3TBDA

Crystal structure of domain vi and le1 of human netrin-g2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
331
Chain Sequence
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin-G2
publication title Crystal structure of the ligand binding domain of netrin g2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 81
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00053 Laminin_EGF Laminin EGF domain
A PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3tbdA01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3tbdA02
2Y5GL 2UWOB 3EGFA 1CCFA 5JBAE 3FBYA 5L2ZL 3U7UG 1F7EA 2VH6B 2B7DL 4NA9L 4E1GA 5CISA 3LTGD 4XLWA 1PRHA 1IOEL 3NJPC 4BXWA 1WHFA 4RRZA 2RA0L 3HO5A 4URTA 3GCXE 1PGEA 1Z6EL 2J4IB 1Z6CA 2RNLA 3OLTA 2Y81B 5KIRA 4G1MB 3KQDL 1HREA 1EAIC 2Y7XB 2F9BL 1HAFA 3M36L 4AQTA 2PR3B 2WPJE 3DEMA 2RHPA 3LC5B 2EI8B 3LAQA 2KV4A 3ZYIB 2D1JB 3KRKA 1UZJA 1HT8A 3CA7A 3KQBL 4Z0KB 3MDLA 2BZ6L 2P93L 3MQEA 1M1XB 2WPIE 3QH0A 1IVOC 1ZAQA 2BOUA 4BDXA 4AQSA 2OYUP 3TK6B 1CVWL 1B9WA 1DDXA 1EQHA 5JB8E 4OTYA 5JVZA 1IQEL 4XL1A 1YUKB 2W2NE 1WHEA 1TLEA 5COXA 2KB9A 4CUFA 4BTTA 3HO4A 1X7AL 3GISX 4Y71B 1CX2A 2WPLE 1U8CB 1JBUL 3NT1A 4XBMA 4MMZB 1OB1C 3ENSA 5IKTA 4X8TL 4D0EA 3V65B 2GD4A 4O1ZA 2W86A 4PLNA 3TZIA 4X8UL 1DIYA 1U67A 2I9AA 2PHBB 4TGFA 3KQCL 2UWPB 2XBVL 1FAXL 1EQGA 2I9BA 2VWMK 4C16A 5JBBE 1NPEB 3TK5B 1CQEA 1RFNB 1IP0A 1HCGB 3KQEL 2FLBL 1IQKL 2FLRL 2P95L 3ASIA 4D0FA 3LN1A 1V3XB 3CFWA 1EPHA 2P3TA 4ZAEB 4OVEA 2VWOL 2P28B 4Z0LA 1HAEA 2XC0L 3LTFB 1MQ6L 3OLUA 2NPRA 1G2MB 1KLOA 3TH3L 2BQ6A 4MMYB 4RRYA 2W3IB 1YUFA 3F1SB 2VVCK 1IQIL 1KLJL 1NFWB 1MOXC 2WPKE 5JW1A 2EI7B 1YO8A 4ZXXL 2EI6B 4Z6AL 5IKVA 4ISHL 3TGFA 4LMFA 3HO3A 1COUA 1L5GB 1FE2A 2BQ7A 1LPKA 3LIWB 2JKHL 2W26B 2BO2A 3Q3KB 3GCWE 1CCVA 1IGXA 3FCSB 4JYVL 2P3FL 3F6UL 1JL9A 2J34B 1XKBA 3PGHA 4JZFL 4M10A 3RR3A 2J94B 1PXXA 3N8XA 1W7XL 3BT1A 1C5MF 1EBVA 2MHPA 2WYJB 1IGZA 1G1QA 2BOKL 2WFTA 4Y76B 4ZHAB 1DVAL 2W2OE 1ADXA 5K0HB 1HJ7A 3QMOA 2Y5FL 1ATDA 4O02B 3BPSE 5F1AA 2J95B 2TGFA 1ATBA 1K36A 4LORA 1NQLB 3Q7DA 1SZBA 2MGPA 4BDWA 1I0UA 4JZEL 1HZ8A 2WG4B 2XBXL 2XC5L 1YGCL 4CUEA 4X8VL 5I46L 1Q4GA 2BQWA 5JBCE 1QFKL 1K37A 2WPHE 1PFXL 4A7IA 1YUGA 1IQNL 1GK5A 5JVYA 1APOA 3ZYGA 3U73A 4YZUB 2AYLA 2H9EL 2MGRA 2VH0B 4BTUA 1F7MA 3HPTA 3IJEB 2Y7ZB 3POYA 5IKRA 3CS7L 4BTIA 1XKAL 3SW2A 2Q1JB 2VVVL 2P3FN 2Y5HL 4PLOA 5L30L 1G1TA 2BOHA 1IQHL 1IQJL 5CKNA 4ZH8B 4YT7L 3HS5A 3HS7A 4D90A 1IJQA 1MQ5L 1NFUB 2W3KB 1LMJA 3ELAL 2K2TA 2Y38A 4PLMA 1EPIA 1EGFA 1LPGA 2J2UB 5FDQA 2P94L 1LQDA 1N7DA 2BMGA 1APQA 1FAKL 2UWLB 3NTGA 3SOBB 1EMOA 2M74A 3KL6B 4Y7AB 1DX5I 2FD6A 1P9JA 2Y82B 4JZDL 2J38B 1G1SA 2Y80B 1F0RB 3SOQA 1ATEA 1EZQB 1BF9A 1IQML 2YGPA 1G1RA 1IQFL 2VVUL 1J9CL 2YGOA 2FZZL 3P5BL 1URKA 1IOXA 5CKQA 2FLGA 4BXSA 2P16L 1IQGL 1O5DL 4ISIL 1UZPA 2K2SB 5E8DA 3BT2A 1EMNA 2W2PE 2DDUA 1P0SL 1UZQA 1KLIL 1CVUA 2VWLL 1HRFA 2P3UA 4NGAL 1L3YA 1AUTL 4RRWA 5KN5C 1TPGA 1UZKA 2OYEP 3C9AC 2W2QE 6COXA 1TOZA 2CJIB 3KCGL 5CKMA 1ATAA 1FF7A 3K9XA 4RS0A 1EPGA 1KSNB 3N8WA 5JB9E 3H5CB 2W2ME 1WU1B 3N8VA 2WYGB 1HT5A 1N1IA 3M37L 3NTBA 1JV2B 3N8WB 1EPJA 5EGMB 1A3PA 4OTJA 4CSYA 1DQBA 1IQLL 2VWNL 2VJ3A 1LPZA 2XBWL 4COXA 3SOVA 3CENL 4FM5A 2PUQL 3FFGL 2BOXA 5IKQA 3N8YA 2WG3C 4ZXYL 3HS6A 1FFMA 3N8ZA 3N8YB 3IITB 1HX2A 1NZIA 4RUTA 1PTHA 3R05A 1KIGL 2P26A 5F19A 1FJSL 4RRXA 1XFEA 4YT6L 3V64C 2WPME 1XDTR 4JYUL 1G2LB 3LN0A 1NFYB 4Y79B 4CUDA 4NG9L 2XC4L 3KK6A 4Y7BB 1NT0A 4MMXB 4X8SL 1FSBA 4Y6DB 1CEJA 3QCWA 3LC3B 3TBDA 2XBYL 2KL7A 2G00L 4M11A 4PH9A 1NFXB 1F0SB 1W8BL 3ZYJB 2WFXB 5L2YL 2ADXA
chains in the Genus database with same CATH superfamily
5FZFA 1XNBA 4YW3A 4E4SA 3FZ3A 4CU6A 4BISA 5C9AB 3HMYA 3FBYA 4GWJA 4YZ5A 4RFRB 1MQTB 1ZBA3 4YGBA 4Y24A 5C3OA 4D94A 3ZYHA 4NA9L 5C3SA 2EIBA 2IVIB 3LEIA 4LITA 1O7FA 2VCMA 2DCKA 3AZWA 4R9AA 4YG0A 3I3BA 5F9TA 2D43A 1IOEL 4Q4X2 5BNNA 2WL1A 2PHUA 1I1EA 1FPN2 4LIVA 5DAXA 3I3DA 3USUB 5I0RA 1XPWA 2BOJA 1LOEA 4G9SB 4RRZA 1TZOA 2WO1A 4FTSA 1HW5A 3ILRA 5JDBA 5JMCA 1OFSA 3I4IA 2EICA 2ADEA 1PGEA 4AI2A 1OH3A 3DN7A 3I2FA 3Q8BA 2A6YA 4KWUA 1HRI2 1JW6A 2CGOA 1UY3A 1UZYA 4QKDA 2RNLA 4MADA 5ERLA 2R0FA 4YVWC 5LA9A 1XXNA 1PGL2 2FMYA 4OI4A 3S7EA 4BIFA 2CWMA 2BGOA 2HWC2 3O1MA 3N9LA 3UJOA 1URXA 4FOYA 1OA4A 4JHTA 2XMLA 1SCSA 1VPHA 5T50A 3N9NA 3O0VA 4A4AA 1O4ZA 2O8OA 4ZY9A 5FMCA 4QGMA 2QTWB 4BXFA 5T52A 4P08A 3C7HA 4AG4A 4MGIE 1OLMA 1UIKA 1H1IA 2CY6A 3QH6A 2DCTA 1XE7A 2XVGA 3M36L 3SNMA 3V0BB 4AQTA 1GNZA 4COZA 4FPLA 3AMQA 2PR3B 4KNCA 5D8AC 3POGA 1VBD1 2X5IC 3LC5B 5C71A 2KV4A 3ZYIB 4Y1YA 5H9QA 3NAPA 4QPYA 4OYUA 1KFXL 2R7EB 2VY0A 2X5IA 1FAYA 3UJQA 4GKYA 3N9MA 3N9OA 4JRAA 5CFCC 1F4HA 4R4XA 3D0JA 4NROA 2A3XA 2WNVC 3MF6A 3MW3A 2HWF1 2BZ6L 1W6QB 3PIGA 3QH0A 1CAUA 1ZAQA 2BOUA 1BZWA 4BDXA 4AQSA 2OYUP 2Q5TA 1PO12 4B8EA 3AYDA 4ASKA 1WMEA 4Z2WA 1KD7A 1DDXA 1EQHA 5F6KA 1XJAA 3W59A 3LWCA 4LUKA 2ORZA 4D3WA 1Q8QA 2WQ4A 1IS6A 2BBVA 5COXA 3RRDA 4DPNA 3K48A 2WS93 1XSQA 3RZZA 4GWNA 4RS5A 5LATA 1XNTA 1QHDA 1W2NA 4CP1A 4BTTA 2P3YA 1X7AL 4HG6B 3CL1A 1K12A 1G9FA 3ALQA 4UXAA 5LZ6A 2R6QA 3AK0A 2WFF2 4Q8KA 2B9UA 3RQ0A 3QACA 3UT0A 2HLEA 4YZ1A 1JBUL 3EYPA 5FQ0B 4UFIA 1YCIA 1OB1C 1LGCA 2PN5A 4XFBA 5LRRA 4Y5TA 4X8TL 4D0EA 3CU7A 1QDOA 5FWJA 4Y4YA 3NKGA 3ZYRA 3CJIB 2W86A 4PLNA 1TME3 4ISRA 3TZIA 4XUOA 3RSJA 4X8UL 1PK6B 3VD4A 3UNPA 3V64A 3K3OA 1VP6A 2PHBB 4XDQA 3R0RA 1N1SA 1MZEA 1VBA1 1SDWA 4NPMA 4YVSA 5EFUA 5A7OA 2E6VA 2JG9B 3RNSA 2I07B 3CO2A 3GYDA 1HRV1 2EIGA 3GGLA 3ORJA 5JBBE 3E5UA 3N4MA 1SLLA 2VZSA 1XYPA 1RFNB 1RHI3 5IK7A 1RIRA 1KDKA 3KQEL 3FHIB 2FLBL 1WLTA 2IWGB 3OGGA 1YQCA 4AHWA 4GH4A 2NPIA 1UN1A 2VBBA 5KHGA 2P95L 2FLRL 3ASIA 5A32A 1W8ZA 5ISLA 1U5ZA 4XF3A 3A4UA 3K3NA 2WWUA 3O1UA 2KD7A 3LN1A 2IXJA 3KWVA 3NL1A 4GB33 1CESA 2IXHA 2DFBA 5LW9A 1OKQA 2HEVF 4Q0UA 2XJSA 3ZXFA 3ZFFB 4NPLA 4GZ9A 4PT6A 1PIV1 3LTFB 1S0IA 1U0AA 1HDKA 2HWE2 2PHDA 2NPRA 1BKZA 1PVC3 2RS33 5C8CC 1Q8SA 1JZ6A 3MIEA 1GZ9A 3ZSLA 3ZMOA 3AP9A 4OHYA 2W3IB 1OD3A 1YUFA 1LOAA 3WDTA 5IATA 3F1SB 4JAAA 3BTZA 1IQIL 1QH6A 2ES3A 3I3EA 1MS5A 3I7DA 4MYEA 5FUIA 3RZLA 1QQP1 1UYZA 4PBOA 2EI7B 1L3JA 2EALA 1R1ZA 2Z69A 2VMIA 4XTMA 4NVPA 5FZDA 2EI6B 2DV9A 4N7UA 3P1IA 2VVEA 3I3MA 1JI6A 1GBGA 2VCBA 1ULCA 2DCYA 4WVMB 4Z6AL 5LEJA 1J59A 5LCWL 4LLOA 1XSRA 1CVNA 4CCOA 1RUF1 2H6CA 2BQ7A 4AI3A 3WCSA 4AVSA 1AXKA 4YYOA 1HXS2 1ULOA 4H55A 2YGMA 2C9AA 4LO6B 1ZM1A 2KXLA 2ZEYA 2R1BA 4P9WA 5AFBA 4JYVL 2HBUA 3F6UL 1JOJA 3OGJA 1QKQA 2ZA9A 2J34B 5FKCA 3RJRA 2B45X 4AZZA 2WN3A 3M3EA 1DLLA 1CJDA 2W08A 3OF1A 4JZFL 3QD6A 4H7MA 3RR3A 2J94B 5DZGA 3GJAA 4BQ3A 5IFTA 1W7XL 1C5MF 1EBVA 1O91A 4AAXA 4EZ4A 2YPDA 1AR61 1PNGA 2NP0A 2MHPA 2Z5WA 3VGIA 2IXIA 1KS4A 4JTOA 4A94C 2XBO2 3U07A 3CLPA 1ADXA 1DVAL 2W2OE 1HJ7A 3IDCB 4AHZA 1BBT2 3SH4A 3FFQA 1ATDA 3Q8CA 3ST7A 4DINB 3J7LA 2ZGLA 3IAPA 5F39A 2XJRA 1AR72 5IVCA 4E2SA 4FO9A 4HONA 4MOAA 5G05L 4XW3A 4XABA 1WA6X 3I3QA 4HETA 5D8AB 2VBPA 1O5UA 3JQXA 4GJYA 1PO21 3N3HA 2X5IB 4Q4W2 3HQRA 5DZEA 4AVBA 3AXEA 4Y4RA 1UY1A 1SZBA 4W8JA 1YFXA 1G6NA 1I0UA 4XDOA 2WG4B 2OQ6A 3ILFA 3GCXA 5CFCB 4GIQA 2VZUA 1CAUB 1I5PA 2LS6A 2WLQA 2PLV1 3VBRC 2WNVB 4YFWA 5FBZA 2PQQA 3B9IA 4Y33A 2JECA 2KR2A 2FZ1A 1UU5A 4F3JA 1H0BA 2W1UA 2BSFA 2VNVA 5IW0A 1WBFA 3GBFA 2ARBA 4L2NA 1PFXL 2R062 5CAZA 1C5HA 1MEC1 4FOVA 1F2NA 1D4M1 2BW8A 2DTWA 1Q56A 1JU3A 2HWB3 4J1XA 4A7IA 4XXPA 3UGGA 3VDCA 3WHTA 4CDQC 4OLLA 1JZ2A 1UOBA 2B4KA 3NQHA 3EQEA 1GK5A 4CDQA 1VIWB 2RG4A 3U73A 1P8JA 3ACGA 4YZUB 3HNMA 2AC1A 1N3OA 1W9TA 2D40A 5HCHA 3DXTA 4TN7A 4GU3A 4K8RB 4LK6A 4QM8A 5KR7A 1X33A 1QJY1 1KRIA 4NAOA 5I0DA 3HNYM 2F4PA 5BNOC 2ARXA 2Y7ZB 1VBB1 4HPKA 5IKRA 4LJHA 5F5AA 4N9IA 2XBO3 4AQ6A 4Y1ZA 2D6PA 3VBFC 4OUEA 3ZSEA 5J98B 2VVVL 5J7MA 2Y5HL 4XQ4A 4PIZA 4RN5A 4IE5A 4FQ4A 1W8WA 1MVEA 1T6GC 4KQ7A 4IEVA 1GU3A 4LE4A 2R071 3HS7A 4YVSB 5E1RA 5FIXA 1LMJA 4FOWA 4IGQA 4MXVA 4HN0A 3THCA 1AR83 4DXTA 1E5RA 1REEA 3FJSA 4PLMA 4Y22A 1YC61 4XCAA 5T5LA 2ARCA 1VMJA 1R091 2W95A 3MPBA 4JTNA 5FZGA 4BQ5A 5LK7B 2IZWA 3GNEA 4ZS3A 1LQDA 1ODNA 2BMGA 5GLVA 2YC4A 1APQA 1RITA 5A32B 4B1LA 2VAUA 3NTGA 3KF3A 3C2UA 4RQPC 4EN6B 4XFIA 5IVEA 2A3YA 1S0BA 3OOXA 4CA9A 1NAEA 5AFEA 3ZYBA 1W0NA 1EUUA 2PTMA 1RUG1 3H3ZA 3NWKA 1AX2A 4RQPA 4FPGA 3D82A 4TYSA 2HH9A 3M3QA 5DAVA 4A7KA 4Z1VA 1W6PA 4Y7AB 2B7YA 1NCRA 2B5HA 1FMD1 2VUAA 3NV2A 4Q26A 2JIGA 1BVVA 1AX0A 2Y82B 1U12A 4QQPA 3I2GA 2OA2A 3VV1A 2XH6A 4GMP0 2P6CA 1WCSA 5ACA3 1G7YA 1RMU3 2BQPA 4YG6A 3VL8A 5C8CB 1CGPA 2Y33A 3BCWA 4N90A 1H2KA 4XUPA 4KU7A 1JZ7A 3VD3A 4AFMA 1PZ7A 3N36A 3OGSA 1VALA 2Q1MA 3LZZA 3HBKA 3ILNA 4A3XA 5HBAA 2VQTA 1TMF3 3VHNA 2O0OA 4IETA 5GZCA 3P5BL 3B3QE 1JBCA 2X09A 2RM21 4KL1A 4FT8A 5FYZA 3KLSA 1LECA 1V70A 2QBXA 4I30A 4WM7C 1X7NA 2J1VA 3OBTA 3ZXKA 1AR93 4Q2FA 5C5TA 3B02A 1OVSA 4FFIA 4JVAA 1W2AX 5FY5A 1VAMA 4E8DA 3F2ZA 1LCLA 1MVQA 1OH4A 2WSUA 3APBA 3I2KA 4JX0A 3VKLA 1VBC1 1RUJ3 3AL6A 4UF0A 4QKFA 1QY4A 3ZFEC 1VBE1 3KV9A 5IHRA 4MG2A 1EMNA 4XJAA 3POJA 4HXCA 2QQNA 5FPUA 2V72A 3DV8A 1GWKA 3LE0A 3VZLA 3B01A 1NXMA 1UYYA 1ENXA 2RMU1 4LBLA 5FUPA 4CDUA 1KLIL 1CVUA 4ZZ8A 4TWTA 2RS53 1NCQC 1J84A 1A34A 3LD8A 2P3UA 1VB4A 4NO4A 1W6MB 5BPXA 1AUTL 3H7JA 1NCQA 2PAEA 3GBWA 4GA9A 4W6WA 1UZKA 2VW0A 1FV3A 5FPZA 2MHFA 3RG0A 2OYEP 2GN7A 3WCRA 4CXYA 1POV1 5TSWA 3O1VA 1O3QA 2QQWA 2CYFA 1DYKA 2W2QE 4IL7A 1RUH3 4YRDA 4LO4B 5FK8A 3KCGL 2RJLA 1RUD1 3WY6A 3LSEA 3U0ZA 2E51A 1O3SA 1RUI1 1FF7A 1AVBA 1ND3C 3AKSA 4WVZA 3ZPYA 3E5QA 4NMIA 4YM0A 3K9XA 5F2WA 3WW4A 3WXPA 4RS0A 4XJ9A 4FAHA 5ABJC 4QPGC 1KSNB 5JB9E 4IGOA 3KD4A 4C1WA 1JZ4A 3U75A 2JDKA 2HJIA 3H5CB 2P6HA 1VBD2 3SH5A 4PF5A 2W91A 2Z79A 3T0BA 1QXJA 1FX5A 3I54A 1C4RA 1REDA 2J1TA 3K4AA 3KQRA 2BP6A 4QX8A 4ES9A 3IDAA 2CGPA 5FDBA 4META 1Z78A 3W20A 1DU3D 3MIGA 3N8WB 1A3PA 1WCUA 3VKOA 4HSJA 3ZIXA 3EB7A 3H7YA 3CDZB 1KS5A 1RUE1 4QKNA 2HWF2 1QOTA 3U11A 4UOJA 5A1AA 3GCWA 1NQDA 1KFUL 4G3YC 5J09A 2JG8C 4ZXEA 3ZIWA 4TZDA 4QQLA 5FMOL 4CVUA 1LPZA 1GWMA 1N3QA 2ZGQA 3T0DA 2BRTA 4DXZA 2JG8A 3C3VA 3TWIA 5EYXA 4LBOA 3CZJA 4Q4Y3 4QHOA 5EQUA 3BU7A 5DXDA 5EWSA 2VTXA 2RS11 2P3JA 5IKQA 5LY2A 3C7GA 3H8UA 5APAA 1D2SA 2WG3C 4ZXYL 4AE2A 5FYTA 5KXDA 2GSYA 1J1LA 1C8NA 2WT2A 3IZOA 5DUWA 5FJKA 4CEYC 3LEGA 4CDQB 1RUOA 5CADA 3OPWA 2VCCA 5JXGA 2FBEA 1XE8A 2SBAA 4CEYA 3BOPA 3IITB 3V65A 1HX2A 3LPGA 3BPSA 3ENRA 4XTPA 4YG3A 4AEJA 1EAH3 5AC91 1JYNA 1QIUA 1QNYA 4HPKB 3ZM8A 1H6YA 3K4ZA 2YY1A 4XMIA 5DG1A 2P26A 1W9WA 3WDXA 2GH2A 4WZFA 1FJSL 4RRXA 3SXWA 1DQ2A 3B69A 4XPVA 2W92A 4M00A 4CCJA 2BPA2 3NNMA 2WZ8A 5EYYA 4M0NA 5FZ9A 3KS7A 3DL3A 3WQ0A 1D0GA 4AQ2A 1VBA2 2E53A 3IMMA 4FTBA 1S1AA 2AYHA 2D3SA 5CNAA 4CPBA 2Q8EA 3I2IA 4UWDA 1NFYB 4BK4A 2RR13 2JIJA 1HRV2 1MR5A 1ODMA 1VAKA 4Y22B 4B29A 2ZGUA 1DGWX 1SDDB 2NMOA 3SEEA 4MH0E 5DZFA 4QX3A 4CUDA 5A3PA 4NG9L 2WINB 3KK6A 4Y7BB 1NT0A 1H6XA 3WR0A 1CEJA 3H42B 4AGRA 1W03A 1GQGA 3PU3A 4QT6A 5L9RA 1V6OA 1W04A 3TBDA 3N7LA 1GQHA 1AYN3 1T6BX 3M3OA 3UKNA 1US2A 1MPXA 4RQPB 3UESA 1F15A 1NFXB 4IV3C 4KGQA 4KMQA 1CX4A 4XXAA 5E88A 5FV3A 4JCKA 1W6PB 1NCRB 3B7MA 2VZRA 2GNMA 4LKEA 4IV3A 3IBMA 2YG0A 3MLJA 1JUIA 4P9GA 1MQTA 1AJKA 4CTEA 1PIV2 1ALYA 2VUDA 4TTGA 1PZ9A 2B8MA 1H8TC 2Y5GL 1SEFA 3KQ4B 5HCFA 3N35A 3EGFA 2WAAA 4K8FA 4BWOA 2Y6KA 3EHKA 5L9BA 1CCFA 4IEQA 3NW4A 1H8TA 1YQ5A 4EWAA 3B5LB 3CEWA 4K7JA 2VH6B 1A8DA 1RVF3 4CDXC 2HYXA 4LK7A 1QQP2 1UY0A 2WRAA 4GQ7A 2MEV1 4Q4V3 3JD71 4XFGA 4EWEA 3EXUA 5FFOC 1PRHA 5A70A 2JDMA 1JYIA 4CDXA 4OZXA 1UX6A 2JDHA 3BIWE 4BXWA 1WHFA 1GNYA 1OFNA 1R64A 2WA4A 2YBKA 4URTA 1PX3A 1W28A 3GCXE 4XDPA 3JBG1 1YFYA 3DPRC 1CZTA 3KB5A 2JDPA 5JOXA 3SQOA 2KNIA 1R1A1 1RUF2 1ZZ8A 4HOOA 3KHBA 4M3CF 2QQPA 3DPRA 3A22A 3PMSA 4RGAA 4Z2AA 3OLTA 5B4XA 5IK4A 4QX7A 4RD7A 3ZSKA 3ZFEB 4UFKA 1HV1A 1H4GA 1HREA 1LGBA 2VJXA 4CDUB 1YI7A 2XJPA 3LIGA 4HSLA 2Q4SA 2Y7XB 2WZR3 2VU9A 5M0TA 3BTAA 4V2WA 3UKVA 3BTXA 4XOGA 5KXEA 1NCQB 1KITA 2F9BL 5C70A 1YLLA 1ASJ3 3ZOIA 1AR62 2WPJE 5I8SA 2RHPA 4F7ZA 1YQ2A 2OKXA 2VOVA 2VNOA 3WG2A 5A6ZA 1NG0A 3H50A 2EI8B 1UWWA 3H1YA 5DABA 5A7PA 1QGLA 2D1JB 1DP0A 2VVDA 2JX9A 4KU8A 3VZNA 3AMMA 1UZJA 1ZA4A 1V00A 4COYA 5IVBA 2CWSA 5LB6A 3WP6A 3ZN6B 5ABJB 2ZGPA 4QPGB 3PUIA 1XB9A 3POFA 4P9LA 1PO22 1QF3A 5A3OA 1CVWL 2QQVA 3LGRA 4QWNA 1PVXA 5FRAA 3OD0A 2EXIA 4OUMA 4YGCA 5JB8E 2RVAA 2V5YA 5JIAA 5JVZA 2VZ1A 2JWPA 2PLV2 1EYBA 4OI2A 4LBKA 1VRH1 4EN0A 2G1MA 5FZ6A 1TLEA 4IQPA 2GDFA 1CJPA 2JG8B 3AVRA 4CUFA 4AHYA 5LASA 1HJGA 2WWSA 5J3UA 4TSVA 2E7QA 1W3VA 1FXZA 4ORFA 3SLIA 3O1PA 2XLFA 4B4RA 2WZPP 4W6YA 2WPLE 1MEC2 4CEWC 5KC6A 1D4M2 4QQHA 5FYYA 4YFZA 4NIDA 1LB2A 3I2OA 1U8CB 4YSFA 4EWDA 1R081 1ULGA 2HEYF 1H30A 4CEWA 5KXBA 4XACA 5IKTA 2F17A 4RR3C 4HVOA 5FY1A 4CEYB 1LTEA 2E33A 2R043 2UWAA 3V65B 4BLJA 1IHMA 1CPMA 4MZUA 3J8F3 4OQ9A 3MV01 3LA3A 2Y6JA 4RR3A 1QJY2 2P3IA 4N7IA 2YV8A 2C9KA 4YW4A 1JYWA 1DIYA 2I9AA 3OBZA 4AFBA 4TGFA 1FOD1 1VBB2 4IUGA 1DQ5A 5HCAA 2YROA 4GMP1 2UWPB 1W2TA 1NA1C 2XBVL 1PMHX 3FLTA 3B00A 4XAEA 1IS4A 1FAXL 1EQGA 2WAOA 1OT5A 4C16A 2F6BA 3AKTA 2JKBA 2J22A 1QH7A 1LK9A 1AZDA 1IP0A 3PTYA 3WEZA 1HCGB 2R072 2WC2A 2WABA 3BALA 2ZKLA 4ZU7A 5DAPA 1IS5A 2CV6A 3V0AA 1W0PA 5E89A 3VN4A 1UNBA 5CFDC 3AZZA 3IN9A 1Q5OA 5F8PA 2YFUA 4D0FA 3FX3A 3CFWA 1XNDA 3MW4A 3PJQA 4ES8A 3WNXA 1SCRA 5CFDA 5GLUA 3PVEA 3U78A 1BVP1 3ZN4A 4IE7A 5GZDA 4ZPIA 4Q8LA 2QKDA 2ZEXA 1Q3EA 2A71A 4P9JA 2P28B 4Z0LA 1U5YA 3HT1A 3CNAA 2D6LX 1E5SA 4N43C 4QXHA 4PIXA 1RUG2 5FP9A 3RMYA 1K42A 1LHOA 3HR9A 2YBSA 3BN6A 2BQ6A 3VD9A 5ANQA 1FMD2 4MMYB 1KEXA 1JN2P 3A0KA 4IEXA 2H6BA 4IV3B 3NSTA 2RDSA 2C24A 5FP7A 3WDWA 1E5IA 1W9SA 4A42A 3M4FA 1QJZA 1VAVA 2ZGKA 2GNBA 3EBRA 5F5QA 3THDA 4V2VA 1COV3 4WVMA 2WPKE 3RS6A 4QAWA 5FY8A 2I2SA 3WQ1A 3O1OA 1H8TB 1YO8A 1AYM1 1SBEA 2YZ4A 3QH7A 5LBCA 4EN9B 2A6XA 3I49A 2ZGTA 4CCDA 5A3LA 3S5QA 4LPLA 3MICA 4BIOA 5C4WC 1VBB3 1PMIA 4KWLA 4ISHL 1TG7A 2MPFA 2VZTA 2BBAA 2VZQA 1OPMA 3KM5A 3E5XA 3OBRA 5FZ4A 2OIIA 3HBZA 1V6JA 3HT2A 1FE2A 4YM3A 1QJX1 1W6NA 5C4WA 2RM22 2Z42A 1LPKA 3M70A 1Y43B 3Q3KB 3CZUA 1FATA 4WVVA 3GCWE 2XKOA 4I0AA 4UAPA 3UETA 1C8M3 2ZZQA 4YVWA 1OA3A 3LDKA 2P3FL 4NHMA 2ZJCA 4H3WA 4QB2A 1V6KA 1LOFC 1VBC2 1EUTA 3ZFGC 3DPRB 3LIHA 5FP8A 4DUXA 1VBE2 1LHWA 1OF3A 3PGHA 1QJU1 2QDRA 4MGQA 1UOFA 2J1RA 3P5BA 1D0HA 2BERA 2IFRA 3ZFGA 5C3RA 2W46A 5I0UA 2RMU2 3J7NA 4BM8A 3L2HA 4FFFA 3LB9A 1VLNA 2EAAA 1IGZA 2YMZA 2ERFA 2BOKL 1NYWA 1X50A 3AFGA 2PHFA 3LA7A 4Y76B 5D8AA 4HANA 4I01A 5K0HB 4NHXA 4DEVA 2BOIA 1NUKA 1ZBE1 2YFZA 3VL9A 4TLFA 3BPSE 3BOWA 2X8KA 2KA3A 1C5IA 3WW2A 4AI9A 2JDAA 1RTVA 1RUD2 4FPCA 1RUI2 5CFCA 3DF0A 2IFWA 2WNVA 1FT9A 5IK8A 4Q4X3 4ZU4A 2ZHKA 4UBGA 1FPN3 4CUCA 1LEDA 1RJ7A 4D6SA 1O5LA 1UKRA 1DFQA 1XNCA 4JZEL 2GP5A 2SLIA 2Q1ZB 4XBQA 2XC5L 2VMFA 1AXZA 1WW6A 2DFCA 2VMDA 4NRPA 1POV0 4FP3A 1O4YA 1LENA 1OLQA 5I46L 3PDQA 1MZ6A 4I0BA 3RFRA 1HRI3 2BQWA 1I5ZA 1RUE2 1OQ1A 1APNA 3S6XA 1GOGA 4UFJA 1JZ3A 4AI1A 3A7QA 3C7FA 2JDYA 3MZHA 2HWC3 3LKJA 1PM7A 4V1PA 4LBQA 3VZOA 1GUIA 3ETPA 4IE6A 4OCTA 1PGSA 1APOA 3CIHA 5FY0A 5A33B 3SHRA 2RS12 1ZA7A 2TUNA 2VMGA 2UYBA 4XILA 4CDXB 2ORXA 5C7GA 4XF0A 2H9EL 2MGRA 2XUMA 4CCMA 3RZJA 2CDOA 4CEWB 4A3ZA 3HPTA 2ZX0A 4QX0A 3O14A 4BTIA 1XKAL 3SW2A 2Q1JB 3ELNA 1ND2C 4LKFA 4CU9A 5T54A 2P3FN 4PLOA 2XJTA 4RR3B 1M4WA 5AC92 1JZ8A 4GXLA 1G1TA 4UBHA 2NQYA 3ZPOA 1IQJL 3U4SA 1WBLA 3LPFA 3MGUA 5C5UA 3O1SA 1NFUB 2W3KB 1V0AA 2DWRA 2HWD1 5EXOA 3OTFA 2OZJA 5JSOA 3ELAL 4DFSA 1WA4A 5JZGC 1F5JA 1EPIA 1PO13 1LPGA 4UFLA 4P9XA 4XHBA 5FWEA 4F8AA 4TXWA 1FI2A 5FDQA 3TEYA 1ENQA 1S0DA 3NNFA 1N7DA 3PU8A 4QM9A 5CZKA 1FAKL 4XBNA 5FZIA 3WNNA 1FV2A 3TNQA 2E31A 2XHKA 3V0AB 5DMYA 3SOBB 1CZSA 3RDIA 2R49A 3A21A 1V9U1 3MI8A 1OQEA 3D5OA 4NOTA 2C4XA 2LROA 1WMFA 1HQLA 2PFWA 2YU2A 3FUOA 4NRMA 3T30A 5JPNB 5CFDB 3Q8AA 3UK9A 3KL6B 3KGLA 3MUY1 1ULFA 3PJYA 1EPWA 5I0TA 2WFF3 2Z4FA 5C8CA 1LOBA 1O8SA 1ULDA 1DX5I 1WUVA 4XYXA 2FD6A 1H8VA 1MS1A 1VRBA 5IAXA 1UMIA 2OYZA 2L9LA 4JZDL 2W87A 1YJKA 1UXZA 2WNUC 4CP2A 1G1SA 3WW1A 1JH5A 1UX7A 1GKBA 4FVVA 2C5DA 4HKOA 1EZQB 1IQML 3H9AA 4R8HA 2G9ZA 2YGQA 4QHBA 4IEOA 4COVA 1UY2A 3S0MA 1U5XA 1J9CL 2YGOA 2Y0OA 1QWRA 3FHQA 4U2AA 4K6BA 1LU1A 4XAAA 1JUHA 1LESA 2WT0A 1GANA 1IOXA 4Y1XA 4AXOA 3KCCA 2ZEZA 3BUCA 2LUWA 3JQWA 1JYXA 1UYXA 5CKQA 2VOTA 2MEV2 3NNGA 2FLGA 1Q43A 3JD72 1GICA 4K9SA 4BXSA 4IDZA 4R9CA 1O5DL 3H0OA 4SBVA 2B42B 2PYTA 4ISIL 1W6NB 5FO7B 1UZPA 5C4WB 4LHNA 4GKXA 1JYVA 2E9QA 2OUHA 5F3GA 4AWDA 1W6MA 5F1RA 2DDUA 1BJQA 3UGHA 1BEV1 3JBG2 2ZS6B 4Y5Z0 4DB5A 4YVWB 1UZQA 1R1A2 2WO3A 3LF7A 3P3NA 5F5IA 3TN91 2NMNA 2DBNA 2QCSB 1HX6A 4NGAL 4XE9A 2HWE3 4MSVA 4P14A 4RRWA 4LO7A 3SC7X 1TPGA 3ZFGB 2W2IA 3TNPB 2P37A 1S0GA 5DAWA 5FXVA 3IIAA 2ARAA 4N53C 4P00B 1ZYBA 4FPOB 5DDJ1 4O9GA 4C0BA 1GMMA 3HVDA 3AX4A 3OEAA 1EV11 4NE9A 4DO0A 6COXA 4XFFA 3WW3A 3M2MA 3RZHA 5CKMA 1Z7S1 1C1FA 2W3JA 1D2QA 1F4AA 4ZZ5A 3FUQA 4KG0A 3N8WA 2VNGA 3ZDSA 5J36A 4ZXKA 1AUYA 3LEKA 1C57A 1YQ8A 2EIDA 3NO8A 4E8CA 5JSRA 2W2ME 2D7FA 4YARA 2YB7A 2BT8A 5GKAC 2Y60A 1AL21 1WU1B 3N8VA 1N3PA 3J9SA 4JGZC 4UW6A 2WYGB 1OD5A 4CDWC 1G9CA 5JR7B 1N1IA 3HN3A 3MIDA 4DNYA 3M37L 3W5NA 5T5OA 2QFEA 1JV2B 1AHSA 5EGMB 1JU4A 3VBRA 3NMBA 3KHCA 4QU2A 4XQWA 3I59B 5HCBA 3MDPA 4OTJA 4K3UA 4OHXA 4RHV1 4D7YA 3J4UH 1HXS3 2CTVA 3PHMA 4NIHA 1YQ6A 4AL9A 3SITA 1DIWA 2WKKA 4JC1A 4OFGA 4LR4A 1B35C 3I2HA 3OSDA 5FZ7A 1C28A 3BTYA 1PMJX 2PUQL 2LM3A 5FMBA 3WT3A 1YIPA 1QEXA 3FFGL 3URFA 5JAXA 1VRH2 1YIFA 5C8WA 2W47A 4BQ4A 1W8NA 4LBQB 2VNRA 2A1XA 5FP3A 3TAYA 3KMHA 4ZHNA 4IGPA 1FFMA 2DCZA 3WDVA 1QOOA 4IEPA 3N8YB 1GYKA 5BNOA 4RUTA 1UW8A 1BBT3 2Q8OA 3T4HB 1ZBA1 4OMDA 1PTHA 2TEPA 3POBA 3HN1A 1R082 1AR73 2V4VA 4QPIC 1KIGL 3BIEA 5FPXA 2W39A 2QUOA 5JUVA 5IYYA 1SG3A 2UU8A 5GLZA 3PUSA 2ET7A 1H4HA 2A6VA 3D0SA 2WPME 4Q4W3 2DCJA 3IB3A 1PGW1 4QGNA 3OCPA 2PAKA 3WP3A 3AJYA 2VG9A 2XQRA 4LQRA 2VQAA 4DUVA 1G2LB 2D6KA 1LHVA 4MV2A 4UFHA 3VBUC 4EN7B 5K7PA 1FOD2 3C7OA 2ADDA 1LGNA 2ZXQA 3PUAA 3ZR5A 3VBUA 4U36A 1VB2A 5CA6A 4QXCA 2AEZA 4M01A 4Y79B 2XGXA 2QZ2A 3ZSMA 1W06A 2ZGOA 2ATFA 1RUNA 4X8SL 4XF4A 3WZ1A 4OHVA 2R063 5FYHA 2QQIA 1OHFA 2DVGA 3T4VA 1SLAA 2VGDA 1DQ0A 2XBYL 3MO4A 4CCNA 2IXCA 2ZEWA 1HJFA 2XXZA 3OY8A 3E6DA 1ZZCA 4PH9A 1JZ5A 2AH2A 2W1WA 3HIFA 4XZPA 3KT7A 5FLHA 5F32A 5FP4A 1STMA 3ZYJB 2WFXB 2ET1A 3WF0A 4COUA 2A5ZA 2VECA 4BQYA 3S5AA 4NRQA 4OMCA 2ADXA 3ACHA 5D2AA 4ET7A 3VKMA 4YW1A 4H2AA 2XR4A 1GLHA 3ZYFA 5CG9A 2UWOB 4F83A 3WNMA 3I8TA 3NJXA 4XJWA 5FMDA 4NHYA 4BA6A 2VZOA 2HEWF 3U7UG 1HN0A 5HV4A 5C33A 4UYBA 2WNUB 2QQKA 2B7DL 2V09A 4XBLA 3HNBM 2BVVA 1RUC1 2JDNA 4M3CB 3THPA 4B4PA 4BCUA 4FTEA 1OOPC 1AJOA 2UURA 4NWWA 1ZRCA 3VBSC 4HFSA 1DQ4A 4B7KA 5JCTA 4WM7A 1AYM2 3NJPC 1DQ6A 4OQ8A 1FNZA 4NR1A 3VBOC 3E6BA 5CB7A 2Y6GA 5LEKA 1Y4WA 3O7OA 2A6ZA 2RA0L 1KXGA 3ZFEA 1D4VB 2O1QA 1ZNPA 1Z6EL 2J4IB 2WS91 3RWKX 3K77A 1QJX2 4XJUA 4URAA 4FOQA 2HYKA 2Y81B 5KIRA 1ZZ9A 1AXYA 2CAVA 2J1SA 4KWJA 4S2FA 3BPZA 3VZKA 1TNRA 2PAMA 5A1LA 2GC0A 2Y6HA 1EAIC 2XHNA 3HEIA 2YGLA 5JWPA 1I6XA 2WO7A 1GWLA 5FZMA 4HL0A 5F2SA 1QJU2 4D6QA 3PURA 2VRSA 5FZAA 1V6IA 4PJYA 3TEXA 5J37A 1TME1 1M06G 1HAFA 3AFKA 1ND3A 4UW5A 3DEMA 3ZN6A 5ABJA 4JQTA 3P6BA 4QPGA 5GJ6A 4Y20A 3SKVA 2PXJA 2HOXA 3F95A 5FYUA 3ZVXA 3JB4C 4K40A 1LMMA 4EE2A 3KRKA 1A3KA 1CPNA 1ZBE2 4QDRA 4NIAA 1HT8A 3DXUA 4I3PA 1RHI1 3CA7A 3P3PA 2X29A 1N47A 3WG3A 4XQDA 4RA0A 2WWJA 1LNSA 2ZKNA 3MQEA 1M1XB 2WPIE 1NOVA 1IVOC 2VPVA 2XB6C 4Q1PA 5T5JA 5BNPC 3VD5A 2DVBA 3LFMA 4JGZB 3TK6B 4CDWB 3VBRB 1CAVA 2IUWA 1B9WA 1ENSA 5FZEA 5BNPA 1SBDA 4GB31 4OTYA 4LA3A 2JJLA 3T1MA 3WUCA 3VBHC 4AR2A 4Z8BA 2AR6A 3CMGA 1OVPA 5A80A 1YUKB 2TBVA 2W2NE 4UW4A 1WHEA 4E27A 3DKWA 1UD1A 2KB9A 1NE4A 4YPJA 5JI9A 5KXCA 4AGVA 1PVC1 1F5FA 2RS31 4NJ4A 4MGKE 1KJLA 1S55A 3GISX 2QQOA 5I91A 5A3WA 2FDHA 1Q8OA 5EJ3A 1UPIA 1BMV1 4XETA 4MVTA 3N7JA 4XBMA 4UI9L 5LA0A 1DGRA 1WD4A 1DYPA 2ZX4A 1W2UA 2GC3A 2WQ8A 1UZVA 3ENSA 3RVHA 4QXBA 1G8WA 4MGZE 2JKXA 2ZGSA 4L8QA 2GD4A 3UGFA 5GZFA 4O1ZA 2D3PA 4NIIA 5BNOB 4CRQA 2TNFA 5IFPA 4BYYA 5K8SA 3WNPA 5FYBA 2Y6LA 3G6JB 1U67A 4LO8A 1MS3A 1VBD3 3N9QA 4JHZA 4M3CE 5KC5A 4JZRA 1NZCA 2BUKA 4QPIB 2J42A 1LEMA 5J96B 4QHZA 2H9EC 2CU5A 2OW4A 3RYRA 4DS0A 2VWMK 5I8TA 1POQA 3AYCA 3TK5B 3IDEA 4ARXA 3AJZA 4XCBA 4G4FA 1TE1B 2HWF3 3ATGA 4M4PA 4Q5OA 2HWD2 2GNDA 1YYNA 2JEMA 4KBBA 5B2GB 2R30A 3VBUB 5K9YA 3IT8A 5JVVA 3SCFA 3IWZA 1UZZA 5LBEA 5BUVA 1EPHA 1V3XB 3ACLA 4LOTA 5JOZA 1MS9A 2WSVA 5FKBA 3GJBA 3RZMA 1IPKA 5GLTA 2YXSA 2ZAAA 2OUJA 4Y1UA 2QDNA 1CR7A 1H1MA 1KGYA 1W8FA 3NJVA 4INDA 4RYDA 2R0HA 4XIKA 4DQAA 2DUQA 1V9U2 5GZGA 1HAEA 1S0EA 2ZACA 3K2OA 3OY8B 4EZHA 5FR3A 1IQAA 1MQ6L 1HKDA 4I2OA 2BU9A 2JD4A 2XJVA 1I3HA 5H9SA 1KLOA 1K45A 2DBIA 5CVRA 3TH3L 4XUNA 4L97A 5FZ8A 2V5DA 1UPSA 2R1DA 1SFPA 4ZS2A 3GDBA 3NNLA 4DY5A 4Q0QA 3BU0A 4ARYA 1ST8A 1MOXC 4BU2A 1WW5A 4AW7A 2YBPA 2I74A 2RE9A 4IW3A 2BZDA 4UT5A 2ZGMA 1UIJA 1ZZBA 2A70A 2Q0AA 1CZVA 5IAVA 4EYUA 5ANNA 1IQDC 1JHNA 2VOWA 3WDYA 1TNFA 4AEDC 5C3PA 2W0XA 4MGTA 1VBA3 3OG2A 5IKVA 3KZ4C 3TGFA 4LMFA 3HO3A 4WM7B 1L5GB 1OOPB 4LULA 4AVAA 1HRV3 1O4TA 1PNFA 2G4IA 3LIWB 3JXSA 4MLOA 2JKHL 2KM2A 1H2MA 3VBOB 4GU4A 5FO8B 4BK5A 5C3QA 1IGXA 2OPWA 2OS2A 3N7KA 2HWB1 2E7TA 3WP4A 1JL9A 4QPWA 3I97A 3PVOA 1REFA 3PVBB 3AB0A 4DMIA 2FZ2A 1DG6A 4AFDA 1PXXA 3N8XA 5KHHA 4DXRA 1BEV2 2C26A 4LBNA 1W6OA 3OGVA 3SCGA 4D7TA 1XYNA 2E32A 3RJ2X 3TN92 4BDVB 1W3XA 1G1QA 2E63A 1AX1A 4WBBA 2JXAA 5GLWA 1PIV3 4CYDA 2XBO1 1O8PA 1TQ5A 2BDRA 5FXXA 2XVLA 5FLIA 5EIYB 3QMOA 5FZOA 2Y5FL 5JMOA 4MHUA 1GZTA 1ND3B 2OVUA 1K5JA 5DDJ2 5E6HA 4D69A 1UYPA 3TEWA 5F1AA 4WV8A 2J95B 1BK1A 1EV12 1J83A 4IEUA 3WG4A 4Y20B 1ATBA 3FLRA 1K36A 1Z7S2 2CHHA 1OKOA 1NQLB 1AR81 1QQP3 2D6MA 3FHAA 1SBFA 3QLQA 5F3IA 1C3HA 2X05A 1XU1A 2FHRA 2QQJA 2ZX2A 2W5FA 4FFHA 4FPJA 4LKSA 4LEJA 5IWFA 4ATFA 4O65A 2MGPA 1RC6A 4BDWA 3LSDA 5SV8A 1CX1A 3WOGA 4PQ9A 3FE5A 1AL22 1SQ4A 1YGCL 1UU6A 4X8VL 4OHWA 3ZXEA 2AUYA 3AC0A 5FJHA 4JKKA 1CAVB 5IVYA 1VMHA 1RUF3 1Q4GA 1BK0A 1DCSA 1HIXA 2A3WA 2BFUS 5BNPB 3O1RA 1QFKL 2P3KA 1DGWA 4RHV2 5A33A 3Q8FA 2GMMA 3NNJA 1XC6A 4H7LA 1SLTA 4HZFA 4XC9A 3HD8B 4RFT0 1KJRA 4E4DX 1KDMA 3B94A 1UOJA 4A6SA 1OPOA 3VBHB 1YUGA 2QJVA 2OXBA 1NX9A 1DZTA 2XWBB 5E8AA 4AAPA 1IQNL 1FYUA 3WNKA 5JVYA 1W39A 1YUDA 4CP9A 1CAXA 1RMU1 4XEZA 5ACA1 2V73A 1W2OA 2VOXA 1JOPA 2Q30A 4YM2A 1JTZX 3FLPA 1AR63 1WMDA 4LBMA 4BTUA 1G9AA 3Q8EA 1SLCA 3W5MA 3U14A 2I45A 3CJIC 4CU8A 2VUCA 4LUMA 1G9DA 5IT6A 1XQNA 2JICA 5JXJA 1PK6C 1TMF1 2EXKA 3DYOA 3WF1A 2FDKA 2ZBJA 3WV6A 5DAQA 4E4HA 2BNNA 1ZBA2 1F9KA 3JU9A 5L30L 2WN2A 2E7AA 4OUSA 1NLQA 1IQHL 1DZQA 1K5MC 1NA1A 1YXWA 2D5FA 2JG9C 4ZH8B 5F3EA 1OXCA 3NVCA 4C91A 1AR91 1GNHA 4YLZA 5JSPA 1ULPA 5EP9A 4ASLA 5F6LB 1NLSA 1NQJA 1PO23 1PGW2 1Q8PA 4ISQA 1RUJ1 1Z0HA 1EGFA 1R092 3A0NA 3U37A 4GD4A 1YI9A 3B93A 2OZ6A 1X8MA 2NN8A 3C7EA 3CJXA 2P94L 3JZVA 4JGYC 4L11A 4LHKA 1CAWA 2QNKA 4S2HA 3WP5A 3A23A 2UWLB 2VMCA 2PLV3 5BY5A 2QVSB 2YDEA 1SLBA 4C1XA 2RS51 2AZ5A 4EQVA 1CWPA 4FP2A 3D8CA 5JOWA 5A6XA 2UY9A 3ZXLA 3RI9A 1QOSA 2P4EA 5K0UC 2IXLA 3AP7A 5FO9B 2W1QA 3OGRA 3ZYPA 2VZ3A 5HI0A 4N43A 3VDDC 4ONUA 1V1IA 1IS3A 1MEC3 4FFGA 1D4M3 3W58A 1V1HA 1RUH1 3GM8A 3MLKA 5A3TA 4LHLA 2VVFA 2XWJB 4QDQA 2QQMA 5SV5A 4L92A 2BWAA 3WF4A 4LO5B 5FREA 4L9BA 1X36A 1UXXX 2FQPA 1GOFA 2O14A 1DF0A 1V6MA 5GALA 1F0RB 1O3RA 2JE7A 5F3CA 1ATEA 2FCVA 3INAA 3J7MA 3MF9A 1BF9A 1QJY3 3SISA 2ZHNA 2YGPA 4JV4A 2Y6FA 2J1AA 2X53S 1HB3A 2XOMA 1HB4A 5I0SA 1N1TA 1QXPA 4XMAA 5JXIA 5T55A 4PI0A 3RZGA 1QJFA 2GZWA 2OX0A 2EXHA 1NY71 3MHZA 4OZOA 1F35A 1RUC2 3T1LA 5BNNC 3KGZA 3ZXAC 1VMFA 2R073 4FPHA 5DPNA 1WCQA 3V56A 3WQBA 2P16L 4AEDB 1IQGL 2WNEA 2RJKA 1TVGA 4IV1C 3GZEA 1GZWA 1QIQA 1UMZA 3BYWA 4HLTA 1V6LA 3K46A 5T5PA 4Q4Y1 2WA3A 3VKFC 1R093 3BT2A 4HN1A 4IV1A 1LOFA 2DU1A 3RYKA 2Y26A 3OYWA 3MYXA 3PIJA 3KV4A 4IEYA 4A41A 5FOJB 3R6SA 2K0GA 2WS92 3PUHA 4W4ZA 4QX2A 2VTFA 3QOPA 5HXVA 3MUZ1 3D3AA 4YZ2A 2VWLL 1GQPA 5LY1A 1HRFA 2IXKA 1IPSA 1BCXA 2D93A 3O12A 3VZJA 1WCDJ 2OQ7A 1RUG3 1RYYA 3ZXDA 2YYOA 3KV5A 2FDFA 1W6OB 3POWA 1E5HA 4JRLA 1EAH1 1Y9GA 1YNAA 1LOCA 5IVFA 5FYIA 1FMD3 3C9AC 5FCCA 1OUSA 2VD7A 1TOZA 2CJIB 2O8QA 5DUUA 4X6QB 1ATAA 2DUOA 3IDBB 3RYPA 5L7OC 2D44A 3MV11 5FZOB 1TME2 3DECA 1CIYA 2FCTA 5FPBA 4HKLA 5E16A 2VR4A 1QXRA 5L7OA 3MIBA 3NKTA 4LT5A 3B9CA 3I59A 3NAPC 1JXNA 3AL5A 3LDRA 4CUGA 3HQUA 3SH3A 4K1ZA 3ES4A 3NV1A 1RXFA 3E1F1 2RR11 5FAXA 1HT5A 1DYOA 1XBFA 3EJKA 2JDZA 3NV3A 3W9AA 2XKPA 3NTBA 1UQXA 2AREA 4YW6A 1EPJA 2JJ6A 3DCQA 1RHI2 4YM1A 3AYAA 3O5SA 2K46A 4W50A 2VC9A 2DTYA 2RM23 3MBWA 3WINE 5LRSA 4DEQA 2GU9A 1RUC3 3RZKA 2EA7A 3VDBA 4CZSA 1IQLL 1G9BA 4IERA 4LBJA 2VWNL 2VJ3A 5AVPA 2VQ0A 1AYN1 4COWA 4COXA 2NYYA 5FUNA 2BV4A 2VL4A 1IZ3A 1VBC3 1WW4A 3CENL 1G86A 1NXD1 1VBE3 4GB32 2D97A 4FM5A 4LA2A 4LE3A 2J1UA 4RS5C 3N8YA 3WHUA 2Q1FA 4AI8A 2RMU3 3PLQA 3N9PA 3AZVA 4A45A 2DU0A 3HQXA 2HKXA 1KQRA 4CP9B 3HS6A 1E57A 1PVC2 2RS32 1CAXB 3KT1A 3ZX7A 2ETEA 4CCCA 4D8MA 3MLLA 1IG0A 2NLRA 5BV6A 3ZR6A 1GOHA 1DLCA 3BGAA 1NZIA 3C8XA 1BLZA 5K4LA 2XQXA 3ETQA 5J1XA 5BNQA 2CSGA 1BMV2 3IAQA 4DXSA 2LALA 2VZPA 1POV3 1ND2A 1UAIA 1RVF1 2ZAHA 3R05A 4QB6A 5FZ3A 2FD8A 4N9HA 3GHNA 3AVSA 5DUXA 4Q4V1 1AF9A 1RUD3 2DVDA 4KG8A 2B9VA 4QD2A 3VBFA 1RUI3 5KHKA 5KWRA 1XFEA 3V64C 1O3TA 1YRZA 2PHRA 4YVSC 2VQUA 3S30A 5JLVA 1NA1B 5JZGA 1BHGA 4AFAA 5IVJA 1L7RA 2VOKA 2VM9A 4S2DA 5CIRA 5G04L 4CE8A 2C1FA 2DURA 1ONAA 3I2JA 3K4DA 1LULA 1K5MB 4PBPA 3ZKYA 1FNYA 4NHLA 5H9PA 4DIQA 3UL2A 3ITQA 3G7DA 4GH4C 1ACCA 3OPTA 5LK5A 5A1FA 4YW7A 2K9ZA 1RUE3 4MHRA 1CAWB 2XC4L 2WQZC 5KHJA 1FSBA 4P02B 1O59A 3IIIA 4BXSV 4JGYB 4E4ZA 3QCWA 4ASMB 2A75A 3KVBA 3VB9A 2WZR1 1YJLA 2KL7A 2G00L 4FQZA 1UOGA 4JKLA 2ZX1A 3LAGA 4YW5A 3GALA 3WUDA 4HKWA 1F0SB 4QB1A 1ASJ1 4N43B 4BJ0A 5K0UB 1ZZ7A 2RS13 1DGRN 4YW2A 3O1TA 3X29B 3AKRA 2WNUA 4BQ1A 3VDDB 4RGKA 4MGSA 1GZCA 4M3CA 3MIFA 2VW2A 1W9FA 3M3CA 3USSA 5JBAE 1NKGA 2EXJA 4PDWC 3VKNA 5L2ZL 1PHMA 2ZMLA 3AP6A 5FPAA 1F7EA 2BWCA 5AC93 3RI8A 4E1GA 4P9YA 5CISA 1LRHA 3LTGD 1X9PA 4PDWA 5AVAA 1OQDA 5FYMA 4PCRA 4XLWA 2FCUA 1Y9QA 4CPBD 1ZX5A 5A7SA 1QU0A 2JDUA 1BQPA 2Y64A 1WZXA 2FDJA 2VE1A 1ZRRA 3H1WA 2EIEA 1IGOA 5BYNA 3HO5A 3T2OA 1A6CA 2ZMKA 2E26A 2GMPA 2AGSA 3M7AA 2YUEA 2D5HA 2IC1A 5BNNB 2ZPXA 1GZWB 2JB8A 3Q9OA 3VLBB 1OI6A 4D7SA 1Z6CA 2XJUA 3H3LA 1PX4A 4FI9A 1I9RA 4IV1B 1VJ2A 1GP6A 3R4UA 3L9JT 4HBNA 4G1MB 3KQDL 3H1MA 3OYWB 4IEZA 1LR5A 2QQUA 2HWB2 3I2DA 4N8MA 2H0BA 2XPJA 3KT4A 4B3NA 3CF6E 5FPVA 4YZ4A 3DKQA 4N53A 3WVJA 2VMEA 2N7GA 4PIYA 2R041 4B4QA 3MFAA 3J8F1 3MIHA 4BPZA 1HQWA 5DUVA 5A3MA 1IKPA 1OURA 5CBLA 1WCKA 1IOAA 1ULEA 1YFUA 3ABZA 2ZHLA 5B4NA 2CNAA 1DDLA 1UU4A 2F4LA 3LAQA 2AENA 1HB1A 4IESA 2B46X 4UW3A 4BQWA 1OLRA 2BNOA 3ACFA 4JGZA 4CDWA 1RINA 2BGCA 3LQCA 1IKQA 5L7OB 2EF6A 3KQBL 2PA7A 5FBJA 5FZCA 2ZGNA 4Z0KB 1SHWB 5JI7A 1OUXA 3MDLA 1XE0A 2P93L 1YWKA 5DG2A 1WWYA 4C90A 5I93A 4XFAA 1AR82 5JPMB 3NAPB 2MEV3 3JD73 3R4SA 1U5IA 3IMNA 4PF1A 4KH9A 4Q27A 2X10A 1ZVFA 3AMNA 3PVNA 4O7XA 3MPPG 4MUVA 4DZGA 1J3PA 1IQEL 4L0PA 4XL1A 3RMXA 2WUHA 4AYUA 1B35A 1MZ5A 3JBG3 2GH8A 1J1TA 2IVJA 4FAGA 5FY9A 3HJRA 1R1A3 4AFCA 5D21A 3CKHA 2BT7A 3ZSJA 3KVAA 3HO4A 1W8TA 4XJZA 3W21A 2XJQA 4Y71B 3WX5A 1RB8G 3VHOA 3POEA 1CX2A 1GP4A 4GWMA 4FCAA 4X8PA 1H9WA 1QJEA 1XU2A 3WQ7A 1X8EA 3NT1A 3E6CC 2P17A 4RS5B 2BVBA 3KSCA 4LIUA 4MMZB 2BJSA 3BVCA 1COV1 4YZ3A 5ACA2 1RMU2 2LTNA 5EZWA 2XL9A 2CAUA 4QPIA 1ZREA 1OSGA 3AP5A 3RWNA 3EO6A 2ENRA 2C6SA 4CCEA 2JE8A 1XOYA 1ND2B 3ACIA 3PMEA 3L2YA 4FPYA 1VR3A 2P5BA 4WM8C 4XVHA 3ZXGA 1L7LA 1J3RA 4BB3A 1JODA 2W1SA 3VBFB 3KQCL 4QMAA 4HK9A 4WM8A 1TMF2 4LXLA 4OI1A 4DRRA 4PQQA 4YNIA 4DUWA 3SKJE 2I9BA 1NPEB 5JZGB 1CQEA 2WO2A 5LWBA 4I0WB 5A7QA 1AR92 2EVXA 1C8M1 3AMPA 4J6GA 2R16A 3LOBA 1IQKL 3IKWA 3J7HA 3FFZA 1RUJ2 4I3GA 1V6NA 3KV6A 2XONA 5EJZB 1GSLA 4MO3M 5HXMA 5T3NA 2P3TA 3ZMNA 2P1BA 4GH4B 3ME2A 5F7UA 4ZAEB 1XYOA 1SPPA 2ZZJA 3SMHA 1F8VA 5DQ0A 4AI0A 4OVEA 1VRH3 2P2KA 2RS52 1H9PA 3FWEA 4XJ8A 2VWOL 1MZFA 4AVTA 3U10A 3HPNA 2XC0L 1MS4A 4IE0A 1GFF2 2PHLA 1NCRC 3OLUA 2Y0IA 4OULA 4AOCA 1ZRIA 1G2MB 2ZX3A 4Q0SA 2AEYA 5FXZA 2WFPA 3QBQA 2UYAA 2YU1A 3PUQA 4XUTA 3O0XA 2D6NA 2GC1A 1J58A 3BODA 4RRYA 1UKGA 2FDGA 4BHPA 1EPZA 3T2TA 1RUH2 2DVAA 5FZ0A 2MNGA 4AEMA 2LRPA 2VVCK 2XLAA 3SCHA 3ZXJA 1KLJL 1NFWB 1R083 1XNAA 3GZUC 2XL7A 2YC2A 5JW1A 3PL0A 3WF3A 1OC1A 2PHWA 1OLME 4Q4X1 4GAZA 1OOPA 3UV9A 4BZ4A 4R4ZA 1FPN1 3VBSA 3TYJA 4ZXXL 4IEWA 4Q0VA 4XZUG 2RDQA 4S2GA 4PDWB 2W68A 4L99A 3GBGA 3VBOA 1FOD3 2D3RA 4E2GA 1LODA 4GMP3 1NE6A 3K51A 1COUA 2GN3A 2WDBA 4YGDA 1HRI1 1NY72 2BGPA 4YGEA 4E9KA 3WNOA 2K2SA 1IG3A 3GZTB 4NHKA 2Q8CA 4J1WA 5HV0A 1PGL1 1S0JA 2W26B 2BO2A 2JENA 3POIA 4DY3A 1OMIA 1CCVA 3FN9A 5CYYA 3U1XA 2HWC1 5KBFA 2A6WA 3FCSB 4KBZA 1CN1A 3FMGA 3J26N 1YHFA 1DQ1A 1W8OA 4Q4Y2 1S0CA 4B7EA 1T2XA 1XKBA 2BEOA 3OUJA 4M10A 1N1VA 4HMZA 4NPRA 4FPFA 1HN1A 1TEIA 1A78A 4PHZA 3RGBA 2RDNA 4A7YA 4CDUC 1L7QA 3VHPA 3FL7A 4HVQA 1Y3TA 3DYMA 2GP3A 3MW2A 3BT1A 2WYJB 4D6RA 3RPQA 4Y26A 4M4RA 4AVVA 4N53B 1JOBA 2WFTA 1W8UA 4ZHAB 4AK3A 1DZRA 3HAGA 4LKDA 1BYHA 3VD7A 4JQRA 1EAH2 1NLRA 3T09A 5FOBB 4O02B 2XVKA 3JUUA 5L36A 4FBFA 1RJ8A 1AL0G 2TGFA 1QMJA 3AXDA 3EMRA 1RXGA 5H9RA 4CXWA 4LORA 4JDOA 2RV9A 5FMOS 4QGLA 3TB0A 4LLFA 1PO11 3AYEA 1W0OA 4Q1RA 3LFIA 2BYVE 3OUHA 4Y5SA 3Q7DA 1AYM3 1RGSA 2WT1A 2WYFA 2VH9A 2PMWB 3NJZA 4DRVA 3WD5A 3KF5A 1HLCA 2ZHMA 1HZ8A 1GP5A 4W6XA 4BQ2A 2XBXL 1Y7BA 4CUEA 2D98A 3HOBA 4EV0A 3E97A 3HWJA 2UY8A 1CIWA 2PELA 2RR12 2W9XA 5I8YA 2WBKA 4XF1A 4AF9A 2GC2A 3H3UA 2J1EA 3VBHA 5L19A 3T0AA 1SFNA 4K1YA 4CCLA 1QJX3 4AVCA 1C1LA 5JBCE 4FPEA 4CP0A 1K37A 2W94A 1ENRA 1HQNA 2WPHE 1LKNA 1B35B 1WLDA 2WFF1 3ZDVA 4WZCA 3M3IA 3UKTA 2OPKA 4XFCA 4OHZA 2C0ZA 1AYN2 1WLWA 5LBFA 1Y9MA 5LA2A 2VCAA 4LNVA 3ES1A 1ZRDA 1OA2A 5FYVA 3S6PA 2Y8KA 3KCYA 3ROUA 3TRSB 1QJU3 3T2PA 3UYJA 3ZYGA 4E2QA 5EJ1B 3SEPA 2HBTA 4YWAA 2AYLA 3WG1A 3OBAA 5A6QA 2VH0B 2WZEA 4ITCA 3U4XA 4NAMA 4FSJA 1S2BA 1F7MA 5FTTC 1LJ7A 3IJEB 2WLPA 3POYA 1H2NA 1HV0A 3DYPA 3T08A 3CS7L 3NJYA 2XDVA 1JMUB 5DN2A 2CGNA 5HPOA 3WSOA 1JYCA 1S4CA 1ZBE3 2D6OX 4CU7A 4Y3OA 2BOHA 4XFHA 1RVF2 1SACA 4Z92B 2AACA 5CKNA 4DOUA 4YT7L 3HS5A 4Q29A 4Q4V2 4D90A 2CL2A 2ZOEB 1IJQA 1MQ5L 4QDSA 4WM8B 2DF7A 5A7WA 4ATEA 1OBNA 5FPLA 1SFYA 2K2TA 4MX3A 2Y38A 3IPVA 1ZZ6A 1US3A 5LA1A 4P9IA 2ZCWA 4BOWA 2NM1A 2J2UB 2PQSA 2GMEA 4MXWA 4A44A 1MS8A 2XLGA 4NWVA 4QXKA 2PHXA 4M0HA 3TOJA 2B39A 4CCKA 3AM2A 1JS9A 1CONA 1EMOA 3D6EA 3LA2A 5BXXA 2M74A 5EV7A 1BXHA 1MACA 2VULA 1UL9A 1GV9A 2HWE1 2RJ2A 4LBQD 2WNOA 4QU1A 2EAKA 3ZO0B 3VUOA 1SLIA 2Y34A 2CDPA 4IE4A 1SPPB 5F5CA 3CHXA 4WVWA 3ECQA 2VXRA 2ZTNA 2WZR2 3MEPA 1P9JA 4QQ2A 4A6OA 5A3NA 5FY7A 2BTVC 5C9AC 5JXHA 4FXGB 1VE0A 4H14A 4BE3A 2J38B 1ASJ2 1MQTC 2FMDA 2FDIA 5C9AA 4GALA 2A7AA 2Y80B 3SOQA 1UZ0A 3LOIA 1H2LA 4NN0A 2VZVA 2ZABA 3FC0A 4EJRA 3GZAA 1UY4A 2Q8DA 1K3IA 1G1RA 1IQFL 1MS0A 1W9YA 2VVUL 5FZLA 1WW7A 3O0WA 3H8OA 4C8DA 5IUQA 4KGGA 4AEDA 4BQXA 3WNLA 3VBSB 2FZZL 4ZU5A 2P34A 2YPJA 3USUA 1URKA 3LDBA 2UWBA 4NIGA 1HXS1 3AP4A 4I02A 4MGYE 1JHJA 4QX5A 2VXJA 5GZEA 1WD3A 2HWD3 2JE9A 1X9TA 1W99A 4X8NA 5FXWA 4AEKA 4RSUA 2K2SB 3THTA 4QX1A 5E8DA 4XHXA 5A3UA 1LAJA 2W2PE 1KKEA 1UMHA 3OJBA 3JB8A 2QZ3A 3GXUA 1P0SL 4P5HA 1EP0A 1YEWA 1A8MA 2R32A 3AZXA 2PHTA 4KI5M 4A7ZA 1GR3A 2DUPA 2ZGRA 4UF0B 4PI2A 1V9U3 2GALA 2QE3A 4LTAA 1QDCA 3GHMA 4R9DA 1WLCA 5EHDA 5FY4A 2W52A 1L3YA 1UF2C 5KN5C 1UZWA 5FZKA 1BBT1 2BNMA 4BH9A 5FLJA 3R4DB 3V0BA 1AR71 2DYCA 1DGLA 3CQOA 5FYCA 5JOYA 2H0VA 1S2EA 3CBNA 4Q0PA 1PZ8A 4R9BA 3H8XA 2NZ9A 2R042 4OI0A 4GJZA 4I09A 2ILMA 3J8F2 4Q4W1 1W8HA 3WF2A 1WGPA 4JKMA 1EPGA 2XUEA 5F37A 2LW8A 1CQ9A 4LOSA 5A7NA 3VHRA 3TEZA 2A73B 2OT7A 1XNKA 2VTXJ 3AKQA 3JCIA 3OD4A 3ON7A 4J25A 3BB6A 3MFCA 2VBDA 4QQOA 1W6QA 3VZMA 2G9GA 1J3QA 3S57A 5L73A 2J7MA 5KHIA 2Z2SB 4BMEA 4BMBA 2DVFA 2YHJA 4D0QA 4KWKA 4XUQA 1D7PM 2V4AA 4CSWA 5FYSA 3GF6A 4SLIA 1LHUA 3NV4A 4CSYA 3T3YA 4O9EA 1DQBA 4TLGA 4XF9A 4JDNA 3OPZA 3S7IA 2R061 4UFMA 4RGGA 5JR2A 2ID4A 2XBWL 4FPKA 3M8LA 4X6RB 3KCXA 1B09A 3SOVA 4NUBA 3AKPA 5CG8A 4GWIA 2VO5A 3M1HA 5CEHA 3LEMA 3OUIA 3N7MA 3H8RA 1XRUA 4HVRA 1QNWA 2VW1A 4O61A 4A2UA 5J48A 2BOXA 1BEV3 4CXXA 1EY2A 4QKBA 2WR9A 1WKYA 2WYSA 4Y1VA 5CU1A 3BKZA 5C6CA 4XURA 5FQ0A 2BFUL 3TN93 1CD3G 1JYTA 1S2KA 4LHSA 1UCXA 5L9VA 3OEBA 3N8ZA 1PM4A 1WMXA 3DGTA 4W65A 2GNTA 4R52A 4XIOA 1DHKB 3ZN5A 3CJIA 5FZ1A 3OB8A 2G19A 4AHXA 3BI3A 1W05A 1PK6A 5DDJ3 3IM0A 3AZYA 4Z82A 1EV13 1COV2 1OF4A 5D1IA 2G9FA 5JIUA 1O6UA 1Z7S3 5F19A 1K5MA 1N1YA 4YT6L 2JB4A 2JG9A 3DUIA 1IPJA 4EROA 1XDTR 3PNAA 4CUAA 4P5YA 4RL7A 4JYUL 3FBMA 1W90A 1LHNA 3D4KA 5A6YA 2HORA 5IK5A 2UWCA 4ZKTB 4FXKB 3T2QA 3LN0A 5A7WB 3WDUA 1AL23 2WIIB 2ZMNA 3K75B 1Q8VA 2GAUA 5IJRA 3WLUA 4JGYA 4AGGA 4C0HA 1HB2A 2WJSA 1H1AA 2YC0A 3IPVB 1LOGA 3AMHA 3PTRB 3ZLIA 4Z07A 4K20A 5EPAA 2QQLA 2JD9A 2RDRA 1F31A 2VMHA 3POSA 4MXWB 5FZBA 3ZFFC 4HT1T 1C8M2 4RHV3 1S0FA 4MMXB 4K21A 4Y6DB 5K0UA 4BLIA 5LBBA 1X82A 1YFWA 3LC3B 4JDMA 5IVVA 1ZRFA 5FK7A 3ZFFA 5GM0A 4HK8A 1DBNA 3VDDA 4IXLA 4CUBA 4M11A 3ZKUA 5FZHA 1W8BL 1RL3A 1SMVA 2XG3A 4EN8B 5L2YL 4ZONA 1LU2A 3NRUA 4GULA 3VDAA 4B1MA 1UO9A 3LCPA 2VUJA
chains in the Genus database with same CATH topology
1XNBA 4YW3A 4E4SA 3FZ3A 5C9AB 3HMYA 3FBYA 4YZ5A 1MQTB 1ZBA3 4YGBA 4Y24A 4D94A 4NA9L 1O7FA 2DCKA 3AZWA 4R9AA 4YG0A 5F9TA 2D43A 1IOEL 4Q4X2 5BNNA 2WL1A 2PHUA 1I1EA 1FPN2 3USUB 5I0RA 4G9SB 1LOEA 4FTSA 4RRZA 1HW5A 3ILRA 5JDBA 5JMCA 1OFSA 3I4IA 1PGEA 4AI2A 3DN7A 2A6YA 1HRI2 1JW6A 2CGOA 1UZYA 2RNLA 1PGL2 2R0FA 4YVWC 1XXNA 2FMYA 4OI4A 3S7EA 4BIFA 2CWMA 2HWC2 3UJOA 1URXA 4FOYA 1OA4A 5T50A 1SCSA 3O0VA 1O4ZA 2O8OA 4QGMA 5T52A 4AG4A 4MGIE 3QH6A 1UIKA 1H1IA 2CY6A 2DCTA 1XE7A 2XVGA 3M36L 3SNMA 3V0BB 4AQTA 1GNZA 4COZA 4FPLA 3AMQA 2PR3B 4KNCA 5D8AC 1VBD1 2X5IC 3LC5B 2KV4A 3ZYIB 4Y1YA 5H9QA 3NAPA 4QPYA 3UJQA 1KFXL 2VY0A 2X5IA 1FAYA 4GKYA 4JRAA 5CFCC 4R4XA 3D0JA 2A3XA 2WNVC 3MF6A 3MW3A 2HWF1 2BZ6L 1W6QB 3QH0A 1CAUA 1ZAQA 2BOUA 1BZWA 4BDXA 4AQSA 2OYUP 2Q5TA 1PO12 4B8EA 3AYDA 4Z2WA 1WMEA 1KD7A 1DDXA 1EQHA 5F6KA 3W59A 3LWCA 4LUKA 4D3WA 1Q8QA 2WQ4A 1IS6A 2BBVA 5COXA 3RRDA 4DPNA 3K48A 2WS93 3RZZA 4GWNA 4RS5A 1QHDA 4CP1A 4BTTA 1X7AL 3CL1A 3ALQA 1G9FA 4UXAA 2R6QA 3AK0A 2WFF2 4Q8KA 2B9UA 3RQ0A 3QACA 4YZ1A 1JBUL 5FQ0B 1YCIA 1OB1C 1LGCA 2PN5A 4XFBA 5LRRA 4X8TL 4D0EA 3CU7A 1QDOA 4Y4YA 3NKGA 3ZYRA 3CJIB 2W86A 4PLNA 1TME3 4ISRA 3TZIA 3RSJA 4X8UL 1PK6B 3V64A 1VP6A 2PHBB 4XDQA 3R0RA 1N1SA 1MZEA 1VBA1 1SDWA 4YVSA 5EFUA 3RNSA 2E6VA 2JG9B 2I07B 3CO2A 3GYDA 1HRV1 2EIGA 5JBBE 3E5UA 3N4MA 1SLLA 1XYPA 1RFNB 1RHI3 5IK7A 1RIRA 1KDKA 3KQEL 3FHIB 2FLBL 1WLTA 2IWGB 3OGGA 4AHWA 4GH4A 2NPIA 1UN1A 5KHGA 2P95L 2FLRL 3ASIA 5A32A 1U5ZA 4XF3A 3A4UA 3LN1A 2IXJA 3NL1A 4GB33 1CESA 2IXHA 2DFBA 1OKQA 2HEVF 4Q0UA 2XJSA 3ZXFA 3ZFFB 1PIV1 3LTFB 1S0IA 1U0AA 1HDKA 2HWE2 2PHDA 2NPRA 1BKZA 1PVC3 2RS33 5C8CC 1Q8SA 3MIEA 1GZ9A 3ZSLA 3ZMOA 3AP9A 4OHYA 2W3IB 1YUFA 1LOAA 3WDTA 3F1SB 4JAAA 1IQIL 1QH6A 2ES3A 4MYEA 1MS5A 3I7DA 1QQP1 4PBOA 2EI7B 1L3JA 2EALA 1R1ZA 2Z69A 2VMIA 4XTMA 4NVPA 2EI6B 2DV9A 4N7UA 2VVEA 1GBGA 1ULCA 2DCYA 4WVMB 4Z6AL 5LEJA 1J59A 4LLOA 1CVNA 1RUF1 2H6CA 2BQ7A 4AI3A 3WCSA 4AVSA 1AXKA 4YYOA 1HXS2 4H55A 2YGMA 2C9AA 4LO6B 1ZM1A 2KXLA 2R1BA 4P9WA 5AFBA 4JYVL 3F6UL 1JOJA 3OGJA 1QKQA 2ZA9A 2J34B 3RJRA 2B45X 3M3EA 1DLLA 1CJDA 2W08A 3OF1A 4JZFL 3QD6A 4H7MA 3RR3A 2J94B 5DZGA 1W7XL 1C5MF 1EBVA 1O91A 2NP0A 1AR61 1PNGA 2MHPA 2Z5WA 3VGIA 2IXIA 1KS4A 4JTOA 4A94C 2XBO2 3U07A 3CLPA 1ADXA 1DVAL 2W2OE 1HJ7A 3IDCB 4AHZA 1BBT2 3SH4A 3FFQA 1ATDA 4DINB 2ZGLA 2XJRA 1AR72 4E2SA 4FO9A 4XW3A 4HETA 5D8AB 1O5UA 3JQXA 4Q4W2 1PO21 3N3HA 2X5IB 5DZEA 4AVBA 3AXEA 1SZBA 1YFXA 1G6NA 1I0UA 2WG4B 3ILFA 5CFCB 4GIQA 1CAUB 2WLQA 2PLV1 3VBRC 2WNVB 4YFWA 5FBZA 2PQQA 3B9IA 2JECA 2FZ1A 1UU5A 4F3JA 1H0BA 1WBFA 3GBFA 2ARBA 4L2NA 1PFXL 2R062 5CAZA 1C5HA 1MEC1 4FOVA 1F2NA 1D4M1 2BW8A 2DTWA 1Q56A 2HWB3 4J1XA 4XXPA 4A7IA 3WHTA 4CDQC 4OLLA 3EQEA 1GK5A 4CDQA 1VIWB 3U73A 4YZUB 1N3OA 2D40A 4QM8A 1KRIA 1X33A 1QJY1 2F4PA 5BNOC 2ARXA 2Y7ZB 1VBB1 4HPKA 5IKRA 4N9IA 2XBO3 4AQ6A 4Y1ZA 2D6PA 3ZSEA 5J98B 2VVVL 5J7MA 2Y5HL 4XQ4A 4PIZA 4FQ4A 1MVEA 1T6GC 4KQ7A 4IEVA 4LE4A 2R071 3HS7A 4YVSB 5E1RA 1LMJA 4FOWA 4MXVA 4HN0A 1AR83 3FJSA 1REEA 4PLMA 4Y22A 5T5LA 3MPBA 5LK7B 1R091 4JTNA 2IZWA 3GNEA 1LQDA 2BMGA 5GLVA 1APQA 1RITA 5A32B 3NTGA 3C2UA 4RQPC 4EN6B 4XFIA 2A3YA 1S0BA 5AFEA 2PTMA 1RUG1 3H3ZA 3NWKA 1AX2A 4RQPA 4FPGA 3D82A 4TYSA 3M3QA 4A7KA 4Z1VA 1W6PA 4Y7AB 2B7YA 1NCRA 2B5HA 1FMD1 2VUAA 3NV2A 4Q26A 1BVVA 1AX0A 2Y82B 1U12A 4QQPA 3VV1A 2OA2A 2XH6A 4GMP0 1WCSA 5ACA3 1G7YA 1RMU3 2BQPA 4YG6A 3VL8A 5C8CB 1CGPA 3BCWA 4N90A 1H2KA 4KU7A 4AFMA 1PZ7A 3N36A 1VALA 2Q1MA 3LZZA 5HBAA 3ILNA 4A3XA 1TMF3 3VHNA 2O0OA 4IETA 5GZCA 3P5BL 3B3QE 1JBCA 4KL1A 2RM21 4FT8A 3KLSA 1LECA 1V70A 4I30A 4WM7C 1X7NA 3OBTA 3ZXKA 1AR93 4Q2FA 3B02A 4JVAA 1VAMA 1LCLA 1MVQA 3APBA 2WSUA 3VKLA 1VBC1 1RUJ3 3ZFEC 1QY4A 1VBE1 1EMNA 4XJAA 3DV8A 3VZLA 3B01A 1NXMA 1ENXA 2RMU1 4LBLA 4CDUA 1KLIL 1CVUA 4TWTA 2RS53 1NCQC 2P3UA 1VB4A 4NO4A 1W6MB 5BPXA 1AUTL 3H7JA 1NCQA 2PAEA 3GBWA 4GA9A 4W6WA 1UZKA 2VW0A 1FV3A 5FPZA 2MHFA 3RG0A 2OYEP 2GN7A 3WCRA 1O3QA 1POV1 5TSWA 2CYFA 1DYKA 2W2QE 4IL7A 1RUH3 4YRDA 4LO4B 3WY6A 3KCGL 2RJLA 1RUD1 3LSEA 3U0ZA 2E51A 1O3SA 1RUI1 1FF7A 1AVBA 1ND3C 3AKSA 4WVZA 3ZPYA 3E5QA 4YM0A 3WW4A 3K9XA 3WXPA 5ABJC 4RS0A 4XJ9A 4FAHA 4QPGC 1KSNB 5JB9E 3KD4A 4C1WA 2HJIA 3H5CB 1VBD2 3SH5A 4PF5A 2Z79A 1QXJA 1FX5A 3I54A 1C4RA 1REDA 3KQRA 4ES9A 2CGPA 5FDBA 4META 1Z78A 1DU3D 3MIGA 3N8WB 1A3PA 3VKOA 4HSJA 3ZIXA 3H7YA 1KS5A 1RUE1 2HWF2 1QOTA 3U11A 1NQDA 1KFUL 4G3YC 5J09A 2JG8C 3ZIWA 4TZDA 4QQLA 5FMOL 1LPZA 1N3QA 2ZGQA 4DXZA 2JG8A 3C3VA 3TWIA 5EYXA 4LBOA 4Q4Y3 3BU7A 5DXDA 5EWSA 2RS11 2P3JA 5IKQA 3H8UA 1D2SA 2WG3C 4ZXYL 4AE2A 5KXDA 2GSYA 1J1LA 1C8NA 2WT2A 5DUWA 4CEYC 4CDQB 1RUOA 5CADA 2FBEA 1XE8A 2SBAA 4CEYA 3BOPA 3IITB 3V65A 1HX2A 4AEJA 3ENRA 4YG3A 4XTPA 1EAH3 5AC91 1QNYA 4HPKB 2YY1A 4XMIA 5DG1A 2P26A 3WDXA 2GH2A 4WZFA 1FJSL 4RRXA 3SXWA 1DQ2A 3B69A 4XPVA 4M00A 2BPA2 5EYYA 4M0NA 3KS7A 3DL3A 3WQ0A 1D0GA 4AQ2A 1VBA2 2E53A 4FTBA 1S1AA 2AYHA 2D3SA 5CNAA 1NFYB 2RR13 1HRV2 1MR5A 1VAKA 4Y22B 4B29A 2ZGUA 1DGWX 2NMOA 4MH0E 5DZFA 4CUDA 4NG9L 2WINB 3KK6A 4Y7BB 1NT0A 3WR0A 1CEJA 4AGRA 1GQGA 4QT6A 1V6OA 3TBDA 3N7LA 1GQHA 1AYN3 3M3OA 3UKNA 4RQPB 4XXAA 1NFXB 4IV3C 4KGQA 5E88A 1CX4A 4JCKA 1W6PB 1NCRB 3B7MA 2GNMA 4IV3A 3IBMA 4P9GA 3MLJA 1JUIA 1MQTA 1AJKA 4CTEA 1PIV2 1ALYA 1PZ9A 2B8MA 1H8TC 2Y5GL 1SEFA 5HCFA 3N35A 3EGFA 4K8FA 4BWOA 3EHKA 1CCFA 4IEQA 3NW4A 1H8TA 4EWAA 3B5LB 3CEWA 4K7JA 2VH6B 1A8DA 1RVF3 4CDXC 1QQP2 4GQ7A 2MEV1 4Q4V3 3JD71 4XFGA 4EWEA 3EXUA 5FFOC 1PRHA 1JYIA 4CDXA 4OZXA 1UX6A 3BIWE 4BXWA 1WHFA 1OFNA 2WA4A 4URTA 3GCXE 3JBG1 1YFYA 3DPRC 3KB5A 5JOXA 2KNIA 1R1A1 1RUF2 1ZZ8A 4M3CF 2QQPA 3DPRA 3PMSA 4RGAA 3OLTA 5IK4A 4RD7A 3ZSKA 3ZFEB 1HV1A 1H4GA 1HREA 1LGBA 4CDUB 1YI7A 2XJPA 4HSLA 2Q4SA 2Y7XB 2WZR3 2VU9A 3BTAA 3UKVA 4XOGA 5KXEA 1NCQB 1KITA 2F9BL 1YLLA 1ASJ3 1AR62 2WPJE 2RHPA 4F7ZA 3WG2A 2VOVA 2VNOA 1NG0A 3H50A 2EI8B 3H1YA 1QGLA 2D1JB 2VVDA 4KU8A 2JX9A 4COYA 3VZNA 3AMMA 1UZJA 1ZA4A 1V00A 2CWSA 3WP6A 3ZN6B 5ABJB 2ZGPA 4QPGB 4P9LA 1PO22 1QF3A 1CVWL 3LGRA 1PVXA 5FRAA 3OD0A 2EXIA 4OUMA 4YGCA 5JB8E 2V5YA 5JIAA 5JVZA 2PLV2 1EYBA 4OI2A 4LBKA 1VRH1 4EN0A 1TLEA 4IQPA 2GDFA 1CJPA 2JG8B 4CUFA 4AHYA 2WWSA 5J3UA 4TSVA 2E7QA 4ORFA 1FXZA 3SLIA 2XLFA 4B4RA 2WZPP 4W6YA 2WPLE 1MEC2 4CEWC 5KC6A 1D4M2 4QQHA 4YFZA 1LB2A 1U8CB 4YSFA 4EWDA 1R081 1ULGA 2HEYF 1H30A 4CEWA 5KXBA 5IKTA 4RR3C 4HVOA 4CEYB 1LTEA 2R043 2UWAA 3V65B 4BLJA 1IHMA 1CPMA 4MZUA 3J8F3 3LA3A 4RR3A 1QJY2 2P3IA 4N7IA 2YV8A 4YW4A 1DIYA 2I9AA 4AFBA 4TGFA 1FOD1 1VBB2 1DQ5A 5HCAA 2YROA 4GMP1 2UWPB 1NA1C 2XBVL 3FLTA 3B00A 1IS4A 1FAXL 1EQGA 4C16A 2F6BA 3AKTA 2JKBA 3PTYA 1QH7A 1AZDA 1IP0A 1HCGB 2R072 2WC2A 3BALA 2ZKLA 4ZU7A 1IS5A 2CV6A 3V0AA 1W0PA 5E89A 3VN4A 5CFDC 3AZZA 3IN9A 1Q5OA 4D0FA 3FX3A 3CFWA 1XNDA 3MW4A 3PJQA 4ES8A 3WNXA 1SCRA 5CFDA 5GLUA 3PVEA 1BVP1 3ZN4A 5GZDA 4Q8LA 2QKDA 1Q3EA 2A71A 4P9JA 2P28B 4Z0LA 1U5YA 3HT1A 3CNAA 2D6LX 4N43C 3WP5A 4PIXA 1RUG2 3RMYA 1LHOA 3HR9A 2BQ6A 1FMD2 4MMYB 1JN2P 3A0KA 4IEXA 2H6BA 4IV3B 3NSTA 3WDWA 3M4FA 1QJZA 1VAVA 2ZGKA 2GNBA 3EBRA 5F5QA 1COV3 4WVMA 2WPKE 3RS6A 2I2SA 3WQ1A 1H8TB 1YO8A 1AYM1 1SBEA 2YZ4A 3QH7A 4EN9B 2A6XA 2ZGTA 5A3LA 3MICA 4BIOA 5C4WC 1VBB3 1PMIA 4KWLA 4ISHL 2MPFA 3KM5A 5CB7A 1OPMA 3VHRA 3E5XA 3OBRA 4CDXB 2OIIA 3HBZA 1V6JA 3HT2A 1FE2A 4YM3A 1QJX1 1W6NA 5C4WA 2RM22 2Z42A 1LPKA 3M70A 1Y43B 3Q3KB 1FATA 4WVVA 3GCWE 2XKOA 4I0AA 1C8M3 2ZZQA 4YVWA 1OA3A 2P3FL 4NHMA 2ZJCA 4H3WA 1V6KA 1LOFC 1VBC2 3ZFGC 3DPRB 1VBE2 1LHWA 3PGHA 1QJU1 2QDRA 1D0HA 2IFRA 3ZFGA 5I0UA 2RMU2 4BM8A 3L2HA 3LB9A 1VLNA 2EAAA 1IGZA 2YMZA 2ERFA 2BOKL 1NYWA 1X50A 3AFGA 2PHFA 3LA7A 4Y76B 5D8AA 4HANA 4I01A 5K0HB 1ZBE1 3VL9A 4TLFA 3BPSE 3BOWA 2X8KA 2KA3A 1C5IA 3WW2A 1RTVA 1RUD2 4FPCA 1RUI2 5CFCA 3DF0A 2IFWA 2WNVA 1FT9A 5IK8A 4Q4X3 4ZU4A 2ZHKA 4UBGA 1FPN3 1LEDA 1RJ7A 1O5LA 1DFQA 1UKRA 1XNCA 4JZEL 2SLIA 2Q1ZB 4XBQA 2XC5L 1AXZA