2EI8 B;  4COX A;  3QH0 A;  1EUT A;  3WN7 A;  1ATB A;  2IAT A;  1NSB A;  1S0J A;  4FOW A;  4GZX A;  4FPO B;  4KS4 A;  1V3B A;  5IKR A;  1FFM A;  2YGQ A;  2F11 A;  5HX0 A;  4G1M B;  4ZHA B;  1SUU A;  3O4P A;  3TBD A;  1C5K A;  4IFN X;  2BOU A;  4YW3 A;  1ZAQ A;  3BPS E;  1CQE A;  4BTT A;  4YY8 A;  4X8T L;  2YDT A;  1S0I A;  4AGT A;  1WCS A;  3G4H A;  1PFX L;  1W7X L;  2VAQ A;  4NCS A;  3KRK A;  4RUT A;  5IKT A;  1PGE A;  4G3N A;  1LK9 A;  5F19 A;  1MS1 A;  2ZB5 A;  2BQ6 A;  4GN7 A;  5JVZ A;  2W8B B;  5D9C A;  3LN0 A;  2Y5H L;  1G1T A;  1V3X B;  4RRW A;  3V65 B;  1FF7 A;  4WEF A;  4A0P A;  2SIL A;  1N1S A;  1RFN B;  3SLI A;  2AYL A;  4B7R A;  2VK7 A;  2J95 B;  2FLB L;  4BXW A;  3CKZ A;  1MZ6 A;  2HTR A;  4MWU A;  4XE9 A;  3K39 A;  1ING A;  1N1Y A;  1IVE A;  2PUQ L;  1TOZ A;  1UZP A;  3Q3K B;  3KYA A;  4M4U A;  3K3A A;  2FP9 A;  4E1G A;  4GNA A;  4XBM A;  4JYV L;  4NG9 L;  4GZO A;  4MWQ A;  2YGP A;  2FLG A;  4UOU A;  3SRG A;  2K2T A;  1V0F A;  5COX A;  1V3E A;  4GB1 A;  3POY A;  5FZN A;  4QN3 A;  1OFZ A;  2Y7Z B;  1Z4Z A;  3K38 A;  1F8E A;  2VSM A;  1QFK L;  5JB8 E;  1INH A;  4NA9 L;  1W0O A;  1ADX A;  4UF7 A;  5GX1 A;  1WHE A;  4AHA A;  1KIG L;  1DQB A;  4HZX A;  1CCF A;  3F6U L;  1E8V A;  3LTF B;  1W1X A;  1KLJ L;  1J9C L;  2XBV L;  4GZW A;  2RNL A;  4YZ4 A;  4B7J A;  4LOR A;  5CKM A;  2ZWA A;  2HTQ A;  2BOK L;  1G1R A;  2GVW A;  2F28 A;  3N8V A;  2OYE P;  3SW2 A;  3HRP A;  3INB A;  1IVD A;  5D9D A;  3AMR A;  4BTI A;  4C16 A;  1NFY B;  1W8N A;  4XJ8 A;  1NMB N;  3HS5 A;  4LMF A;  2P3T A;  1NNA A;  1A4Q A;  2EI6 B;  4MMX B;  1EQH A;  3G4E A;  3A72 A;  4XYX A;  1H6L A;  1HJ7 A;  4X4A A;  1IQK L;  3QMO A;  1E1A A;  1ZI0 A;  3ALX A;  1YO8 A;  4SLI A;  5B2D A;  2W86 A;  1F7M A;  3GCX E;  2J34 B;  3KQD L;  1F8C A;  1FAK L;  1DIY A;  1Z4W A;  2BZD A;  4IFJ A;  5GX2 A;  2KV4 A;  1W21 A;  4GZP A;  4TGF A;  2G8S A;  1HX2 A;  4QN5 A;  4BXS A;  2F13 A;  3RR3 A;  1X2J A;  2VWL L;  1CRU A;  1W8B L;  2HOR A;  1DIL A;  3WWA A;  2WPH E;  2POO A;  3BT2 A;  2BQ7 A;  1POO A;  1MOX C;  1HRF A;  3NSS A;  2VWM K;  2IAR A;  2AH2 A;  2FZZ L; 
#chains in the Genus database with same CATH homology
 1TPG A;  1UZQ A;  3SRE A;  3A9H A;  4Q1U A;  3GIS X;  3GCW E;  1U8C B;  2YGO A;  1NFX B;  4D0E A;  1EAI C;  3SOB B;  3PGH A;  4M11 A;  2BOH A;  5KIR A;  1QLG A;  5GX3 A;  3FFG L;  2Y80 B;  3ZYJ B;  1ATD A;  4D0F A;  1K36 A;  1WU1 B;  1XKB A;  4Y71 B;  5JBC E;  1O5D L;  3BYC A;  1C5M F;  2RA0 L;  1JV2 B;  2WYG B;  4Z6A L;  3M37 L;  1APQ A;  1HAF A;  1LQD A;  3N8Y A;  2BO2 A;  1LPG A;  2OYU P;  4O5S A;  3H5C B;  3HO4 A;  2P4O A;  1CRZ A;  3K9X A;  2DG1 A;  3CFW A;  4JZE L;  3ZYG A;  5CIS A;  1URK A;  2EI7 B;  3HO5 A;  4NGA L;  3TH3 L;  1CEJ A;  4HHO A;  1KSN B;  2W26 B;  1SZB A;  1EPH A;  3LC5 B;  1CVU A;  2B7D L;  1F0S B;  3M36 L;  1IVO C;  6COX A;  1NFU B;  3KL6 B;  3SOQ A;  2W2P E;  3BT1 A;  4FM5 A;  1APO A;  4ISI L;  3HS6 A;  4YZU B;  3N8Y B;  5JBB E;  2W2Q E;  2WFX B;  3FVZ A;  3Q6P A;  1LMM A;  3MDL A;  2D1J B;  1EPJ A;  2WPK E;  3OLU A;  1UZK A;  5KN5 C;  3P5B L;  4RRZ A;  1YGC L;  1PTH A;  4O1Z A;  2FPC A;  1IJQ A;  1EZQ B;  2WPI E;  5JB9 E;  2W2O E;  2Q1J B;  2BQW A;  2XBX L;  4Y76 B;  1IQM L;  2Y5F L;  5CKQ A;  3MQE A;  1RWI A;  1NPE A;  2GVU A;  1IQG L;  2KB9 A;  1EGF A;  2W3I B;  1LPK A;  3ZYI B;  3F1S B;  1G1Q A;  1NT0 A;  3LAQ A;  3TK6 B;  4ZAE B;  3ENS A;  4XLW A;  2VWN L;  1K37 A;  2UWL B;  1XKA L;  2XC0 L;  4BTU A;  4Y6D B;  4CUF A;  2VH6 B;  1L3Y A;  3A9G A;  2IAX A;  2P95 L;  5K0H B;  2GD4 A;  1EQG A;  4O02 B;  2J38 B;  3OLT A;  3U0S A;  5GX5 A;  5GX4 A;  4ZH8 B;  5L2Y L;  3AMS A;  1WHF A;  1L5G B;  1CVW L;  1NPE B;  4Z0L A;  1P9J A;  2K2S B;  3LI5 A;  1CCV A;  2P3F L;  1GK5 A;  3FCS B;  1ATE A;  3LIW B;  4PWZ A;  3SOV A;  2XC5 L;  2IAS A;  2H9E C;  1EPI A;  1AUT L;  3HS7 A;  1Z6C A;  1LMJ A;  2KNI A;  3KGG A;  4XL1 A;  2F9B L;  4OTJ A;  2DDU A;  3LI4 A;  4YT6 L;  4ZLR A;  2JKH L;  2WPJ E;  1F7E A;  1G1S A;  4HW6 A;  2WPM E;  2PR3 B;  3NTB A;  1IOE L;  3V64 C;  2P94 L;  1PXX A;  3V1S A;  2J4I B;  3NJP C;  2ADX A;  4Y79 B;  1EBV A;  4Z0K B;  3Q7D A;  2FLR L;  4RRY A;  5F1A A;  1LPZ A;  2BZ6 L;  2IAV A;  1COU A;  5E8D A;  2FPB A;  2GVX A;  3KK6 A;  3WW9 A;  2Y5G L;  1YUG A;  3TK5 B;  2MGP A;  3QCW A;  4CUE A;  3TC9 A;  2DG0 A;  4RRX A;  1IP0 A;  1IQL L;  3LI3 A;  1NQL B;  5JW1 A;  1HAE A;  5JVY A;  1CX2 A;  1U67 A;  4JML A;  2MGR A;  1KLI L;  1ATA A;  1EMN A;  1XFE A;  3C9A C;  1HT5 A;  1UZJ A;  3NT1 A;  2CJI B;  2KL7 A;  1JBU L;  2WG3 C;  3N8X A;  3IJE B;  3I1C A;  4JZD L;  2P28 B;  1IQJ L;  3CS7 L;  2Y38 A;  4MMZ B;  1FE2 A;  3FW0 A;  2PHB B;  1EMO A;  2BMG A;  2P26 A;  4PH9 A;  4X8V L;  1A3P A;  3HLI A;  2I9B A;  4M10 A;  3NTG A;  4BDW A;  4MMY B;  4CUD A;  1CVM A;  3S6X A;  2QE8 A;  4BDX A;  1QBI A;  2UWO B;  1B9W A;  2W2M E;  2TGF A;  3CEN L;  1P0S L;  3R05 A;  3EGF A;  3HLH A;  5IKQ A;  5JBA E;  1NZI A;  1IQN L;  2OJH A;  2VVV L;  1M1X B;  1FJS L;  3TZI A;  1HCG B;  4GNC A;  3DEM A;  1MQ6 L;  2GVV A;  2H9E L;  1F0R B;  1JL9 A;  2UWP B;  2IAQ A;  2Y81 B;  1IGX A;  2HQS A;  3N8Z A;  2BOX A;  3E5Z A;  3S8Z A;  2VH0 B;  1OB1 C;  2IAU A;  1Z6E L;  2IVZ A;  3LN1 A;  4JYU L;  3U73 A;  3HPT A;  3Q6K A;  3DAS A;  4RS0 A;  2FD6 A;  2XBW L;  2WG4 B;  4DG6 A;  4ISH L;  2XC4 L;  5FWW A;  1YUK B;  1DDX A;  2FP8 A;  3Q6T A;  1FAX L;  3IIT B;  2V91 A;  2VVU L;  1MQ5 L;  1RWL A;  3LC3 B;  1HRE A;  2W3K B;  2WPL E;  3S8V A;  2J2U B;  4Y7A B;  2GHS A;  5CKN A;  3HO3 A;  1DX5 I;  4IYG A;  2VJ3 A;  4A94 C;  5I46 L;  1IQH L;  2DSO A;  1KLO A;  1IOX A;  2Y82 B;  1EPG A;  5L2Z L;  3S94 A;  4GN9 A;  2WFT A;  1Q7F A;  2P16 L;  3IAX A;  4O5T A;  1BF9 A;  2XBY L;  3TGF A;  1IQF L;  5IKV A;  2IAW A;  1PJX A;  2RHP A;  3ASI A;  1N7D A;  4Y7B B;  4R40 A;  4A7I A;  1DVA L;  1CQ1 A;  1I0U A;  2J94 B;  1HT8 A;  4X8S L;  3LTG D;  2WZP P;  2G00 L;  4D90 A;  4IMB A;  2IAP A;  4OTY A;  2P3U A;  1G2L B;  3S2K A;  2P3F N;  1N1I A;  1XDT R;  1FSB A;  3N8W A;  4GNB A;  3KQE L;  1HZ8 A;  1NFW B;  4ZXX L;  2VWO L;  1TLE A;  4JZF L;  1IQE L;  2MHP A;  2IAO A;  4HHQ A;  4X8U L;  4AQT A;  4ZXY L;  4YT7 L;  2WYJ B;  4CSY A;  2I9A A;  2ISM A;  5FDQ A;  5EGM B;  4GN8 A;  5L30 L;  3KQB L;  3KQC L;  1IGZ A;  1G2M B;  1IQI L;  2M74 A;  1V04 A;  3KCG L;  2VVC K;  1X7A L;  3CA7 A;  3FBY A;  1Q4G A;  3DR2 A;  5GTQ A;  1PRH A;  2W2N E;  2P93 L;  3U7U G;  5D9B A;  1YUF A;  2Y7X B;  3N8W B;  1C9U A;  2W8B A;  2NPR A;  3ELA L;  2EI8 B;  4COX A;  3QH0 A;  1ATB A;  2IAT A;  5IKR A;  1FFM A;  2YGQ A;  4G1M B;  4ZHA B;  3O4P A;  3TBD A;  1C5K A;  2BOU A;  1ZAQ A;  3BPS E;  1CQE A;  4BTT A;  4X8T L;  3G4H A;  1PFX L;  1W7X L;  2VAQ A;  3KRK A;  4RUT A;  5IKT A;  1PGE A;  5F19 A;  5D9C A;  4GN7 A;  2BQ6 A;  5JVZ A;  2W8B B;  3LN0 A;  2Y5H L;  1G1T A;  1V3X B;  4RRW A;  3V65 B;  1FF7 A;  4A0P A;  1RFN B;  2AYL A;  2J95 B;  2FLB L;  4BXW A;  2PUQ L;  1TOZ A;  1UZP A;  3Q3K B;  3KYA A;  2FP9 A;  4E1G A;  4GNA A;  4XBM A;  4JYV L;  4NG9 L;  2YGP A;  2FLG A;  3SRG A;  2K2T A;  5COX A;  3POY A;  2Y7Z B;  1QFK L;  5JB8 E;  4NA9 L;  5GX1 A;  1ADX A;  1WHE A;  1KIG L;  1DQB A;  1CCF A;  3F6U L;  3LTF B;  1KLJ L;  1J9C L;  2XBV L;  5GX2 A;  2RNL A;  4LOR A;  5CKM A;  2BOK L;  1G1R A;  2GVW A;  3N8V A;  2OYE P;  3SW2 A;  3HRP A;  5D9D A;  3AMR A;  4BTI A;  4C16 A;  1NFY B;  3HS5 A;  4LMF A;  2P3T A;  3G4E A;  2EI6 B;  4MMX B;  1EQH A;  1H6L A;  1HJ7 A;  5EX7 A;  1IQK L;  3QMO A;  1E1A A;  1YO8 A;  2W86 A;  1F7M A;  3GCX E;  2J34 B;  3KQD L;  1FAK L;  1DIY A;  2KV4 A;  4TGF A;  2G8S A;  1HX2 A;  4BXS A;  3RR3 A;  2VWL L;  1CRU A;  1W8B L;  3WWA A;  2WPH E;  2POO A;  3BT2 A;  2BQ7 A;  1POO A;  1MOX C;  1HRF A;  2VWM K;  2IAR A;  2FZZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...