3TBDA

Crystal structure of domain vi and le1 of human netrin-g2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
331
Chain Sequence
b'DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin-G2
publication title Crystal structure of the ligand binding domain of netrin g2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 81
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00053 Laminin_EGF Laminin EGF domain
A PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3tbdA01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3tbdA02
2PR3B 3P5BL 1KLIL 5IKQA 1ZAQA 1A3PA 4RUTA 5I46L 2RA0L 1XKAL 2VH0B 2WPKE 3U7UG 1IQFL 5JB8E 1APOA 2XBVL 2W2ME 3EGFA 2WPJE 2P28B 3TK5B 2Y5GL 1SZBA 1UZQA 3CS7L 4G1MB 1CCFA 3OLUA 3ZYGA 1EPIA 4E1GA 1W7XL 1Z6CA 4AQSA 2P3UA 1HREA 1ADXA 2J4IB 2BQWA 1IGXA 2I9BA 2TGFA 4D0FA 1NQLB 4ZXYL 2Y5HL 3HPTA 3GISX 1YGCL 2CJIB 4BDWA 4Y76B 3HS7A 2PUQL 4AQTA 2BZ6L 3HO5A 1IQML 4M11A 1IQHL 1EQHA 1PRHA 3TK6B 1YUGA 2Y7ZB 2P95L 1ATAA 1DDXA 4X8TL 2KL7A 1NZIA 2D1JB 2XC4L 4PLMA 1NFUB 4D90A 3MDLA 1F0RB 1WHFA 1CQEA 2YGPA 3N8VA 2W2QE 1CVWL 1IQJL 3NTBA 2XBXL 4BTIA 2MHPA 5COXA 2Y80B 3QMOA 1EQGA 1G1SA 4CUFA 3GCWE 1K37A 1COUA 1YO8A 1IP0A 4JYVL 2PHBB 1EPJA 3NJPC 5KN5C 1C5MF 3LTFB 5IKRA 4XBMA 1L3YA 3LTGD 2J95B 3QCWA 2FLGA 2VWOL 2VWLL 1MQ6L 2W2NE 1DVAL 2F9BL 2WYGB 1UZPA 1EGFA 2VWNL 3K9XA 6COXA 3OLTA 2WYJB 1V3XB 3IITB 2M74A 1PXXA 1WU1B 2VH6B 1FJSL 1FE2A 3Q7DA 4XLWA 3KQBL 1N1IA 1HZ8A 2J34B 4X8SL 2WFXB 2UWPB 1K36A 4JYUL 1XFEA 4ZAEB 1FF7A 2VVCK 1TLEA 3N8XA 4PLOA 2P93L 1UZJA 1HX2A 2Y38A 1LPZA 1WHEA 2BQ7A 2Y81B 1G1TA 2VVVL 1LPGA 2DDUA 4X8VL 1FAXL 1OB1C 1W8BL 5EGMB 3M37L 3PGHA 3N8WB 4BTTA 3HS5A 1NPEB 2GD4A 1PFXL 2NPRA 4C16A 1TOZA 1B9WA 1IQLL 3HO4A 1CEJA 4ISHL 4Y79B 1G1RA 3NTGA 3F1SB 4COXA 3LC5B 1FFMA 2FLRL 2BOXA 4TGFA 4ZHAB 1LMJA 3N8WA 3LAQA 2J2UB 3KK6A 5JBAE 2KB9A 3DEMA 1YUFA 5JBCE 5JVYA 3N8YB 2YGOA 1G1QA 4Y6DB 1EPGA 4YT6L 3BPSE 1L5GB 3SOQA 3CFWA 2J94B 4X8UL 3TH3L 4JZDL 2WG4B 1PGEA 2Y5FL 3POYA 4RRYA 1Z6EL 1IQKL 1NT0A 5FDQA 1HJ7A 4PH9A 1DQBA 3M36L 3N8YA 1ATBA 4LMFA 4JZFL 3SOVA 1JL9A 2EI7B 1ATDA 2XC0L 4NGAL 2XBYL 1ATEA 1EZQB 1EBVA 2BOUA 5F1AA 4Z0KB 2BO2A 2ADXA 1IOEL 3KL6B 1UZKA 2VWMK 1HCGB 2H9EL 2BQ6A 4URTA 1KSNB 2AYLA 3FCSB 4O02B 3TZIA 2WG3C 2OYEP 1IQNL 1IQGL 3NT1A 4FM5A 2BMGA 1Q4GA 1QFKL 2UWLB 3V65B 4JZEL 5JB9E 2WPIE 5CKMA 5CISA 3ZYIB 3KQEL 2FZZL 3TBDA 5K0HB 4RS0A 4D0EA 5KIRA 1APQA 2P26A 2P94L 4LORA 1I0UA 1CCVA 1DX5I 1URKA 1IOXA 3V64C 1JV2B 3N8ZA 2P3FN 1EPHA 1FSBA 1KIGL 1KLOA 1CX2A 1RFNB 2WPLE 4CUDA 1HRFA 2EI8B 1BF9A 2VVUL 4M10A 4OTJA 1M1XB 2B7DL 2FD6A 5IKVA 2P16L 4BXSA 1FAKL 1F7EA 2OYUP 3F6UL 2UWOB 3FFGL 1G2LB 4CSYA 1U67A 2RNLA 1IQIL 1MOXC 1MQ5L 1XKBA 1PTHA 3FBYA 4RRXA 1NFWB 1J9CL 4PLNA 1YUKB 3IJEB 4OTYA 4BDXA 2EI6B 2MGRA 2RHPA 1HT5A 1LQDA 1JBUL 1LPKA 3ZYJB 4YT7L 3BT1A 4NA9L 3LN0A 4XL1A 4Z0LA 5JW1A 3LC3B 1F0SB 2K2TA 2MGPA 3C9AC 4MMYB 2W86A 1KLJL 4Z6AL 1EAIC 3KRKA 1EMNA 2WFTA 4O1ZA 5IKTA 3LN1A 5JBBE 1NFXB 3U73A 5L30L 2XBWL 1DIYA 1P0SL 1HAEA 2XC5L 2FLBL 2W2PE 4BTUA 2W3KB 2BOKL 5CKNA 3LIWB 1P9JA 3Q3KB 2G00L 2W2OE 4MMXB 2BOHA 2I9AA 3KCGL 1HAFA 4ZXXL 1NFYB 3MQEA 1G2MB 3ASIA 3H5CB 1IQEL 4NG9L 3QH0A 3SOBB 3CENL 5JVZA 3KQCL 1EMOA 1U8CB 2W26B 1HT8A 3R05A 2J38B 4CUEA 2Q1JB 5CKQA 4BXWA 1IVOC 3RR3A 1IJQA 1IGZA 3BT2A 2K2SB 3ENSA 5L2YL 1XDTR 3TGFA 1X7AL 5L2ZL 4ISIL 4RRWA 4A7IA 2WPHE 3GCXE 4ZH8B 4Y7BB 3KQDL 4RRZA 4Y7AB 1F7MA 3CA7A 2P3TA 3HS6A 1GK5A 1CVUA 2WPME 3ELAL 2Y82B 4YZUB 2P3FL 1TPGA 2Y7XB 2KV4A 4OVEA 4MMZB 3HO3A 2W3IB 2VJ3A 5E8DA 1AUTL 3SW2A 1O5DL 1N7DA 5F19A 4Y71B 2JKHL
chains in the Genus database with same CATH superfamily
2CGOA 2JG8C 2GU9A 2YHJA 2P2KA 3D5OA 5FZ7A 4EZ4A 2JX9A 2AACA 3RZLA 1LOFA 1EPZA 3T3YA 1CAXA 3WF3A 1XSQA 2RDQA 3M3QA 5JMOA 4D7YA 5K0UC 1BEV3 2VQ0A 4P9LA 4LBNA 4XIKA 2VZVA 3H3LA 2UWAA 4MXWB 4YLZA 4AI3A 1W9TA 2XBVL 5B2GB 3UK9A 5C5TA 2FD8A 1I5ZA 1CD3G 2WPJE 3WUCA 1WD4A 4K8RB 5BNPC 2IXJA 5CFDA 2Y5GL 4YFZA 3ZXFA 3RWNA 1PGSA 4M01A 3ZM8A 4AFMA 2GAUA 3HPNA 2V09A 4I0WB 3THDA 3W21A 3WT3A 4G1MB 1OQ1A 3ZYGA 1RHI2 3J9SA 3ZFFB 3RDIA 1PM4A 3S7IA 1PGL1 2P5BA 2P3UA 1PZ7A 2VMIA 2WQ8A 3N9LA 2VR4A 4BMEA 1H8TA 1HDKA 2IXIA 3H0OA 4QX3A 3U75A 1ZNPA 2VL4A 5A7SA 4E27A 4TYSA 5CZKA 5L7OA 1LHOA 1MS5A 2PHDA 3PU3A 1NQLB 5A32B 2Y5HL 3JBG2 5C9AB 3VD4A 3POBA 1MVQA 1BQPA 3HPTA 4DRRA 3KWVA 5G05L 1LHWA 1OSGA 5JCTA 1NA1B 1YHFA 4FTBA 4AWDA 2H9EC 3SLIA 3HS7A 4RHV3 2AEZA 2QNKA 2VW1A 3KZ4C 4KGGA 5HBAA 4INDA 3FZ3A 1ST8A 4ZONA 2PUQL 4AI0A 3QLQA 4AQTA 1XJAA 3ZYRA 3RVHA 3ZFFA 4COWA 4BB3A 3M3CA 1WWYA 5EV7A 1EQHA 1PRHA 2QKDA 4LHNA 1AF9A 3TK6B 1YUGA 2Y7ZB 4B8EA 1F5JA 2RS13 2P95L 4A7ZA 4DOUA 1KGYA 5GZEA 5LBBA 4OCTA 5A7WB 4BHPA 4HMZA 4D90A 4QPWA 1ND3C 1F0RB 2GNDA 1MQTC 4MSVA 1OQEA 1NXD1 1Q8PA 1ULPA 2PHRA 1CVWL 2D3RA 2CV6A 3VKOA 2EA7A 1IQJL 4M3CA 3BTZA 3DYMA 2ZA9A 5JXIA 2DFCA 5CFCB 5C3QA 5FXXA 4A6SA 2R042 2BYVE 5DABA 4LO5B 1ZVFA 5H9SA 4CUFA 2JKXA 2CDOA 3GCWE 2BRTA 2WNUC 1O6UA 2QQUA 1AJKA 3K4ZA 4AAPA 3AXEA 5A7WA 2PHBB 1PVC2 2QZ3A 3NJPC 2X5IB 1C5MF 1CAUB 2BU9A 4JTOA 4OHVA 4Y20B 3LTFB 1F31A 3LDRA 5EJ3A 4XBMA 1QJX2 4PIYA 2XJTA 3E1F1 4UBGA 2Y26A 3FHQA 3SHRA 5A3NA 2J95B 3D82A 4R8HA 1RUG1 1V9U3 5FDBA 4FCAA 3ZXKA 3ACIA 5J09A 5CFCA 1DVAL 2F9BL 1PIV1 2X53S 4D7SA 2VWNL 3K9XA 1VP6A 2ZGKA 3S7EA 4UWDA 2WSUA 3OLTA 3I2IA 1EV13 2VVDA 1K5MC 2VZQA 2W1SA 3H1YA 4JGZB 1RYYA 1MS8A 2ET7A 3KT1A 2X5IA 1VRH2 1MR5A 4Y20A 1CAUA 3RYPA 1HZ8A 2B39A 4CU6A 1ULCA 5FO7B 1QIUA 1HJGA 1LHNA 2OIIA 4IGQA 1Q3EA 2VXRA 1BMV2 1DGRA 3WVJA 5LW9A 4UAPA 1NY72 2ADDA 1RXGA 1DZRA 1NLQA 2QCSB 3HNMA 1QNWA 4CA9A 2NQYA 3IDAA 2K2SA 4BDVB 1YEWA 4GB33 3FL7A 3KCYA 5BUVA 1JYNA 1A78A 4WVWA 4QKNA 3C8XA 3NAPB 3WNMA 2JJLA 1K36A 2CWMA 2D3SA 2D6PA 2VCBA 4UW5A 4GWNA 5DXDA 1IS6A 1X33A 4BU2A 4MGYE 4ZPIA 3ETQA 4XJAA 4JGZA 1SG3A 3SKJE 3ZXEA 5DAXA 1BHGA 2VVCK 3T1LA 4NVPA 5ACA2 5BNOA 4Z8BA 4JGYC 1UZJA 1YLLA 1HX2A 1PX3A 4Y4RA 3SEEA 2XMLA 3I3BA 4YGCA 1WHEA 4AVBA 1RVF1 5A3PA 4X8VL 2G1MA 3B7MA 1GOHA 1U5YA 4CP2A 1OB1C 2VH9A 5FV3A 3ZSJA 5F3IA 1RUD2 2ZGPA 5EGMB 2OPKA 5ANQA 5LA9A 1Z7S1 3NAPA 4GJYA 3CQOA 2Q8CA 3WOGA 1ZBE3 2RR12 3ZYHA 1HXS3 4E8DA 5ABJC 3MEPA 2XUEA 4IEOA 1CX1A 1W8WA 3B3QE 4L0PA 4BTTA 1S0FA 2GALA 4DPNA 3RZGA 1NPEB 1MS1A 4FOYA 5FLJA 3DKQA 3ELNA 1UU4A 2VM9A 2J1SA 1SACA 5BY5A 5FZOA 4QU2A 1BLZA 3AKPA 1V6KA 3BKZA 1MEC1 1CEJA 1YRZA 1IS5A 2CYFA 4L11A 4N53A 5FZKA 4Y79B 4JZRA 3A0NA 3W9AA 4JC1A 3LZZA 5LK5A 2NMOA 3WP3A 1SLBA 1VLNA 4TGFA 4ZHAB 1QJY3 1RUH1 4I02A 4KWLA 5DZFA 5FLIA 3WG3A 4AI8A 4PBOA 4JAAA 1PMJX 5HCBA 3VBFA 3KK6A 2DCJA 4AFCA 1COV1 3DPRB 4EE2A 4LUKA 1LESA 3E6DA 3RZHA 1IPSA 2OA2A 4YFWA 3SH3A 1VBB3 5JXGA 2P37A 1Z78A 2XBO2 4Q4V2 2YGOA 5F3GA 5A7QA 3VKMA 4P9YA 4YVSB 2DVGA 3S30A 1G1QA 3T0AA 1SCSA 1QXPA 4MX3A 2W1UA 2BGCA 4XEZA 3RSJA 1UXXX 1Q5OA 4M0NA 4S2DA 4TTGA 3SOQA 3Q8EA 2ZHLA 1YQCA 3N7MA 3CFWA 5BYNA 1UYPA 3VB9A 2QQWA 3MW2A 3PUQA 3VBOB 4R9AA 1GBGA 3C7OA 4B4PA 1PGEA 3I2GA 3CIHA 4AVTA 3Q8BA 4XC9A 2Y5FL 3L2HA 5L9VA 2XPJA 2FDKA 1DG6A 1RITA 2PMWB 3OPTA 3PIGA 4NHMA 1D2QA 4CEWA 1NT0A 5FDQA 1AR92 3DPRA 4XOGA 2DCYA 2VD7A 1XNBA 3M36L 1AXZA 3E5UA 1ATBA 2JJ6A 3HD8B 4YVSA 1TME3 4I09A 4O65A 5C3PA 1JL9A 1C8NA 1OVPA 2Y0OA 3VDCA 1HB2A 5BXXA 4OQ8A 1HQWA 2W47A 3S5AA 1LU2A 3VDDB 3N36A 1MS9A 4Q0SA 1VBA2 4COUA 3AL6A 4M0HA 1SBDA 3LF7A 2ETEA 3AZXA 1EPWA 1LOEA 1JYTA 1ZYBA 1SLLA 3VZKA 4ZZ5A 1WLDA 2A6ZA 2RMU2 2Z79A 2DVDA 4HBNA 4F83A 5J7MA 2V5YA 4IDZA 1BBT2 1TNRA 4OLLA 4BPZA 4DO0A 1HCGB 2H9EL 2DCTA 2ZAHA 1C5IA 1C8M3 2MEV3 5IVYA 1SFPA 4RD7A 2C5DA 1FATA 4XZPA 3WZ1A 4BYYA 3W5MA 3GXUA 3T2OA 4XDOA 2WNVC 3B00A 4ES9A 1ZZ8A 1VRBA 2G9ZA 2WN2A 3GZTB 1WMDA 2AYLA 4LOSA 3TZIA 3T1MA 3VDDA 3OPZA 2BVBA 4QPIB 4IEZA 1IQAA 1N1TA 1REDA 5FMOS 3NJXA 5FO9B 1IQGL 3VN4A 3NT1A 3KQRA 4HG6B 4GZ9A 3E6CC 4M4PA 1RUI3 4P9GA 4Q0PA 1Q4GA 1AZDA 1FV3A 2WLPA 2P3YA 4UBHA 3ZO0B 1QFKL 4AK3A 3IAPA 3O0WA 1JXNA 1S0CA 5CA6A 1WCQA 2Y6LA 5I8SA 3WXPA 2JDAA 2IUWA 2RS11 1ND2C 3ZFGB 5KC5A 1HX6A 1VBD3 5C7GA 4QHOA 4XMAA 1AUYA 1NCQC 3TBDA 1UIJA 1W6PB 2YV8A 4FAGA 4RS0A 4D0EA 1HKDA 3MBWA 3UKTA 1FNZA 1DGRN 5KIRA 4N53C 4QPIA 2P26A 2DBNA 2E63A 4CDXB 1KXGA 4Q2FA 2VQUA 2E6VA 3TWIA 5G04L 1WW5A 1F35A 2B46X 1DX5I 2W92A 5HCFA 3WX5A 2ZGNA 4BA6A 4CDUB 1NZCA 3V64C 2BQPA 2P3FN 4JCKA 1NG0A 1KIGL 5B4NA 4LLOA 3WQ1A 3NV1A 4O61A 5EIYB 3UNPA 1VBC2 2PHXA 3CLPA 1HN1A 5E6HA 4GIQA 5T52A 3AFKA 1UL9A 2K9ZA 3HQXA 3LQCA 1R083 4Q0VA 3ZFGA 4BK5A 2GDFA 1W28A 2ZGTA 3B02A 3WNXA 3AMNA 3URFA 3HN3A 4MYEA 2HWB3 1W6PA 4OTJA 1W2OA 2W52A 5IKVA 1DQ0A 3VHRA 3AFGA 4AZZA 2YC2A 3IBMA 3ACGA 2P16L 3VBSC 3ABZA 2PLV3 1V9U1 4CDXA 3F6UL 5IFTA 2DU1A 2UWOB 1QQP2 1IPJA 1AYN3 1RUJ2 1XPWA 2WQZC 3JXSA 4QB6A 2R041 1IQIL 2JB8A 2HEWF 3D8CA 5F2SA 5FRAA 3JQWA 3ES1A 4BISA 1RMU2 2C6SA 2RVAA 4QXCA 3KGZA 4OMDA 1K45A 2JIGA 3N9PA 5EJZB 3C7GA 5FY5A 5FXVA 1PVC1 2J1EA 2R072 4RS5A 1YUKB 2GH2A 1JYIA 4XMIA 2WWSA 4AI2A 1GV9A 2IFWA 1JU3A 2EI6B 2E51A 4P08A 1AR73 4OUSA 2AGSA 1F8VA 3AMHA 1PK6B 3JB8A 3W20A 3OB8A 5J36A 4Y1UA 3ZDSA 3GZUC 1K12A 3FFZA 2V73A 5FFOC 4NIDA 3S57A 5C4WB 4CSWA 1V70A 4OI4A 4LHKA 3RJ2X 4D0QA 1UKRA 4JHZA 2ZX3A 1PO23 3VZLA 1UQXA 5IWFA 3JCIA 5C9AC 4C1XA 1RUF3 4LKEA 1IPKA 4YT7L 3BT1A 4NA9L 2YZ4A 3KSCA 3CL1A 2VC9A 4KWUA 4AFAA 3AZWA 4XUOA 4W8JA 1D2SA 2W86A 1GWKA 4CCOA 4UF0B 2D97A 2NM1A 3K3NA 5JSPA 3GJAA 2BBVA 1VAKA 3ZOIA 3WP6A 4RR3C 1TZOA 4YVWB 4YGBA 4FT8A 4W65A 1DGWX 1W8TA 2QBXA 5CNAA 2XLFA 4IEUA 4YG6A 2YBPA 4QAWA 4XE9A 2WFTA 4O1ZA 1A6CA 3K4DA 5C4WA 1NQJA 2LRPA 1OPOA 1G9BA 4R9CA 5A6QA 4W6XA 2I74A 3ZSKA 1HXS1 2YU1A 3OOXA 4CCCA 5J48A 4OI0A 3U73A 3EBRA 1EAH3 4UFKA 3K51A 2BNMA 2XBWL 1DIYA 5ACA1 4HVOA 1HLCA 3KV6A 4JRAA 4CEYC 5KHKA 3OBAA 1L7RA 2BWCA 3BODA 4PBPA 3Q8AA 2BOKL 4EZHA 2XL9A 4UF0A 1Q56A 5CKNA 4P14A 3LIWB 1GQHA 2D5HA 2OX0A 3UJOA 4H3WA 1P9JA 2VG9A 3LDBA 5H9PA 2VNRA 1POQA 2BOHA 3SCHA 3VUOA 2I9AA 1D4M3 3KCGL 1B35A 3OD4A 1RUD1 1QWRA 3N4MA 3ZXGA 2KM2A 1EUTA 3ILNA 4Y1ZA 1G2MB 1XE8A 4N7UA 4BQ2A 1IQEL 5AC93 5HPOA 4NG9L 1ULOA 1QJY1 4UFJA 3NNFA 3O1TA 3QH0A 3WEZA 3NNJA 1ZBA3 3HOBA 3KQCL 3M1HA 4D6RA 2O0OA 3HVDA 1RUOA 1U8CB 2HWE2 1G9AA 4N7IA 3R05A 2XDVA 1KS4A 1YQ5A 1CIWA 2Q1JB 4BXWA 1GKBA 1VBB1 1IVOC 5F3EA 4A42A 1M06G 1UOBA 3MUY1 2OVUA 2V4VA 5LRSA 3BT2A 1GYKA 3MIGA 1JI6A 1FOD3 2B5HA 5T50A 4AQ6A 1LODA 3CZJA 1WLWA 4ISIL 4Y24A 1MZFA 5JR7B 1YIPA 3ATGA 3D6EA 4Z2WA 3WNPA 4AOCA 4LTAA 1GZWB 4P9WA 3ILRA 4NAMA 4LT5A 1ZRRA 3KQDL 4AGVA 1G86A 3CA7A 4LA3A 4XAEA 1OF4A 2XWBB 2WZR3 4XQWA 4JDOA 2NPIA 1CVUA 3AYDA 3T0BA 5LB6A 2Y82B 5FYBA 2Q1ZB 2W1WA 4HXCA 1BZWA 4OULA 2P3FL 5FZDA 5JLVA 4MZUA 4E4SA 1QH7A 1V6LA 4GH4C 1PVXA 5BNNB 1TME1 2Y7XB 5EXOA 2KV4A 5HI0A 1K3IA 1JHNA 3MV11 5J96B 3M3EA 4S2HA 1JU4A 4IV1C 4UI9L 1E57A 4Q4Y2 3O1MA 4XTMA 1JBCA 2PXJA 2VMFA 2WN3A 2P3IA 5E8DA 3MF6A 5KC6A 1NLRA 1O5DL 5F5CA 2Z2SB 5J1XA 3C7FA 3NJYA 4X6RB 2DCZA 3POEA 4YYOA 4AVAA 5A3TA 2PR3B 3I2JA 1AR83 4P5YA 2ATFA 4QXBA 1QOSA 1C8M1 2C4XA 2YY1A 2RS33 3BPZA 4HANA 1NKGA 1ZAQA 2VOTA 4XF3A 1JH5A 1WCKA 4GJZA 3ETPA 4QDQA 1RUG2 3P5BA 3ZX7A 5C71A 3BCWA 4NUBA 1XKAL 1V1IA 2AH2A 2QUOA 4CUCA 2E9QA 4CDWC 1PIV2 3U7UG 2G19A 1LB2A 2WA3A 4XTPA 5LBCA 1VBA1 2VBBA 3J7NA 1FMD3 2BT7A 1W6NB 2W2ME 1RUC2 2RS53 1QJFA 2ZABA 4XHBA 1W9WA 3OTFA 4AFBA 1RUI1 3K4AA 5L36A 2VZTA 4DIQA 3HBKA 3WF0A 5JPNB 3O1UA 1WCDJ 3EHKA 5F39A 3SCGA 3VBUB 3H1MA 2BSFA 2QE3A 3CS7L 2DVAA 2RMU1 4J1XA 4OHWA 2WJSA 2NLRA 1LOCA 4HN0A 4EV0A 5KR7A 1YQ2A 1AYM2 3EMRA 4E1GA 1UZ0A 1JZ3A 3E6BA 2LM3A 2QDNA 3K46A 1A8MA 1AXKA 2XVKA 2F17A 4RGAA 4ZS3A 5DDJ3 3LPFA 3VBHC 1XYOA 4Q4W3 3NKTA 4UW6A 1MVEA 5DQ0A 5F5IA 3ACFA 2TGFA 4D0FA 1JN2P 2BNOA 3KVBA 4KBZA 4XF1A 4CXXA 3FLRA 1T6BX 1V6JA 4XZUG 2R49A 3NVCA 3POSA 3KCCA 1XNKA 2H0VA 5K9YA 1CZVA 4BDWA 2BFUS 3OG2A 2WZ8A 4CCMA 5A70A 1IS4A 2JB4A 3KT7A 3AYCA 3T09A 5GKAC 3OSDA 1J3PA 3N9NA 1RVF2 1GU3A 2GC0A 1I1EA 3ZFEC 5FREA 1R081 2BZ6L 4WM7C 2YBSA 3DUIA 5C6CA 5CADA 4M11A 1YIFA 3O0VA 4K8FA 4BZ4A 2DUPA 1VMHA 4CCJA 1ZRCA 2HWB1 3E97A 4UFHA 5FMOL 5F6LB 3TYJA 5F37A 3B9IA 4N43C 1VB2A 4TWTA 5JOWA 1H2NA 4PI2A 3CKHA 1DQ5A 1Z7S2 3JZVA 2FZ2A 2XC4L 2CGPA 4C90A 5T5PA 3MDLA 4L97A 1AYN1 1WHFA 2ZTNA 3E5XA 2W2QE 4LXLA 4ONUA 3UV9A 2WT0A 5ERLA 1PNGA 4QX7A 2JE8A 2E7QA 5LBEA 5JZGC 1KQRA 1AL0G 2WDBA 4QKFA 1H1MA 3OGVA 3VKLA 4DUVA 2IZWA 4IE5A 4M3CE 2LW8A 5CVRA 5COXA 4C91A 4GKYA 3RPQA 5CB7A 1MEC2 5GJ6A 4AVCA 3ECQA 5E89A 1K37A 5IK5A 3OEBA 1AR71 1YO8A 4IV3B 1IP0A 2WYSA 2IVJA 1DFQA 4I3GA 3AP4A 4RYDA 1DZTA 4JQRA 3KHCA 1RUJ1 1QQP1 3K3OA 2WA4A 3GHNA 5FZHA 3VKFC 3VZJA 2ZKNA 2ORXA 1H4HA 1KDMA 3O12A 4RQPC 4Y33A 4YM0A 1XRUA 3LTGD 2XHNA 1PO21 3JQXA 2VWOL 4HONA 2VWLL 2CNAA 3AYEA 3POJA 1RMU1 1ZZBA 2W2NE 1POV3 2UYAA 3OUJA 1W2NA 1W99A 4Q0UA 3H42B 4NPMA 1MQTB 1SMVA 4CTEA 4ASMB 1CONA 3IITB 3BOWA 2ARBA 3EO6A 3ZMNA 2R16A 4IV3A 5FQ0A 1FE2A 4IE7A 2ZZJA 5LA2A 1RGSA 4XLWA 3KQBL 5CG8A 3B93A 3N9OA 4ITCA 4XHXA 3LEIA 1ODMA 3RS6A 2HOXA 3MIEA 1CVNA 3ZXDA 1O7FA 5JMCA 3LFIA 1YYNA 2E33A 1HV1A 2R063 1A8DA 4V2WA 5JSRA 4FPJA 1BEV2 3NJVA 4D94A 5LA0A 5FZGA 1YFXA 1Y43B 3ENRA 2D7FA 1VB4A 2GNTA 3NNGA 4RGGA 1XFEA 4ZAEB 3H3UA 4XURA 5FYIA 3UGGA 4HPKA 2FDIA 2W08A 4TLGA 2DF7A 2RJKA 4MV2A 1S2KA 4CP0A 1TLEA 2VTXA 4LR4A 4QMAA 5GLVA 4IEVA 2BQ7A 1W9FA 1LECA 4YW3A 3ZLIA 3OPWA 1NCRB 2JENA 3BI3A 1K5MB 1J1LA 2VVVL 3PHMA 2QQMA 4QX5A 4YARA 3OBRA 3K77A 5AC91 1ZREA 1UY4A 1ULGA 2ZGOA 1OUXA 4ARYA 1GICA 1J3RA 1QIQA 1UY1A 3AKRA 5EYXA 5F9TA 5IATA 2UWCA 2LALA 5T54A 4IESA 1ZBA1 1O3TA 3RYKA 2W9XA 4RSUA 2WZPP 4CYDA 4MXVA 1GQGA 2VPVA 2XLGA 3M37L 5KXEA 2ZMNA 1GZCA 3HS5A 1ZA4A 4AGGA 4LBOA 2ZHNA 2GNBA 4RHV2 2GD4A 1FOD1 4XFGA 3KV9A 1NCRA 2OQ6A 2XL7A 4AYUA 1W2TA 2WR9A 3OBTA 5KBFA 1H2KA 2OT7A 2JG9C 1JODA 2ZBJA 1LENA 3ROUA 1OI6A 1IQLL 3AZZA 3QACA 1H8VA 3WDUA 4ISHL 1FPN3 5C8WA 2RS12 4XETA 5IVFA 1JOJA 2UY9A 3NTGA 2VY0A 4COXA 4MXWA 4WM8C 5DG1A 1W8FA 1R1ZA 2Z4FA 4LIVA 1FFMA 2RM23 2WZR1 3ZYFA 5C8CC 2HWE1 1M4WA 3MLJA 1ZZ6A 3EQEA 4UFIA 3ST7A 3LAQA 2VO5A 2J2UB 2QFEA 2ZGMA 3KVAA 2J42A 4K21A 3X29B 2DURA 3JD73 5JR2A 4OHYA 2HWC3 4GULA 5JXJA 3DEMA 1YCIA 2WFF3 3MYXA 4ZS2A 3WQ0A 4IEYA 2VCMA 1YUFA 3I3QA 3BPSA 4NN0A 4QQLA 5I8YA 3HT2A 3PUIA 1LKNA 5GALA 4Y6DB 2XQRA 5L19A 3KT4A 3NQHA 1DCSA 1QJEA 1SDDB 4JKMA 1ALYA 1L5GB 3WNKA 5KHIA 1ZA7A 4YM2A 2ZKLA 1RL3A 4DXTA 5A32A 5C9AA 2XONA 1P8JA 2MNGA 5FZLA 1AR81 4X8UL 4XFCA 2WO2A 3C3VA 4JZDL 1NA1A 2RS31 1QJU3 1OXCA 2Y6JA 4BH9A 4RRYA 3TN93 1V9U2 3HJRA 3T4HB 5F1RA 3N9MA 1OKQA 1JYCA 2VOXA 2WLQA 3V0BB 1D4VB 1DP0A 2WC2A 4HKLA 4IEXA 4XDQA 1DQBA 3OBZA 2EAAA 4Q4Y1 3MLKA 2HWF3 4LMFA 1FMD1 4JZFL 1EV12 1H6XA 3SOVA 1UAIA 1QY4A 2VZRA 3D0SA 3WF4A 2O8OA 3ZN5A 3GF6A 4NGAL 5GLUA 2XBYL 1ATEA 3WCRA 1EBVA 4FFIA 5F1AA 3RJRA 2ARAA 4MVTA 1UD1A 2G9FA 3AP7A 3FHAA 3I3EA 3U0ZA 4FTSA 3G7DA 3NNLA 2ZGSA 3LGRA 3FUQA 1RB8G 3RMYA 4BQYA 3WDXA 1UZVA 3H7YA 3I2HA 3PMSA 3V0BA 4GB32 3R6SA 2E53A 4Q4W1 4EQVA 1SFYA 2ZS6B 4OHZA 2R1BA 3AP5A 1JZ5A 2Y60A 1MZ5A 3CJXA 1H1AA 1LOFC 5IYYA 1RUC1 5FYHA 2IXKA 1OA2A 1QMJA 3LCPA 3FCSB 2VMCA 4BOWA 2WG3C 2VMGA 1PMHX 5HCAA 2OYEP 1IQNL 4SBVA 1DIWA 4Y5SA 1K42A 5T5JA 1OLRA 4FM5A 2D3PA 3CJIB 1S0DA 5T55A 2OZ6A 1AYM1 1A3KA 1ENSA 3EB7A 4QM8A 2CDPA 3NV4A 2UWLB 5FY1A 4JZEL 1LGNA 4E2QA 5CFDC 3HNYM 3M2MA 4JDNA 2VNGA 3O1VA 1TMF3 2ZPXA 3KQEL 2D6LX 2FZZL 5HV4A 1ZBE2 5SV8A 4N8MA 1HXS2 1KD7A 2J22A 5K0HB 4W50A 5IVBA 4V2VA 1GNYA 3BVCA 4YW4A 5DUUA 1H8TC 1KJLA 3T0DA 2DWRA 4CRQA 1US2A 3ZSEA 5L7OC 2WAAA 3J7MA 5JSOA 1JZ7A 3CJIA 2WZEA 2B9VA 4CDQB 1O3RA 1URKA 1XU1A 5FYUA 4NAOA 1EPHA 4LK6A 5FXZA 3PDQA 2WSVA 4ISRA 1HRV3 1O4ZA 2ARCA 2ZHMA 2CGNA 1ASJ3 3RRDA 1WZXA 1G9FA 3AC0A 4XPVA 5APAA 4TZDA 4CUDA 2EI8B 1RJ8A 3JU9A 3QH7A 2EXJA 5KXCA 1BF9A 1RUE3 4LEJA 3ZFFC 4B1MA 1UY3A 2BFUL 4DQAA 1QJY2 3AMMA 5F5AA 3LAGA 5F2WA 2Y6KA 2Q30A 1YWKA 3EXUA 4GWIA 4AR2A 3AJYA 2BERA 3I59B 4UW3A 1QGLA 1ND2B 2LUWA 2BUKA 5FWJA 1U0AA 2D43A 3H8RA 4IE6A 1VBB2 2OPWA 2GSYA 2WT2A 3PL0A 5T3NA 5F32A 4H7LA 4W6YA 1XE0A 2ZACA 3N7JA 3WCSA 1PTHA 2CAVA 2QQVA 2R6QA 2ZJCA 3I97A 2I2SA 4YW6A 2BPA2 1NFWB 5DAVA 3VHOA 4IGPA 3GBWA 4Y26A 2QDRA 2VZOA 1VJ2A 1PZ9A 4YWAA 2ZAAA 5CU1A 2C0ZA 4A6OA 1N3OA 2ZMLA 1KRIA 3I59A 2WWJA 3U11A 3VV1A 2R061 1BK0A 2GN7A 1CIYA 2XJQA 3PJYA 1HT5A 1R64A 4GMP1 5FYZA 1ZRDA 2W95A 4V1PA 3S6XA 3BYWA 3MFAA 2P17A 2CY6A 2HWD3 2QQLA 2XUMA 1JTZX 1TME2 1IKQA 1KJRA 2KNIA 5DG2A 4XJWA 2Q8EA 4XL1A 4YM3A 2VVFA 3LC3B 2BWAA 3C9AC 3NRUA 5CFCC 1OHFA 2HLEA 4L8QA 5JOXA 2KXLA 2GN3A 4ZU4A 4CVUA 2XVLA 1QOOA 4Z6AL 3U1XA 4KI5M 4QU1A 4KMQA 2OS2A 1NAEA 1EAIC 2CHHA 4GXLA 4QQ2A 4X6QB 2Z69A 4XJZA 2J1VA 4LKSA 2BNNA 3RG0A 2VUJA 1DF0A 4FO9A 1BEV1 3TEWA 1W8UA 1C8M2 1I5PA 2MEV2 2X5IC 1PX4A 1KDKA 4S2FA 5FUNA 5JBBE 5FY0A 1NFXB 1XNCA 3MV01 3QOPA 3W58A 4KGQA 1Q8QA 4LE3A 1W06A 2W1QA 2DU0A 4AE2A 4EN8B 3U78A 3PTYA 1HAEA 3GALA 3ZYBA 2XC5L 2FLBL 2XJPA 4Y1XA 5FWEA 3THTA 3ZIWA 4ET7A 1Q43A 4P9JA 4QGNA 1W05A 4G9SB 2IFRA 5HV0A 4EJRA 5DPNA 4PT6A 5FP4A 4FVVA 4PF1A 1LEDA 1RUI2 3VBOA 4PDWB 3Q3KB 4JKLA 4JGZC 1XOYA 5BNOC 1S55A 2W2OE 4XDPA 5FIXA 1CGPA 4XF9A 1X8MA 2Q1FA 2WIIB 3MFCA 1FPN1 3GCWA 4FPEA 4L9BA 4QPGB 5I0TA 3IKWA 3MQEA 1LHVA 1VBD2 3A23A 3H5CB 4NIIA 1FXZA 3ZDVA 4RR3B 5E8AA 4BQ4A 4CXYA 1H30A 1E5SA 2KA3A 3PUSA 2X05A 4I30A 2JDYA 4LQRA 4C1WA 4AEDB 5D8AB 5JVZA 2VZ1A 3KV5A 5B4XA 1OMIA 1XBFA 4QT6A 4XF0A 1QHDA 4KU8A 4FOQA 1EMOA 2XHKA 4RHV1 2QQIA 1HJFA 2W26B 2P34A 3JD71 4ASKA 3NAPC 2HWC1 4IE0A 2VCCA 2WFF1 3BGAA 4OZOA 2J38B 4GU4A 4PDWA 5F5QA 4AVVA 4CUGA 3TEZA 4A4AA 4OYUA 2Q5TA 4QKBA 3LOIA 4CP9B 1DHKB 1UYYA 3GBFA 3AKTA 3LPGA 4K20A 2RJLA 3AK0A 4QPGA 5E1RA 1R082 3BIWE 3KMHA 4CCEA 3GCXA 5GM0A 3H50A 4RRWA 3HT1A 4GQ7A 4NJ4A 3OF1A 4GMP0 4TLFA 2HWB2 4IL7A 3M8LA 1J59A 1RJ7A 4ZH8B 4Y7BB 3C2UA 3MUZ1 4BQXA 4AEDA 2CU5A 5D8AA 4E4DX 2BVVA 2EIGA 3IIAA 3WNLA 5E88A 3TN91 1GK5A 1OA3A 5A1AA 5I91A 1JZ6A 1LOGA 2D6MA 1AYN2 3ELAL 4EWDA 4YZUB 2BOJA 1DU3D 3NV3A 5FK8A 1SBEA 1AHSA 1UZWA 2HWF1 3NWKA 4CP9A 4K7JA 3P1IA 1BBT3 5FY4A 3VBFC 4ZXEA 2JD9A 4MMZB 3VLBB 4YZ5A 3CZUA 4HOOA 3S0MA 1Y9GA 5IJRA 3KGLA 3H9AA 4YRDA 2VJ3A 1VPHA 4Y3OA 3RYRA 1AUTL 2F6BA 4IW3A 5FPVA 5FZ1A 2Q0AA 1QDOA 2AYHA 1AR72 3QH6A 2GC3A 2JKHL 5FMCA 1PMIA 1W6QB 2J1TA 3UGHA 3I2OA 3MDPA 2LROA 5A33B 1KLIL 1CJPA 2PFWA 4CDUA 3PUHA 3CO2A 1UCXA 4GWJA 1A3PA 1PO22 2XJVA 2W91A 4AAXA 4KWKA 3ZIXA 1WLCA 3CHXA 1JYXA 1EV11 2RA0L 1RUF2 4B4RA 4TSVA 4K40A 1WW6A 3SNMA 1X82A 4KG0A 1IG3A 4CEWC 4XQ4A 3DPRC 4RN5A 2OKXA 4FBFA 5JB8E 1APOA 1NLSA 4FPOB 1UIKA 2O14A 4YGDA 3HBZA 1LTEA 5DAQA 2VZPA 4EWEA 2P28B 3TK5B 4B3NA 3O7OA 4COVA 4YVSC 3HEIA 5AVPA 5K4LA 3WW1A 1SZBA 3ACHA 3MF9A 4XCAA 1UWWA 3FC0A 4E8CA 1W6QA 2VQAA 1E5IA 3PVEA 2D6NA 4IV1B 5M0TA 2BP6A 1CCFA 1RINA 3OLUA 2A6XA 3BB6A 4GB31 1WA6X 5GLWA 5A33A 4CU7A 1W7XL 1AR63 3A7QA 2OZJA 3T30A 4DXSA 3B69A 3MZHA 4AQSA 1QXJA 1R1A3 5GZFA 3QD6A 5A3OA 5I93A 1EAH2 3A22A 2J4IB 5EPAA 1UOJA 1WBFA 2BQWA 5LZ6A 3T2PA 4QQOA 2A6VA 2JXAA 3LA3A 2DFBA 1HRI3 1UOFA 4HLTA 1LRHA 5L9RA 3VHPA 4BQ1A 5LK7B 1STMA 3GISX 2Q1MA 4P9XA 2J7MA 4NRMA 1WCSA 4LLFA 3SISA 1YGCL 4B29A 3O5SA 5FO8B 2CJIB 1UOGA 3I3DA 4YG3A 5ISLA 4Q29A 1PK6A 1HRV1 4D6SA 1ASJ1 1D4M2 2VW0A 3VBRB 3VDDC 4AW7A 2HEVF 2YGLA 4BLIA 4W4ZA 4PJYA 1URXA 3ACLA 2EIEA 1RUE1 1VALA 1ZBE1 3GNEA 3LA7A 4CCDA 5AC92 2Z42A 2FCUA 1XNTA 4ASLA 1ONAA 4LHLA 3I7DA 1ATAA 4X8TL 2VOVA 5LASA 1NZIA 1ZBA2 2D1JB 3CEWA 3ON7A 4K3UA 3UESA 1AL23 3BALA 3BIEA 4MGKE 1W03A 3IDCB 4JHTA 3DF0A 4NWVA 2YGPA 3N8VA 1YJKA 4PIXA 4EN7B 1SEFA 3VBHB 4QDRA 2YDEA 4YVWA 1VMFA 4IXLA 4QX0A 1Q8OA 1LK9A 2CWSA 2FQPA 3NTBA 1IQDC 3APBA 4PI0A 3IT8A 3VBRA 1FOD2 4QPIC 1DLCA 2IXHA 4BTIA 2IC1A 3UJQA 3ZKUA 1G9CA 4FI9A 3THPA 3A0KA 3B94A 3GM8A 2Y80B 5FP7A 3ZYPA 5A3UA 2B4KA 3WG1A 1V6NA 5FZ4A 1G1SA 4FQZA 5GZCA 3ZXAC 3RZMA 5IUQA 1XYPA 1FX5A 4QHBA 3ZFEB 5CEHA 1EPJA 4NPLA 4WM7B 5KN5C 3AP9A 4XBLA 5D1IA 2WZR2 5FUIA 1CPMA 5IKRA 3ZFGC 4DY5A 4UFLA 1J84A 4MH0E 5I0SA 1L3YA 2EIDA 3GBGA 1HV0A 5FPXA 3CBNA 1R093 3MGUA 2VE1A 2HWD1 1UF2C 3MPPG 2FLGA 5EWSA 3U37A 3IWZA 3T2QA 4C0HA 3O14A 1PZ8A 1MQ6L 2VNVA 2WYGB 4CDXC 1AVBA 1UZPA 3AL5A 3D3AA 3ZR5A 1EGFA 3RI8A 3KF5A 4E4HA 2BT8A 2VECA 4MGTA 2QQKA 3O0XA 5KHJA 6COXA 1O3SA 2WYJB 4NIHA 1V6IA 5JZGB 4PHZA 1RXFA 2M74A 1WU1B 4I0BA 5EHDA 5IT6A 2B7YA 3OY8B 2FCTA 3Q7DA 3M4FA 1W90A 4A3XA 2ZGUA 3WNOA 5H9QA 1FAYA 4Y1YA 1BVP1 4ZXKA 1AR82 1WUVA 3VL8A 4IE4A 2W2IA 4RS5C 2RS32 1PO13 4L92A 4XILA 3UYJA 2WFXB 2JDKA 4CXWA 1NYWA 1XU2A 4LPLA 4Q1RA 4XVHA 2UWPB 1DZQA 1U12A 1YFUA 1J58A 5FY8A 3KQ4B 2ZEZA 1A34A 3HMYA 4Q0QA 4RQPB 1SLTA 1FF7A 1K5JA 1FMD2 1UYXA 2RS52 4N9IA 3K48A 1GZWA 4JTNA 3PTRB 4KQ7A 4LBKA 1H2LA 5BNQA 1CZSA 1LU1A 2D5FA 4O9GA 4GA9A 4ZY9A 2Y38A 1LPZA 1QDCA 4MGIE 3A21A 5DUVA 2W87A 2Y81B 3SXWA 3I49A 1TEIA 2MEV1 4GD4A 2GH8A 4XCBA 2DDUA 4WVMB 2XJUA 5JIAA 2WNEA 1FAXL 3BTAA 4FQ4A 4PF5A 2HH9A 2TNFA 5BNNA 1UXZA 1JZ8A 1UKGA 3QBQA 1UPIA 4AEJA 5LWBA 1GOGA 1W3VA 2DYCA 1XNDA 2YUEA 4KG8A 4Q4W2 4AF9A 1FT9A 2VMEA 2A5ZA 4RGKA 4K9SA 5C4WC 5IK7A 1N3QA 4I01A 3Q9OA 4K1ZA 5BPXA 4CZSA 2VOWA 1I9RA 3RQ0A 3N8WB 1LULA 2EXKA 5KXDA 4HK9A 1RC6A 4OQ9A 1YFYA 4QQPA 4KH9A 5JOZA 1X50A 2YC0A 4OUMA 3PMEA 3WF1A 2WYFA 4L99A 3VD7A 1NUKA 4AXOA 2NPRA 4J25A 1QF3A 1IOAA 2B8MA 5FAXA 5A6XA 1OOPB 1VBD1 3V0AB 3FE5A 2IVIB 1B9WA 2R1DA 1GLHA 2RDSA 2PAMA 3U4XA 3ZKYA 3HO4A 3LEKA 2JG8B 1ULFA 5FP9A 4XIOA 5IVCA 1O59A 4QQHA 3F1SB 1N3PA 1B35C 4FOWA 4EN6B 4YZ2A 2JDNA 1N47A 4FPGA 5IAVA 3LC5B 2YFUA 3B01A 1W6NA 3FHIB 3WY6A 2BOXA 2A7AA 2BGPA 2PHUA 3LSDA 2GNMA 3N8WA 3U4SA 2FHRA 4IEPA 5K0UB 3OYWB 3VBUA 4A94C 2OQ7A 2R32A 3RZZA 2WNOA 3MIDA 5A3LA 2C9AA 3CDZB 3WDYA 2WO3A 4K1YA 5JBCE 4Y22B 3N8YB 1OOPA 2AR6A 3FUOA 2WBKA 5BNPB 5JI7A 1OC1A 4BJ0A 1ZZ9A 1EPGA 4YT6L 1VBE3 3BPSE 2AC1A 2PELA 3WW3A 2JG8A 5I0RA 2WS93 1KS5A 4ZZ8A 4R52A 1W0OA 1CQ9A 3DXUA 4CCLA 3O1PA 1GP4A 2PLV1 3O1OA 4K6BA 2EICA 2P6CA 5CYYA 1GOFA 1LJ7A 4ATEA 5FOBB 2JG9B 4ARXA 4E9KA 3J8F3 2E7TA 4WV8A 5K0UA 3GYDA 3OYWA 5AFBA 1W2AX 1S0BA 3TOJA 3WR0A 3I3MA 2AREA 1Z6EL 4CU8A 5JUVA 1W8NA 4EN9B 4ZU7A 4WM8B 1QOTA 3RZJA 4D6QA 4PH9A 5EJ1B 1U5ZA 2P4EA 5FP8A 4Y22A 3N8YA 4NIAA 3GDBA 1DGLA 1GWMA 5BNPA 1YQ8A 4META 1ATDA 2EI7B 4OFGA 1H1IA 4JQTA 1TVGA 3E5QA 1CWPA 4IERA 1BJQA 5A6ZA 2PTMA 4FPYA 1X36A 3WF2A 4DRVA 4UOJA 4Z0KB 2DBIA 4DXZA 1G9DA 1AX1A 1VMJA 2ADXA 3WHTA 4YW1A 1NOVA 1W9YA 2ADEA 4MGSA 3W5NA 1PGW1 1U5IA 1AR61 4RFRB 2GMMA 3KL6B 4HVRA 1WKYA 1UZKA 1HQLA 3OGRA 2YU2A 2R062 4KL1A 1RUF1 1UY2A 2UY8A 3RGBA 2BQ6A 3NKGA 5A80A 1TG7A 4URTA 1ND3B 4H14A 4AHXA 4A7KA 2W39A 5HXVA 5C5UA 2UWBA 1F15A 1C28A 1N1SA 4ES8A 2A71A 1LHUA 3TNPB 3UKVA 3R4DB 5K8SA 3TNQA 4O02B 1I3HA 4CUBA 3SITA 1QU0A 2BW8A 4WZCA 1O8SA 2GP5A 2JDPA 5I8TA 4FFFA 3PNAA 2BMGA 2X10A 3AVSA 4Z82A 1UMZA 4UT5A 1X8EA 3BOPA 4I3PA 4QDSA 2WNUB 1PHMA 3WUDA 3WW2A 3V65B 1LGCA 2DUQA 3ZN4A 2WPIE 5CKMA 4W6WA 2FZ1A 3VDBA 1EAH1 4NIGA 4HKOA 1GSLA 2WO1A 5FZEA 3ZYIB 2DV9A 2EALA 1ND3A 4XAAA 5GZDA 2RG4A 1SLAA 1MQTA 4MGZE 5EQUA 1AL21 4HT1T 5DZEA 1BK1A 4YZ4A 4QGMA 5FZIA 2JDZA 4Q4X3 1ZZ7A 2JE7A 5FBZA 5FY9A 2VZUA 4Z07A 5FPZA 3TAYA 1QNYA 2P94L 2N7GA 2BBAA 2PYTA 3IPVB 1I0UA 1OUSA 1CCVA 1RUH3 1D4M1 2QZ2A 3KM5A 1GFF2 3RMXA 3MO4A 1YUDA 4I2OA 2D44A 3N8ZA 1FSBA 1HW5A 2WNUA 4LJHA 1VIWB 2YGMA 4XABA 1CAXB 3F95A 1RFNB 1COV3 3NMBA 3AX4A 3L2YA 4XXPA 1FPN2 4BK4A 1HRFA 1W04A 3EJKA 1YNAA 3N9QA 4NHXA 2RV9A 2NZ9A 3MI8A 2LS6A 2PHTA 2QQOA 5FPAA 2RM22 4M10A 4A7YA 1M1XB 2V4AA 4NROA 5CFDB 2TBVA 5A3WA 1ZZCA 5DN2A 1R091 4BXSA 3POGA 5FZCA 1F7EA 1OPMA 3GJBA 3I2KA 2A6WA 5J3UA 2OYUP 3IPVA 1V1HA 1XB9A 4LBQB 3JD72 4QB1A 3VHNA 3FFGL 4XXAA 2HWC2 2Y6HA 5FUPA 2WFF2 3T4VA 5C70A 3VL9A 1G2LB 1MACA 1U67A 3K2OA 1K5MA 3MPBA 4NPRA 3KD4A 3J4UH 4OUEA 1MQ5L 1H8TB 1XKBA 1SLIA 4JGYB 4NRPA 4FTEA 1IZ3A 5FKCA 5L7OB 2WRAA 3FBYA 2MPFA 4M4RA 1J9CL 2ZX2A 4QX2A 3L9JT 1N1YA 3USUB 3PVOA 5FJHA 2XXZA 4Z92B 4XFHA 1OQDA 3IJEB 3O1RA 1WCUA 4M00A 4BDXA 3WDVA 1MS4A 4FXKB 1PO11 1JUIA 4C8DA 1QJU2 2MGRA 4LBMA 2VBPA 4MADA 4WZFA 3HQUA 1S0GA 3I54A 3TN92 2YG0A 4LBQA 2RHPA 2HKXA 2W68A 3I4IA 1REEA 1W6OB 5FK7A 1MZEA 5ABJB 3WD5A 4YNIA 1WLTA 1RIRA 4O9EA 2HWF2 3AYAA 3MICA 1GNHA 1QXRA 1LPKA 3ZYJB 2FMDA 2PA7A 2WFPA 4JGYA 5FBJA 5FP3A 2K2TA 2MGPA 4MMYB 3ALQA 3USUA 3ZXLA 5DZGA 5CBLA 4P02B 1OKOA 2H6BA 5FZ0A 3WDWA 1MZ6A 2QJVA 2SLIA 1KLJL 3MIFA 4YGEA 4R4ZA 2WINB 2VMHA 1E5HA 3NL1A 2KD7A 5FYTA 4DINB 1OBNA 3G6JB 2RDRA 4M3CB 4CUAA 3PIJA 2QQPA 4OI2A 1ENXA 1BCXA 1EMNA 1X7NA 1XYNA 2W3JA 4HL0A 1RHI3 1ULEA 3FWEA 1W6OA 4IV3C 2XKOA 4XUTA 2CAUA 5FCCA 3IZOA 5ABJA 3WP4A 1UY0A 1W0PA 4AHZA 2PQQA 1ACCA 1EUUA 3HNBM 4BWOA 2RS51 5L30L 2VXJA 1S4CA 4M3CF 1P0SL 2AZ5A 1H9WA 3C7EA 3LOBA 1V6MA 3JBG3 4H55A 4BTUA 2W3KB 2EF6A 5IW0A 2HYKA 2YYOA 3P6BA 2WAOA 2D98A 4LK7A 4NOTA 4F7ZA 4XW3A 1Y4WA 3VD3A 2A6YA 2R30A 5LATA 4D3WA 4DUXA 4IGOA 5JOYA 1XNAA 3IM0A 3VZOA 4MMXB 2GC1A 2C1FA 2QQNA 5LA1A 5FMBA 2XVGA 4B7KA 2G4IA 5DDJ1 1V6OA 1DYKA 2DVFA 1KITA 2R7EB 4QD2A 3U07A 1TMF2 1KEXA 4BIOA 3UETA 1LMMA 2A70A 4ZHNA 4D69A 3ZMOA 1CR7A 4A45A 3PUAA 3T08A 2VW2A 3SOBB 3LB9A 1BXHA 4CCNA 5A6YA 3IDEA 2WT1A 4MHUA 4N90A 5FZ3A 4NRQA 1GP6A 1W3XA 1VAVA 1C5HA 4UW4A 2JIJA 3RI9A 3BU0A 4HSLA 4CUEA 3N7KA 1AX2A 5CKQA 4QXHA 2BV4A 1IJQA 2BJSA 3VD5A 5T5LA 1NXMA 1IGZA 1HRV2 4QGLA 4HSJA 2K2SB 1REFA 1ASJ2 3DN7A 1VBE1 3J26N 3TGFA 3I2DA 4DMIA 5L2ZL 1WD3A 2WS91 2VNOA 3POWA 4KBBA 2ZZQA 2R043 1FNYA 2JWPA 4IQPA 1CAWB 2DTYA 2XR4A 2Y6FA 1OA4A 3U10A 1NCRC 1QEXA 1RUE2 4BE3A 4BXSV 1OFNA 2WPHE 3GCXE 4LBQD 5BNOB 4YG0A 3SEPA 4E2GA 2X8KA 5IAXA 3J8F1 4BQ5A 2P6HA 1DQ6A 1F7MA 4G4FA 1PVC3 2P3TA 3ORJA 2K0GA 5LEJA 2WPME 2VJXA 1WW4A 1QJX3 1C57A 1BYHA 1G6NA 1S0EA 2WNVB 3IDBB 3NJZA 1OLMA 4XYXA 5CAZA 2GC2A 4RA0A 3IAQA 4Q27A 5GZGA 3WQBA 2R0FA 4FPHA 4YW2A 1QH6A 1F2NA 1CAWA 3AKQA 3R4SA 2VUDA 3AJZA 3TRSB 2IXLA 4LOTA 2P3JA 4X8PA 1H4GA 1TNFA 2EXIA 3LA2A 3M70A 5J98B 4DB5A 3MIHA 4UYBA 5F19A 4Y71B 5FLHA 2JICA 2MHFA 1VRH3 1FI2A 4LULA 2DUOA 3P5BL 1OH3A 1EY2A 4CDQA 2ZX1A 3AM2A 5C3RA 1HB4A 5IKQA 1NCQB 1POV1 4HKWA 4OMCA 4Q5OA 2WNVA 5FZOB 4C0BA 5FYMA 5IK4A 3BUCA 2HWD2 2EXHA 4XUPA 1Y9MA 5FKBA 3HR9A 4RUTA 1NA1C 5I46L 2ZXQA 4KWJA 4IEQA 4N53B 2PAKA 2VH0B 2W94A 5IHRA 3JB4C 2QVSB 2WPKE 4QKDA 1IQFL 1L3JA 2AUYA 3IIIA 1FYUA 3EGFA 3H1WA 4COYA 3PU8A 4KNCA 5FZ9A 5TSWA 5ACA3 1UX7A 5H9RA 3VBFB 2JDHA 1WGPA 1OT5A 2O1QA 3RNSA 5I0UA 2E32A 3ZR6A 3AZVA 1ZRFA 1UZZA 2FDGA 1UZQA 1ND2A 5A7PA 1JUHA 3PVBB 4JDMA 2FBEA 3RFRA 2Y34A 3AXDA 3MW3A 4LA2A 5HXMA 1CX4A 2J1UA 1EPIA 2GZWA 1NCQA 3FX3A 5DAPA 1Z6CA 2TUNA 1HREA 3LIHA 1XE7A 3KV4A 4QXKA 2ZEWA 1ADXA 5LY2A 4UXAA 1RUD3 3VBSB 1CESA 3R4UA 2B42B 1IGXA 1OFSA 2I9BA 4Q4X1 3HQRA 4BQ3A 5FYSA 4XBNA 4ZXYL 2RR13 3V64A 2GP3A 4AHWA 2VCAA 1ZM1A 2XLAA 4TN7A 3LIGA 3AMPA 1F4HA 3WQ7A 1SPPB 5IVJA 1N1VA 4Y76B 4NWWA 4XUQA 3SKVA 4CEWB 2L9LA 5D2AA 2D93A 2O8QA 1YJLA 1PNFA 3CF6E 3O1SA 1OH4A 5C3SA 3NV2A 4A2UA 4MG2A 1WMFA 3HO5A 1IQML 2JEMA 5T5OA 2F4PA 5FPUA 1IQHL 2NP0A 2HJIA 2W46A 2CTVA 4DY3A 3VBSA 5DUWA 1CPNA 3DECA 5FZ6A 2W5FA 1DDXA 1IKPA 2KL7A 4PLMA 1H2MA 5A1LA 2Y33A 5JI9A 1NFUB 4HN1A 3Q8FA 2VBDA 2XWJB 4QPYA 1ENRA 1H9PA 1CQEA 4LO4B 3WINE 4AG4A 1SPPA 2BDRA 3FMGA 5FR3A 4RFT0 4BXFA 1W8OA 4YW7A 2H0BA 1O3QA 2XBXL 1EYBA 3S6PA 1G7YA 3ZVXA 3CMGA 3HAGA 1HB1A 2R0HA 1Y9QA 3P3NA 4GALA 2MHPA 2XBO3 4Q4V3 2PHFA 3CJIC 5F8PA 1S2EA 3QMOA 2FDHA 1EQGA 3D0JA 2ORZA 2RM21 3LKJA 3VZNA 1POV0 1Q8SA 2OW4A 2PQSA 4GKXA 1COUA 4MUVA 1TE1B 1KFUL 4JYVL 2LTNA 2VTXJ 1O4TA 2YFZA 4LO8A 4NHLA 5F6KA 3RZKA 4BM8A 2ET1A 3QCWA 4E2SA 3HWJA 3TEYA 4CEYB 2EIBA 5AVAA 1X9TA 2Y6GA 1AR93 4LNVA 1GQPA 4AGRA 2Q8OA 1US3A 1HIXA 1UYZA 4CDQC 3H3ZA 4P5HA 1LOAA 2ILMA 1LOBA 2ZOEB 1V3XB 3OD0A 4RR3A 4AEMA 4FFGA 4OHXA 1PXXA 2VH6B 1O5UA 4GWMA 3BTYA 2NN8A 4IETA 1XQNA 1UZYA 4QX1A 3I2FA 1QJU1 1VBA3 1FJSL 3FLPA 4Q8KA 2JDUA 2PLV2 3GHMA 3PURA 3NNMA 2XB6C 2HORA 5E16A 1N1IA 5C3OA 1RHI1 1HN0A 2JD4A 1YC61 2BEOA 2J34B 4X8SL 1DYPA 2RMU3 1XSRA 1V0AA 5DAWA 4HFSA 4LO7A 1CZTA 1XC6A 2B45X 5FZFA 4LKFA 4CEYA 3VD9A 2VMDA 1PM7A 2NYYA 4B1LA 1IG0A 3ES4A 1Z0HA 4GAZA 2D6KA 3JBG1 5IK8A 4JYUL 1SCRA 3CNAA 1YFWA 3WDTA 2KR2A 2AEYA 4P9IA 2VZ3A 3AB0A 4U36A 4QHZA 2ZEYA 3N8XA 2GMEA 4PLOA 1J83A 2OXBA 2P93L 3C7HA 4H7MA 5JVVA 4EYUA 1G8WA 2IWGB 3KLSA 5KWRA 1G1TA 1PGW2 1F4AA 1LPGA 1AR62 4AL9A 1CAVB 2HBUA 5GLZA 2IXCA 2VRSA 5EFUA 3AKSA 4AEKA 1R1A2 1UMHA 1W8BL 3SMHA 1DBNA 2VU9A 2E26A 1SBFA 3AMQA 1NX9A 1H6YA 1I6XA 2A3YA 3MLLA 1IS3A 1IHMA 1D0HA 1HRI2 4RS5B 1LR5A 4MGQA 5JIUA 4XFIA 4Y1VA 1L7LA 3KS7A 3FLTA 3M3OA 1OD3A 4GH4B 3PGHA 4MLOA 1OURA 1SDWA 2C24A 3J7LA 4MHRA 4A41A 1UO9A 2VGDA 3SH4A 1B09A 3BU7A 2TEPA 4XUNA 2H6CA 1PFXL 1GP5A 4FP3A 5DMYA 4XFAA 4C16A 1JS9A 2ZMKA 5EZWA 5A7NA 4JX0A 2WKKA 1MS3A 1JZ4A 4YZ3A 1TOZA 1CAVA 1TMF1 4JRLA 2AENA 3VBOC 1VBC3 2RJ2A 4U2AA 1KKEA 1YXWA 2X29A 3WSOA 2UURA 4D7TA 3WG2A 1G1RA 2W0XA 4XQDA 4RL7A 2A75A 4LIUA 1AL22 4DEVA 3BTXA 5LEKA 2FLRL 2D40A 3HIFA 2WABA 3MW4A 1QJX1 2YBKA 1LMJA 4GH4A 1H0BA 5FXWA 2HBTA 1O5LA 5FZAA 3DKWA 4FAHA 1TQ5A 1T6GC 3N3HA 4IUGA 4NHKA 4MO3M 4CDWB 4HETA 5JBAE 1QQP3 1RUJ3 4IV1A 5EYYA 2KB9A 2YXSA 5A3MA 1OD5A 5IVEA 4FSJA 4ISQA 2XG3A 1WBLA 4JV4A 5JVYA 1QKQA 3H8XA 2HEYF 4COZA 4PDWC 2YPJA 3FBMA 1U5XA 1LEMA 2A3XA 1RMU3 4J6GA 3ZXJA 4Q1PA 1OLQA 4LBLA 2ZX0A 4LKDA 5HCHA 1W0NA 3D4KA 2EVXA 1HQNA 1UU5A 2XOMA 3R0RA 3OCPA 2ZEXA 1VRH1 2R073 2YPDA 4QPGC 2J94B 2FCVA 3TH3L 2JDMA 3NW4A 4JKKA 2WG4B 1BMV1 3KCXA 1R092 3POYA 1NY71 1SQ4A 4CDWA 2ARXA 4J1WA 1IQKL 1HJ7A 5D8AC 1B35B 4AEDC 1AXYA 1HB3A 2WO7A 4BCUA 4P00B 2V5DA 2RE9A 4Q26A 4XJ9A 4DS0A 2PN5A 4Y5TA 2WQ4A 3FN9A 1WW7A 3CU7A 2BOIA 4D8MA 3PJQA 5FZMA 3VZMA 2OUJA 2XC0L 4AQ2A 3DCQA 1NE4A 1EZQB 4LBJA 2BOUA 1W8HA 4FOVA 3ZSLA 4YSFA 1DQ1A 1NE6A 1JZ2A 4AI9A 2BO2A 3SH5A 1ZRIA 5KHGA 2QTWB 3EYPA 3H7JA 3W59A 1IOEL 4JVAA 2XJRA 4FP2A 4YPJA 1PO12 4LO6B 1XXNA 3VBHA 1UU6A 4N43B 5D21A 2E31A 4XACA 2VWMK 4LHSA 4NR1A 1LGBA 2UU8A 4XBQA 1V00A 1JYVA 1Y7BA 1JOBA 2A73B 4YW5A 3HN1A 3WV6A 3POFA 2J1AA 1PGL2 2RR11 1KSNB 1MS0A 2NMNA 2ENRA 4PQQA 4PQ9A 4CDUC 5J37A 3Q8CA 1CJDA 3N7LA 3P3PA 4N9HA 4FPFA 1GZ9A 3GZAA 3IN9A 3WHUA 4ATFA 2VOKA 3LWCA 3ZFEA 2Z5WA 4NMIA 2CSGA 1SLCA 4WM7A 3KF3A 1C1LA 5KXBA 3LDKA 5AFEA 3N35A 4DUWA 1GNZA 1GR3A 2PHLA 2QQJA 3IMMA 4N43A 3UT0A 1T2XA 3UGFA 4Q8LA 5JB9E 1X9PA 1ULDA 4XJUA 1W2UA 5CISA 1S0JA 2A3WA 2XH6A 3MHZA 4B4QA 3DL3A 5L73A 5L9BA 2GMPA 1E5RA 1RTVA 3OGGA 1J1TA 3POIA 5FPLA 2Q4SA 3VDAA 4X8NA 3S5QA 5FZ8A 3LEMA 3T2TA 3ZSMA 5JZGA 1F5FA 2I07B 1C1FA 5IVVA 4QX8A 2YGQA 4CCKA 1APQA 3OY8A 3DGTA 3WLUA 4LORA 3OUIA 4XJ8A 3LEGA 3SC7X 4EROA 2RDNA 1FV2A 2HWE3 1LCLA 4LUMA 1IOXA 1W9SA 1JV2B 2Q8DA 4Q4V1 2XBO1 3FJSA 1KLOA 4IEWA 4F3JA 5JDBA 1CX2A 4ORFA 5DDJ2 2VTFA 1PK6C 2WPLE 2YC4A 4BIFA 3B5LB 3ITQA 4PCRA 2ZHKA 4OI1A 5K7PA 4R9DA 4RQPA 1UNBA 2VVUL 4Z1VA 1BVVA 1AX0A 3OJBA 2B7DL 3LSEA 2FD6A 3OUHA 1JOPA 2ERFA 1VR3A 1L7QA 1FAKL 5IFPA 3A4UA 4B7EA 4CPBA 5FYYA 2ZGLA 1W39A 1UX6A 1AR91 4R9BA 2J1RA 3ME2A 4NO4A 2WL1A 4CSYA 4S2GA 5FY7A 4FPLA 2I45A 4BMBA 2RNLA 4WVMA 1MOXC 2DTWA 5I0DA 5FZBA 4UFMA 1RUNA 2FDJA 4GU3A 1VBE2 4YVWC 2OYZA 4QWNA 3SQOA 3H8OA 4URAA 3OGSA 2WS92 4WVZA 4RRXA 4Q4Y3 1OVSA 1UPSA 2JKBA 1WA4A 3VBRC 3WP5A 4H2AA 4PLNA 1VAMA 1D7PM 4DXRA 3LFMA 1Y3TA 4OTYA 5ANNA 1LNSA 5FTTC 1ODNA 2DVBA 3J8F2 1JHJA 1BKZA 3WNNA 1O91A 3DV8A 3PLQA 3I8TA 1KFXL 1GWLA 4EWAA 3M3IA 4I0AA 1ENQA 1BBT1 3AZYA 1LQDA 3JUUA 4AVSA 1C4RA 1CN1A 1IGOA 1UN1A 2JE9A 2YROA 1JBUL 2ID4A 4KU7A 4CU9A 3K75B 2K46A 3DYOA 2F4LA 1RUG3 5LY1A 1F9KA 2SBAA 4XFBA 3DXTA 3J7HA 5F3CA 3V0AA 3INAA 1WMXA 3ZN6B 3H8UA 3GGLA 3KB5A 2WUHA 5BV6A 1PIV3 2YMZA 5KHHA 4CE8A 3LN0A 4Z0LA 5JW1A 4SLIA 4AHYA 2A1XA 1F0SB 4QM9A 2CL2A 3VKNA 1RUC3 1YI7A 3NSTA 3TB0A 4MOAA 1MPXA 2V72A 4LITA 4Z2AA 5DUXA 2BTVC 2D6OX 1APNA 2VZSA 3KRKA 1S2BA 1NQDA 1LAJA 4BQWA 1JMUB 2EAKA 2XJSA 1AYM3 2E7AA 4NE9A 5IKTA 2BZDA 2Y8KA 4QB2A 3SCFA 1D0GA 2JECA 3UL2A 5C8CB 1DLLA 3LN1A 1EP0A 1O8PA 1W6MB 4FPCA 3ZPYA 3ZPOA 4O7XA 3ZN6A 3LD8A 1Q8VA 1AJOA 1YI9A 3BN6A 3LE0A 2P1BA 2C26A 3IB3A 3UKNA 2W2PE 2XGXA 2DCKA 2G9GA 2XKPA 5LBFA 5FPBA 2FMYA 1WMEA 3FFQA 1GMMA 1DQ4A 2VULA 2ZGQA 2HYXA 3KHBA 2JG9A 2WWUA 5A7OA 3RWKX 4L2NA 4DNYA 5FYCA 3MIBA 4E4ZA 4AFDA 2G00L 3OEAA 4ZKTB 1R1A1 1GZTA 1VBC1 3B9CA 4WBBA 1RVF3 2UYBA 1HAFA 1GANA 4ZXXL 4HZFA 4WM8A 4NHYA 1NFYB 4Y5Z0 5C8CA 1VE0A 1W6MA 3ASIA 1J3QA 1HRI1 3NO8A 5FYVA 4CPBD 4Q4X2 3AP6A 3CENL 4WVVA 1Z7S3 1OF3A 5FQ0B 2ES3A 5BNNC 3WG4A 2YB7A 2ZX4A 2OUHA 2ZGRA 3V56A 1HT8A 1RUH2 1DQ2A 1S0IA 5FMDA 2BGOA 2VUAA 5JWPA 4DEQA 2Y0IA 4CP1A 3RR3A 1W8ZA 3VGIA 3TEXA 4EN0A 4TXWA 2ZCWA 4PIZA 3M7AA 3ENSA 1COV2 5L2YL 5GLTA 4XF4A 1XDTR 2XQXA 1X7AL 1GUIA 1SFNA 1DDLA 2VQTA 5LRRA 3ILFA 3DYPA 5EP9A 3USSA 5JPMB 4A44A 2R071 5JAXA 2VUCA 2PHWA 3GZEA 4A7IA 1MEC3 2VVEA 4HPKB 4OZXA 5FOJB 5LCWL 3AVRA 2PAEA 1O4YA 4RRZA 4Y7AB 2Y64A 1DGWA 4FFHA 4HK8A 1YQ6A 1JW6A 3HS6A 4FPKA 4F8AA 5SV5A 3U14A 2B9UA 5CIRA 1C3HA 4DFSA 4DZGA 5CG9A 1TPGA 2P3KA 4AI1A 1ZX5A 4G3YC 4BLJA 5C33A 5F7UA 2FDFA 3OGJA 3V65A 2VAUA 4A3ZA 1JYWA 5A1FA 5JXHA 4GMP3 4Y4YA 1DYOA 4OVEA 3VBUC 3WW4A 4YM1A 1OLME 3PVNA 3THCA 1UMIA 3HO3A 2W3IB 3F2ZA 3IMNA 1S1AA 1UW8A 2C9KA 4YZ1A 1QJZA 1OOPC 3SW2A 4HVQA 4R4XA 1N7DA 2X09A 4FXGB 4LE4A 4XFFA 4ZU5A 1SHWB 5FJKA
chains in the Genus database with same CATH topology
2CGOA 2JG8C 2GU9A 2YHJA 2P2KA 3D5OA 2JX9A 1LOFA 1EPZA 1CAXA 3M3QA 4D7YA 5K0UC 1BEV3 2VQ0A 4P9LA 4LBNA 4XIKA 2UWAA 4MXWB 4YLZA 4AI3A 2XBVL 5B2GB 3UK9A 1I5ZA 1CD3G 2WPJE 3WUCA 1WD4A 5BNPC 2IXJA 5CFDA 2Y5GL 4YFZA 3ZXFA 3RWNA 1PGSA 4M01A 4AFMA 2GAUA 2V09A 4I0WB 3WT3A 4G1MB 1OQ1A 3ZYGA 1RHI2 3J9SA 3ZFFB 3RDIA 3S7IA 1PGL1 2VMIA 2P3UA 1PZ7A 4BMEA 1H8TA 1HDKA 2IXIA 3H0OA 1ZNPA 4E27A 4TYSA 5L7OA 1LHOA 1MS5A 2PHDA 1NQLB 5A32B 2Y5HL 3JBG2 5C9AB 1MVQA 1BQPA 3HPTA 4DRRA 1LHWA 1OSGA 5JCTA 1NA1B 1YHFA 4FTBA 4AWDA 2H9EC 3SLIA 3HS7A 4RHV3 2VW1A 2QNKA 3KZ4C 4KGGA 5HBAA 4INDA 3FZ3A 2PUQL 4AI0A 3QLQA 4AQTA 3ZYRA 4COWA 3ZFFA 3M3CA 5EV7A 1EQHA 1PRHA 2QKDA 4LHNA 1AF9A 3TK6B 1YUGA 2Y7ZB 4B8EA 1F5JA 2RS13 2P95L 4A7ZA 4DOUA 5GZEA 4BHPA 4HMZA 4D90A 1ND3C 1F0RB 2GNDA 1MQTC 4MSVA 1OQEA 1NXD1 1Q8PA 2PHRA 1CVWL 2D3RA 2CV6A 3VKOA 2EA7A 1IQJL 4M3CA 2ZA9A 2DFCA 5CFCB 2R042 2BYVE 4LO5B 1ZVFA 5H9SA 4CUFA 3GCWE 2WNUC 1AJKA 3AXEA 2PHBB 1PVC2 2QZ3A 3NJPC 2X5IB 1C5MF 1CAUB 4JTOA 4OHVA 4Y20B 3LTFB 1F31A 5EJ3A 4XBMA 1QJX2 4PIYA 2XJTA 4UBGA 2Y26A 3SHRA 5FDBA 2J95B 3D82A 4R8HA 1RUG1 1V9U3 4FCAA 3ZXKA 5J09A 5CFCA 1DVAL 2F9BL 1PIV1 2X53S 4D7SA 2VWNL 3K9XA 1VP6A 2ZGKA 3S7EA 2WSUA 3OLTA 1EV13 2VVDA 1K5MC 3H1YA 4JGZB 1MS8A 2ET7A 3KT1A 2X5IA 1VRH2 1MR5A 4Y20A 1CAUA 3RYPA 1HZ8A 2B39A 1ULCA 5FO7B 1LHNA 2OIIA 1Q3EA 2VXRA 1BMV2 1DGRA 3WVJA 1NY72 2QCSB 1DZRA 4D7TA 1QNWA 2NQYA 2K2SA 4GB33 3KCYA 5BUVA 1A78A 4WVWA 3NAPB 2CWMA 1K36A 2D3SA 2D6PA 4UW5A 4GWNA 5DXDA 1IS6A 1X33A 4MGYE 3ETQA 4XJAA 4JGZA 3ZXEA 5BNOA 3T1LA 2VVCK 5ACA2 4NVPA 4Z8BA 4JGYC 1UZJA 1YLLA 1HX2A 4YGCA 1WHEA 4AVBA 1RVF1 4X8VL 3B7MA 1U5YA 4CP2A 1OB1C 2VH9A 3ZSJA 1RUD2 2ZGPA 5EGMB 2OPKA 1Z7S1 3NAPA 3WOGA 1ZBE3 2RR12 1HXS3 5ABJC 3MEPA 4IEOA 3B3QE 4BTTA 1S0FA 2GALA 4DPNA 1NPEB 1MS1A 4FOYA 5FLJA 3ELNA 1UU4A 5BY5A 1SACA 4QU2A 3AKPA 1V6KA 1MEC1 1CEJA 1YRZA 1IS5A 2CYFA 4L11A 4N53A 4Y79B 3A0NA 3W9AA 4JC1A 3LZZA 5LK5A 2NMOA 3WP3A 1SLBA 1VLNA 4TGFA 4ZHAB 1QJY3 1RUH1 4I02A 4KWLA 5DZFA 5FLIA 3WG3A 4AI8A 4PBOA 4JAAA 5HCBA 3VBFA 3KK6A 2DCJA 4AFCA 1COV1 3DPRB 4LUKA 1LESA 3E6DA 2OA2A 4YFWA 3SH3A 1VBB3 2P37A 1Z78A 2XBO2 4Q4V2 2YGOA 3VKMA 4P9YA 4YVSB 2DVGA 3S30A 1G1QA 1SCSA 1QXPA 4MX3A 2BGCA 4XEZA 3RSJA 1Q5OA 4M0NA 4S2DA 3SOQA 2ZHLA 3N7MA 3CFWA 5BYNA 3MW2A 3VBOB 4R9AA 1GBGA 4B4PA 1PGEA 4AVTA 2Y5FL 3L2HA 2XPJA 1DG6A 1RITA 4NHMA 4CEWA 1D2QA 1NT0A 5FDQA 1AR92 3DPRA 4XOGA 2DCYA 1XNBA 3M36L 1AXZA 3E5UA 1ATBA 2JJ6A 3HD8B 4YVSA 1TME3 4I09A 1JL9A 1C8NA 2Y0OA 5BXXA 1HQWA 1LU2A 3VDDB 3N36A 1MS9A 4Q0SA 1VBA2 4COUA 4M0HA 1SBDA 2ETEA 3AZXA 1EPWA 1LOEA 1ZYBA 1SLLA 3VZKA 1WLDA 2A6ZA 2RMU2 2Z79A 2DVDA 4HBNA 4F83A 5J7MA 2V5YA 1BBT2 1TNRA 4OLLA 4BPZA 1HCGB 2H9EL 2DCTA 2ZAHA 1C5IA 1C8M3 2MEV3 4RD7A 2C5DA 1FATA 4XZPA 3WZ1A 4BYYA 2WNVC 3B00A 4ES9A 1ZZ8A 3GZTB 1WMDA 2AYLA 3TZIA 3T1MA 3VDDA 3OPZA 2BVBA 4QPIB 4IEZA 1IQAA 1N1TA 1REDA 5FMOS 5FO9B 1IQGL 3VN4A 3NT1A 3KQRA 3E6CC 1RUI3 4P9GA 4Q0PA 1Q4GA 1AZDA 1FV3A 2WLPA 3ZO0B 4UBHA 1QFKL 4AK3A 3O0WA 1JXNA 1S0CA 5CA6A 5I8SA 3WXPA 2RS11 1ND2C 3ZFGB 5KC5A 1HX6A 1VBD3 4XMAA 1AUYA 1NCQC 3TBDA 1UIJA 1W6PB 2YV8A 4FAGA 4RS0A 4D0EA 1HKDA 3UKTA 1FNZA 1DGRN 5KIRA 4N53C 4QPIA 2P26A 2E63A 4CDXB 1KXGA 4Q2FA 2E6VA 3TWIA 1WW5A 2B46X 3WX5A 1DX5I 5HCFA 2ZGNA 4BA6A 4CDUB 1NZCA 3V64C 2BQPA 2P3FN 4JCKA 1NG0A 1KIGL 4LLOA 3WQ1A 3NV1A 1VBC2 2PHXA 3CLPA 5T52A 4GIQA 3AFKA 1UL9A 2K9ZA 3HQXA 4Q0VA 1R083 3ZFGA 2GDFA 2ZGTA 3B02A 3WNXA 3AMNA 3URFA 4MYEA 2HWB3 1W6PA 4OTJA 2W52A 3VHRA 5IKVA 1DQ0A 3AFGA 3IBMA 2P16L 3VBSC 2PLV3 1V9U1 4CDXA 3F6UL 2DU1A 2UWOB 1QQP2 1IPJA 1AYN3 1RUJ2 2WQZC 2R041 1IQIL 2HEWF 3D8CA 5FRAA 3JQWA 3ES1A 1RMU2 3KGZA 1PVC1 2R072 4RS5A 1YUKB 2GH2A 1JYIA 4XMIA 2WWSA 4AI2A 1GV9A 2IFWA 2EI6B 2E51A 1AR73 4OUSA 2AGSA 1F8VA 3AMHA 1PK6B 3JB8A 5J36A 4Y1UA 3ZDSA 3GZUC 3FFZA 2V73A 5FFOC 5C4WB 1V70A 4OI4A 4LHKA 3RJ2X 1UKRA 2ZX3A 1PO23 3VZLA 3JCIA 4C1XA 1RUF3 1IPKA 4YT7L 3BT1A 4NA9L 2YZ4A 3KSCA 3CL1A 4AFAA 3AZWA 1D2SA 2W86A 5JSPA 2D97A 2NM1A 2BBVA 1VAKA 3WP6A 4RR3C 4YVWB 4YGBA 4FT8A 4W65A 1DGWX 5CNAA 4YG6A 2XLFA 4IEUA 4XE9A 2WFTA 4O1ZA 1A6CA 5C4WA 1NQJA 1OPOA 1G9BA 4R9CA 4W6XA 2I74A 3ZSKA 1HXS1 4OI0A 5J48A 3U73A 3EBRA 1EAH3 3K51A 2BNMA 2XBWL 1DIYA 5ACA1 4HVOA 1HLCA 4CEYC 4JRAA 5KHKA 2BWCA 3BODA 4PBPA 2BOKL 2XL9A 1Q56A 5CKNA 4P14A 3LIWB 1GQHA 2D5HA 3UJOA 4H3WA 1P9JA 2VG9A 5H9PA 2VNRA 2BOHA 3SCHA 3VUOA 2I9AA 1D4M3 3KCGL 1B35A 3OD4A 1RUD1 1QWRA 3N4MA 3ZXGA 2KM2A 3ILNA 4Y1ZA 1G2MB 1XE8A 4N7UA 5AC93 1IQEL 4NG9L 1QJY1 3QH0A 1ZBA3 3KQCL 3M1HA 2O0OA 1RUOA 1U8CB 2HWE2 1G9AA 4N7IA 3R05A 1KS4A 1CIWA 2Q1JB 4BXWA 1GKBA 1VBB1 1IVOC 1M06G 5LRSA 2OVUA 3BT2A 1GYKA 3MIGA 1FOD3 2B5HA 5T50A 1LODA 1WLWA 4ISIL 4Y24A 1MZFA 5JR7B 1YIPA 3ATGA 3D6EA 4Z2WA 4LTAA 1GZWB 4P9WA 3ILRA 4LT5A 1ZRRA 3KQDL 4AGVA 1G86A 3CA7A 4LA3A 2XWBB 2WZR3 4XQWA 4JDOA 2NPIA 1CVUA 3AYDA 2Y82B 2Q1ZB 4OULA 5JLVA 1BZWA 2P3FL 4MZUA 4E4SA 1QH7A 1V6LA 4GH4C 1PVXA 5BNNB 1TME1 2Y7XB 5EXOA 2KV4A 5HI0A 1JHNA 5J96B 3M3EA 4S2HA 4IV1C 1E57A 4Q4Y2 4XTMA 1JBCA 2P3IA 5E8DA 3MF6A 5KC6A 1NLRA 1O5DL 2Z2SB 4X6RB 2DCZA 4YYOA 4AVAA 2PR3B 1AR83 2ATFA 1QOSA 1C8M1 2YY1A 2RS33 3BPZA 4HANA 1ZAQA 4XF3A 1JH5A 1WCKA 1RUG2 3ZX7A 3BCWA 1XKAL 2AH2A 2QUOA 2E9QA 4CDWC 1PIV2 3U7UG 1LB2A 2WA3A 4XTPA 1VBA1 1FMD3 1W6NB 2RS53 2W2ME 1RUC2 2ZABA 4XHBA 4AFBA 4AGRA 4B7KA 3OTFA 5L36A 1RUI1 5JPNB 1WCDJ 3EHKA 3SCGA 3VBUB 3H1MA 2QE3A 4J1XA 3CS7L 2DVAA 2RMU1 4OHWA 2WJSA 2NLRA 1LOCA 4HN0A 4EV0A 1AYM2 4E1GA 3E6BA 2LM3A 2QDNA 1A8MA 1AXKA 2XVKA 4RGAA 3VBHC 5DDJ3 1XYOA 4Q4W3 3NKTA 4UW6A 1MVEA 2TGFA 4D0FA 1JN2P 2BNOA 4XF1A 3FLRA 1V6JA 2R49A 3NVCA 3POSA 3KCCA 1XNKA 2H0VA 5K9YA 4BDWA 2BFUS 1IS4A 3KT7A 3AYCA 5GKAC 1J3PA 1RVF2 2GC0A 1I1EA 3ZFEC 5FREA 1R081 2BZ6L 4WM7C 3DUIA 5C6CA 5CADA 4M11A 1YIFA 3O0VA 4K8FA 4BZ4A 2DUPA 1ZRCA 2HWB1 3E97A 5FMOL 3TYJA 5F6LB 3B9IA 4N43C 1VB2A 4TWTA 5JOWA 1H2NA 1DQ5A 1Z7S2 3JZVA 2FZ2A 2XC4L 2CGPA 4C90A 5T5PA 3MDLA 4L97A 1AYN1 1WHFA 2ZTNA 3E5XA 2W2QE 4ONUA 3UV9A 2WT0A 1PNGA 5JZGC 2E7QA 1KQRA 1AL0G 1H1MA 3VKLA 2IZWA 4M3CE 5CVRA 5COXA 4C91A 4GKYA 3RPQA 5CB7A 1MEC2 5GJ6A 4AVCA 3ECQA 5E89A 1K37A 5IK5A 1AR71 1YO8A 4IV3B 1IP0A 1DFQA 4I3GA 3AP4A 1DZTA 4JQRA 1RUJ1 1QQP1 3VKFC 2WA4A 3GHNA 3VZJA 2ZKNA 3O12A 1H4HA 1KDMA 4RQPC 4YM0A 1XRUA 3LTGD 1PO21 3JQXA 2VWOL 2VWLL 2CNAA 3AYEA 1RMU1 1ZZBA 2W2NE 1POV3 2UYAA 4Q0UA 1MQTB 1SMVA 4CTEA 4ASMB 1CONA 3IITB 3BOWA 2ARBA 3EO6A 3ZMNA 2R16A 4IV3A 5FQ0A 1FE2A 2ZZJA 1RGSA 4XLWA 3KQBL 5CG8A 3B93A 4ITCA 4XHXA 3RS6A 3MIEA 1CVNA 3ZXDA 1O7FA 5JMCA 1YYNA 1HV1A 2R063 1A8DA 5JSRA 4FPJA 1BEV2 4D94A 1YFXA 1Y43B 3ENRA 2D7FA 1VB4A 2GNTA 4RGGA 1XFEA 4ZAEB 3H3UA 4HPKA 2W08A 2DF7A 2RJKA 4MV2A 1S2KA 4CP0A 1TLEA 4LR4A 4QMAA 5GLVA 4IEVA 2BQ7A 1LECA 4YW3A 1NCRB 2JENA 1K5MB 1J1LA 2VVVL 3PHMA 4QX5A 4YARA 3OBRA 5AC91 1ZREA 1ULGA 2ZGOA 1GICA 1J3RA 3AKRA 5EYXA 5F9TA 2UWCA 2LALA 5T54A 4IESA 1ZBA1 1O3TA 3RYKA 4RSUA 2WZPP 4MXVA 1GQGA 2VPVA 2XLGA 3M37L 5KXEA 2ZMNA 1GZCA 3HS5A 1ZA4A 4AGGA 4LBOA 2ZHNA 2GNBA 4RHV2 2GD4A 1FOD1 4XFGA 1NCRA 2XL7A 4AYUA 3OBTA 5KBFA 1H2KA 2JG9C 2ZBJA 1LENA 3ROUA 1OI6A 1IQLL 3AZZA 3QACA 1H8VA 3WDUA 4ISHL 1FPN3 5C8WA 2RS12 4XETA 1JOJA 2UY9A 3NTGA 2VY0A 4COXA 4MXWA 4WM8C 5DG1A 1R1ZA 1FFMA 2RM23 2WZR1 5C8CC 2HWE1 1M4WA 3MLJA 1ZZ6A 3EQEA 3ST7A 3LAQA 2J2UB 2QFEA 2ZGMA 4K21A 3X29B 2DURA 3JD73 4OHYA 2HWC3 4GULA 3DEMA 1YCIA 2WFF3 3MYXA 3WQ0A 4IEYA 1YUFA 4NN0A 4QQLA 5I8YA 3HT2A 1LKNA 5GALA 4Y6DB 5L19A 3KT4A 1ALYA 1L5GB 5KHIA 5C9AA 4YM2A 2ZKLA 1RL3A 5A32A 2MNGA 1AR81 4X8UL 4XFCA 3C3VA 4JZDL 1NA1A 2RS31 1QJU3 4BH9A 4RRYA 3TN93 1V9U2 5F1RA 1OKQA 1JYCA 2VOXA 2WLQA 3V0BB 1D4VB 2WC2A 4HKLA 4IEXA 4XDQA 1DQBA 2EAAA 4Q4Y1 3MLKA 2HWF3 4LMFA 1FMD1 4JZFL 1EV12 3D0SA 3SOVA 1UAIA 1QY4A 3ZN5A 2O8OA 3GF6A 4NGAL 5GLUA 2XBYL 1ATEA 3WCRA 1EBVA 5F1AA 3RJRA 4MVTA 1UD1A 2G9FA 3AP7A 3U0ZA 4FTSA