3TBDA

Crystal structure of domain vi and le1 of human netrin-g2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
331
Chain Sequence
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Netrin-G2
publication title Crystal structure of the ligand binding domain of netrin g2.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00053 Laminin_EGF Laminin EGF domain
A PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3tbdA01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3tbdA02
1MOXC 3SOVA 1EMNA 1PGEA 4LMFA 2B7DL 1QFKL 3Q7DA 5IKQA 1NFUB 1HREA 1P0SL 2FZZL 2WPKE 4JYVL 1HX2A 1ZAQA 2J2UB 3HO4A 4OTYA 2FLGA 4RS0A 5IKVA 1UZPA 3ENSA 2WG3C 3GISX 1F0RB 5JW1A 3HS6A 2VWOL 1EQGA 1TLEA 3LTFB 3DEMA 2J4IB 2MGPA 1EAIC 1HZ8A 5JVZA 6COXA 1IOXA 3H5CB 2W3IB 1EGFA 2XC5L 1HRFA 1LMJA 2J38B 1F7EA 1YUKB 3KCGL 1IP0A 3KQEL 4JZFL 1DVAL 5CKQA 1EPJA 3CFWA 1P9JA 1DDXA 3N8YA 1V3XB 1COUA 2BQ7A 3KL6B 2MGRA 1HJ7A 3V64C 1IOEL 4YZUB 3N8XA 1APQA 2EI8B 2MHPA 4D90A 2RA0L 4NA9L 3HS5A 1NZIA 4RRXA 3BT2A 4Z0KB 1F7MA 5I46L 1UZKA 1CVWL 2UWOB 1G1QA 5KN5C 1U67A 3N8YB 1Q4GA 4PH9A 3TK5B 1FFMA 1IQIL 4BDXA 5L2ZL 2WPLE 3LN0A 1IQJL 3KRKA 1G1RA 2VH6B 1FAXL 4CUEA 2G00L 4AQTA 1C5MF 1KLIL 3R05A 4X8VL 4ZXYL 4M10A 1X7AL 1CCFA 2OYEP 2VWNL 1LQDA 3KK6A 5L30L 4PLNA 1AUTL 2VH0B 3SOQA 2I9AA 4YT6L 2KL7A 1HT8A 1W8BL 1DQBA 2I9BA 1APOA 3OLUA 2P28B 3F1SB 1HCGB 1U8CB 2P93L 1CCVA 4MMYB 1W7XL 3PGHA 1IGZA 2NPRA 4XBMA 1IJQA 1NT0A 2P3UA 1IQML 1YGCL 2Y80B 2WPHE 2RHPA 1J9CL 2F9BL 2J94B 2P16L 3IJEB 1G2MB 1EZQB 5JBCE 3TH3L 2XBWL 1JBUL 3FBYA 2Y5HL 4RRWA 1EPHA 2J95B 3N8WB 1XDTR 1K36A 1KLOA 3HO5A 5K0HB 4ZAEB 5COXA 3LN1A 2WFTA 1ATBA 3LC3B 2TGFA 2Y82B 1IQHL 2VWMK 1EBVA 3ZYGA 3HO3A 3M36L 1ATAA 1NQLB 1CX2A 2Q1JB 4Y71B 2PHBB 1CVUA 1FSBA 1WHFA 3U73A 3MQEA 2K2TA 4G1MB 4PLOA 1PRHA 3OLTA 1L3YA 4XLWA 4BDWA 1KSNB 1IQKL 3NJPC 2EI6B 3RR3A 1RFNB 1YUGA 2H9EL 5JB9E 2WG4B 2WYJB 3POYA 5FDQA 1BF9A 1G1SA 2W26B 4M11A 3BT1A 3FFGL 5CKMA 3FCSB 1EPGA 3ZYJB 2WPJE 3Q3KB 5JBBE 1B9WA 1K37A 1A3PA 4COXA 1ADXA 1IQGL 4MMZB 5L2YL 5IKTA 1I0UA 2KB9A 1EMOA 1LPKA 4LORA 2FD6A 2W3KB 2BZ6L 1XKAL 1FF7A 1IGXA 2XBYL 2UWPB 3KQCL 4URTA 4CSYA 3NTBA 3U7UG 3ELAL 3TK6B 4FM5A 4E1GA 3KQDL 2BQ6A 3P5BL 2K2SB 4BTIA 2BOKL 3EGFA 5E8DA 4Y7AB 1EPIA 1OB1C 1FJSL 4ISIL 4RUTA 2VJ3A 3GCXE 1IQEL 1SZBA 2P94L 2W2QE 4X8TL 3LAQA 4AQSA 4JZEL 4ZH8B 2W86A 4BXSA 3NT1A 4NG9L 3ASIA 5F19A 2WFXB 3NTGA 4YT7L 1Z6CA 2P3FL 2Y81B 1HAEA 2Y5GL 5KIRA 5CISA 2P3FN 5JBAE 3V65B 2OYUP 1TPGA 1Z6EL 1PXXA 3QMOA 4Y76B 4JZDL 1WU1B 5IKRA 1L5GB 2BOHA 2XC0L 3IITB 2AYLA 3SOBB 2M74A 4X8SL 3GCWE 3LC5B 1JL9A 3CS7L 1CEJA 3LIWB 1JV2B 1NPEB 3SW2A 4CUDA 2GD4A 2W2OE 2DDUA 2CJIB 1PTHA 1LPZA 1IVOC 5CKNA 2UWLB 2YGPA 3TZIA 2BMGA 2EI7B 2XBXL 5F1AA 1PFXL 1ATDA 2XBVL 4A7IA 3K9XA 4BTTA 1DX5I 1GK5A 3F6UL 3LTGD 3MDLA 2BOUA 4Y7BB 1FE2A 1G2LB 4Y6DB 1MQ5L 4BTUA 1NFYB 2VVVL 2BO2A 2P95L 2D1JB 4MMXB 3QH0A 4D0EA 1KIGL 1HAFA 1YO8A 2BOXA 4X8UL 4TGFA 4Y79B 4ZXXL 4JYUL 1CQEA 3TBDA 1MQ6L 2Y7XB 2Y38A 1F0SB 2WYGB 3CA7A 4ZHAB 2FLBL 4D0FA 1EQHA 3M37L 1M1XB 2P26A 5JVYA 4CUFA 3CENL 1G1TA 4O1ZA 5JB8E 1URKA 1DIYA 2W2NE 1HT5A 4Z6AL 3N8VA 2W2ME 3HPTA 4C16A 3ZYIB 2VVUL 5EGMB 4BXWA 1KLJL 2Y7ZB 3C9AC 4XL1A 1FAKL 2KV4A 3HS7A 2VVCK 2RNLA 3TGFA 1IQNL 2ADXA 2XC4L 4RRZA 4OTJA 2BQWA 4OVEA 3N8ZA 1NFWB 1UZJA 4PLMA 4Z0LA 1O5DL 1WHEA 2J34B 2WPME 4RRYA 4NGAL 1N1IA 1XFEA 4ISHL 1UZQA 1TOZA 2FLRL 2P3TA 3QCWA 2JKHL 1ATEA 2W2PE 3BPSE 1LPGA 2WPIE 1XKBA 2PR3B 1YUFA 2PUQL 3N8WA 2YGOA 4O02B 1N7DA 3KQBL 1NFXB 2Y5FL 2VWLL 1IQLL 1IQFL
chains in the Genus database with same CATH superfamily
1O3SA 1MOXC 3EXUA 2B7DL 3CJIB 4R9CA 4N53C 3VKNA 3S5AA 5FP7A 3B7MA 1SCSA 4RFRB 3GBWA 3WHTA 5A7OA 1VE0A 1UIKA 2BT8A 5FYVA 5L7OA 1EAH3 3EO6A 2V4VA 3V0BB 2R073 4N9HA 4RHV2 3R6SA 2JG9C 2AC1A 5FZMA 2Q8DA 1C8M2 1IGOA 3AZXA 2C6SA 3UESA 3OGVA 4GKYA 5FIXA 3VDDC 1HX2A 3VBFA 1AX1A 3WHUA 5GZGA 4ZPIA 1H2MA 2IXKA 3HO4A 3NJVA 2YBSA 2YZ4A 1A8DA 3H9AA 2QQNA 4Y20B 4RS0A 1RUD2 4BH9A 5KBFA 3LPFA 1F0RB 1DGLA 3HS6A 1PMHX 1TLEA 2BNMA 3SXWA 5EFUA 3U4XA 4K40A 1SLCA 1OA2A 3AVSA 3HT1A 2A6ZA 4FP2A 4YWAA 3PUAA 5FMOS 5L7OB 1EAIC 1LHWA 3K46A 1UY2A 1U5IA 5D21A 3RZZA 2VMEA 3AK0A 4NMIA 1DQ0A 4DB5A 3IBMA 1PO23 3H50A 1ZRCA 1IOXA 1QF3A 3PUSA 1LULA 3MGUA 3VBFB 1O3QA 2W3IB 5FLHA 1KD7A 1DQ2A 2ZZQA 2XC5L 3WQ7A 3UL2A 2C0ZA 1OOPC 2ADDA 3F2ZA 4KWKA 2EXJA 5BXXA 4BU2A 2FDIA 1EPJA 2IXLA 3J7NA 2AENA 1W3VA 5IVBA 3N9OA 2AYHA 1W6OA 1KGYA 2YPJA 1ZBE3 4M4PA 1V3XB 2BPA2 4G3YC 2BQ7A 4OI0A 1ZZ9A 2BERA 4DUWA 5E16A 3I2KA 2BW8A 2QQVA 2DVBA 3U78A 5I0SA 1S0GA 5FZ8A 2VCAA 2VW2A 4IE5A 4WVWA 1WW4A 3DXTA 4EN8B 2RA0L 5FPXA 1Z78A 2JDAA 4N8MA 3ZSKA 3BI3A 1XNTA 4F7ZA 2VC9A 1FAYA 5HCAA 3DGTA 1DZQA 3GZUC 1QY4A 2C9AA 5SV5A 4META 3EJKA 3TYJA 3HOBA 3WY6A 1CAUA 2PFWA 5I91A 2JB4A 1RVF1 1HQNA 1PO12 5KN5C 1I5PA 2CWMA 5A7NA 4MZUA 2VQ0A 1H6XA 1W6OB 3U75A 1Q4GA 2PHLA 4LT5A 5CAZA 2AREA 1YXWA 3RJ2X 1NCQA 4NVPA 1ZRRA 4BDXA 2DTYA 3O7OA 1QQP2 5L2ZL 4FI9A 4IXLA 4RGKA 3ST7A 1UCXA 3ZYHA 5FP3A 2D3RA 2Q1MA 4S2HA 1JHJA 4JQRA 1VRH2 2WFF1 4H7MA 4JC1A 2H9EC 2OPWA 3FC0A 4GQ7A 4N7UA 4QPGA 4WVZA 2HEVF 4XBNA 3NNGA 1G1RA 4YW7A 4BOWA 2IXHA 1CAUB 2A1XA 2VH6B 2QQUA 3VD3A 1WGPA 2N7GA 3I8TA 3N9PA 1FAXL 4YPJA 1PZ7A 4CUEA 3HMYA 4AQTA 1COV1 1C5MF 1KLIL 3MHZA 1VBA3 3R05A 1HJFA 1S0FA 3GZTB 4X8VL 4RA0A 5EV7A 1NCQB 4M10A 1UOJA 1UKRA 1X7AL 1UU4A 3IDAA 1QOTA 5FUNA 3ZXEA 5DMYA 2JJ6A 2VWNL 1W8UA 3LSEA 4AVSA 1GNYA 2G1MA 2WZR1 2XKPA 1YJKA 3VZJA 4JQTA 2TEPA 4QPGB 4AHXA 4AI9A 4COZA 1NZCA 2Y6GA 4LOTA 4L8QA 3SOQA 1ZBA3 4V1PA 1C8M1 1ULOA 5CADA 4AAXA 4WM8A 1OKOA 2C5DA 1ZM1A 1HT8A 3U1XA 1DQBA 1APOA 5A1FA 5LW9A 2E63A 4DRRA 1CIWA 2UYBA 1VPHA 2Q4SA 4IEPA 1DGRA 2WLPA 2BDRA 2P93L 4P9LA 1RUD1 2VVFA 5JOXA 4PDWA 1CCVA 2XOMA 4MMYB 2RS53 1IS5A 4HSLA 3PGHA 2NPRA 1RUF3 2O14A 4AGGA 4Q5OA 3MFAA 2DURA 4D6SA 2BZDA 5FZOA 1IJQA 1NT0A 1SLLA 3JUUA 4JDNA 3UJQA 3VLBB 1AZDA 1YGCL 1G9FA 3B9IA 4MX3A 2D6NA 2RHPA 1K45A 1WZXA 1XB9A 1OLME 1QEXA 1S1AA 1VBB3 1HXS3 3UKVA 2J1SA 3IJEB 1V6IA 1L7QA 3ITQA 3OPWA 4QXCA 3ZKYA 3IIIA 2YGQA 5FZ6A 1W90A 2PMWB 1ZRIA 2WL1A 2Z2SB 3W5MA 1NA1B 4V2WA 3BUCA 3I7DA 3AKQA 1EPHA 5L9RA 2UURA 3N7JA 3IAQA 2VW0A 5LA9A 2D3PA 5COXA 2DVAA 4GB32 3Q8FA 3OBAA 1OLQA 5FZOB 4PT6A 5FTTC 4KWUA 4QU1A 3CDZB 4QX5A 4CU7A 2Y82B 4FT8A 4GMP0 4LHLA 3UJOA 4P5HA 2VWMK 5GLTA 1EBVA 2E26A 2RS33 1AL23 1Z7S1 5FYBA 1OD5A 2Q1JB 3THDA 3NAPC 3FLRA 4DXTA 2QDRA 5FPUA 1PO11 4XVHA 3WP4A 1CAWA 3HAGA 4WM7B 4AGRA 4E27A 4G1MB 1UYPA 1DLCA 4Z07A 4X6RB 1PRHA 1APNA 2XBO3 1L3YA 5FWEA 3EMRA 5LATA 1G86A 3WF1A 2ARCA 2X8KA 4Z1VA 1VRH1 2GNBA 2OA2A 2HWC1 3BU0A 1W9TA 2KXLA 2XR4A 3GZAA 3N4MA 2EI6B 1CR7A 1V9U3 4WVMA 3RR3A 4NJ4A 4P5YA 3DPRB 3VB9A 2ZMKA 1C28A 1KJLA 3ES1A 1DQ5A 3HN1A 1PNFA 3P3PA 2PHXA 4HSJA 2FZ2A 1FMD2 1DGRN 1EPZA 3AYCA 4GZ9A 4DXZA 5C4WC 4RN5A 3ZYFA 2XGXA 4QPYA 2WYJB 2ZGUA 4W6YA 4EWEA 2WT1A 4P9GA 3POYA 3USUA 1Y4WA 5FDQA 2WO7A 3WNPA 1G1SA 4QDRA 2PELA 4YW2A 4WV8A 5JSPA 1W39A 5CVRA 3MICA 3FCSB 1Q8OA 2WPJE 4QM8A 4JTNA 1JUHA 2W68A 2DU1A 2VMFA 2WS93 3I97A 5E1RA 1CAXB 3HWJA 1SLBA 1SFPA 4S2FA 4E8CA 2ZX0A 1Y43B 1MQTA 4WVMB 5LEJA 5A1AA 1YCIA 4K3UA 1LU1A 2K2SA 4TWTA 2PLV3 5C6CA 2OS2A 3AMNA 2VOKA 2CGOA 4B1LA 4OI1A 1VR3A 1EMOA 1U5ZA 1G6NA 2IVIB 2O1QA 5BV6A 2WO1A 1XKAL 2R072 4LBKA 2B39A 1IGXA 2BYVE 4NROA 3HJRA 3OUIA 2XB6C 4MO3M 1YHFA 4FAGA 5F1RA 2NP0A 4S2DA 2VUAA 4RR3A 3PDQA 5JAXA 3NTBA 2I2SA 4HK8A 2RDNA 4JDMA 4ZU4A 3VZNA 1J3PA 1ZRFA 1SBFA 4OCTA 1MQTB 4XZPA 5C71A 1JYXA 3CU7A 3OPZA 3OJBA 1D4VB 2JD4A 2K2SB 3KLSA 3BIWE 5CFCB 4MLOA 2VNGA 5IUQA 4Y7AB 3RWKX 4QQOA 2WYFA 3C2UA 3VD7A 2DVDA 2HYKA 4XBQA 1W2AX 3ATGA 3IDEA 3RZKA 5FZCA 3AC0A 2VJ3A 2X5IA 1QH7A 2DCYA 3OBZA 3GCXE 4LKEA 4MSVA 3POWA 1PO22 1YYNA 1UNBA 1OC1A 2W2QE 1YQ2A 4RL7A 5ANQA 1CAVA 4NIDA 3CZJA 4H7LA 3CLPA 3UYJA 3O1RA 4NHMA 4QGMA 2F4LA 1W0PA 1CX1A 3OBTA 1O8SA 4QXHA 5HI0A 1IG3A 3ASIA 4W4ZA 3MZHA 4GB31 3CHXA 2ZGNA 4NHLA 1H9PA 1UZYA 2J1VA 3BPSA 3DYOA 3AXEA 1GP6A 3ZDSA 2Y81B 1UOBA 3KT1A 4PCRA 4XJZA 3WP6A 5FY8A 2QQIA 2Y6FA 2X5IB 2GC1A 3LKJA 5DZEA 4HKWA 5CB7A 5C9AC 1O59A 3WQ1A 2EALA 5I0RA 1CAVB 4ZHNA 2WINB 2X29A 1TPGA 2XVKA 1YIFA 3NNFA 4N43A 4AVAA 1UYZA 2FBEA 2CAVA 3D8CA 1BVP1 1UX6A 2RE9A 1YJLA 3RWNA 2KR2A 5FYMA 3VBRA 4NRQA 2BOHA 4AVTA 3VBHC 3IITB 2AYLA 1AR83 2XG3A 2M74A 2XUMA 3J9SA 3GCWE 3PU8A 4KNCA 3VZLA 2Y6HA 1XYNA 1W3XA 1F2NA 1W8NA 1W2TA 2ILMA 2JXAA 1C5HA 1MR5A 4AW7A 2XHKA 4F83A 2D44A 2DDUA 1FMD1 2CJIB 2BTVC 1DU3D 2P4EA 3DUIA 4GMP1 3L9JT 4I09A 3C7HA 1AR73 3ILFA 1WA6X 2K46A 5HV4A 3TN92 2W9XA 5CIRA 1TME2 3ILNA 2JENA 5FBZA 3WDWA 2NYYA 1BK0A 3FFZA 1W8FA 1WD4A 4LBLA 4N9IA 3NL1A 2WBKA 2XBXL 1PFXL 1QJEA 2TBVA 4Q4V1 4R9BA 4Z2AA 3BTYA 2XBVL 3TB0A 5HCHA 4A7IA 1D2SA 5FKBA 1IZ3A 4XIKA 2VULA 1DX5I 1AJKA 2YXSA 5AVPA 5FWJA 4OUEA 4S2GA 1Q56A 2R0FA 4EQVA 4AI8A 3VKMA 1W6PB 3MDLA 4LUKA 2WR9A 5BNPB 4Y7BB 3CL1A 3ZMNA 4HBNA 4AVVA 5FZEA 1UD1A 2R071 1OA3A 3LDKA 2WJSA 5A32B 4FSJA 4KWLA 4BTUA 1NFYB 1ZBA2 3H7YA 4J1XA 4QHOA 2VVVL 5I8SA 3LEMA 3ZSEA 2E32A 2E53A 1KIGL 1W6NA 4EZ4A 1WCQA 3LDBA 3KV6A 2OKXA 2WYSA 4TGFA 1RVF3 5IVVA 2EA7A 2JDUA 3J7HA 4OHVA 4X6QB 3CMGA 4JYUL 5FO9B 4AI1A 1SPPA 2QE3A 4UW6A 1XNKA 3S0MA 3HR9A 4NHYA 5FO7B 2Y38A 3IMMA 4JGYB 4PIZA 4XCBA 2WYGB 3CA7A 1S0BA 4GWIA 3THTA 3ZM8A 4YSFA 5LY1A 2H6BA 5LCWL 4KBBA 3WF2A 1EQHA 1S55A 1PO21 2DBNA 4ES8A 1KFXL 1GV9A 2P26A 2DWRA 4Y1XA 5K0UB 3TWIA 5JVYA 3AZWA 4NIGA 2VZ3A 3F95A 3GYDA 4YGCA 1W6NB 4GA9A 2C24A 2ZAHA 4EYUA 2OQ6A 1RUC3 5LBEA 4CUFA 4O61A 4Q4X2 3THCA 3CQOA 3O0VA 1COV3 1YI7A 2D6LX 3RSJA 1ZBE1 2VRSA 1ND2B 2JWPA 2LS6A 2WT0A 1EUUA 2IWGB 2D6KA 2JDZA 1J3RA 2ET1A 2XL9A 1Q8SA 4E2GA 1LMMA 3N36A 5J7MA 3ZN6A 4PBOA 1URKA 4Q1RA 1C4RA 4FTSA 2PN5A 1JBCA 2ZGOA 4UWDA 4CP1A 1HT5A 1MS8A 4P9JA 5FZ9A 3H8RA 4CP0A 2AR6A 1GSLA 5DXDA 4X8PA 1N1TA 4R4XA 2P3YA 2ZEYA 4RHV3 3FE5A 2RS32 4KI5M 2ZGPA 4JHTA 2VVUL 5EGMB 1AL22 2OZJA 3WDXA 4C8DA 4CA9A 4CTEA 5LA1A 4B7KA 1YQ6A 4YW6A 1W9YA 2WNVC 3WP3A 1FAKL 2VOWA 2KV4A 3SEEA 2XLGA 3ABZA 4YM1A 1QGLA 4BM8A 5FPBA 2WSUA 3RVHA 1W05A 1RUD3 3H1YA 5J09A 4R52A 4AFMA 5LA2A 4E2QA 1FYUA 4RRZA 1RUE2 1VAVA 2DCKA 2BQWA 3C3VA 3KV4A 4CEYA 4D6QA 4KWJA 1O5LA 2P6HA 3GM8A 1NFWB 3I59A 2VJXA 1JI6A 1UZJA 2EXKA 2BVBA 2E9QA 2PHTA 5DAWA 1RINA 1WHEA 4JRAA 1R082 1WD3A 4ZZ8A 3M8LA 1AR92 1S0IA 3GJBA 3HEIA 3ZXKA 4RRYA 4WM7C 3IDCB 3RPQA 1VMJA 4CCKA 4NGAL 2B7YA 1XYPA 2R0HA 3AFGA 4Y5TA 4A44A 4XBLA 4DEVA 3BIEA 5I93A 4FVVA 4ISHL 1TEIA 3HD8B 2LW8A 4XFFA 3QCWA 3E6DA 1PNGA 2NPIA 1ATEA 2W0XA 2WC2A 4Q0QA 3WUCA 3BPSE 1O3TA 2WAOA 4NIIA 3DPRC 3I59B 4ATEA 4UF0A 2PR3B 1XE0A 1ZBA1 4HG6B 4IE6A 4EN0A 1KDMA 3UGHA 1JZ6A 3A4UA 1I3HA 4JKLA 3FN9A 3QOPA 5FZGA 5C8WA 3GNEA 5G04L 2YUEA 1CQ9A 1CX4A 1OFSA 1QJZA 2VZTA 3OGRA 1ZZCA 2DUPA 4YM2A 4CZSA 2Y5FL 2VWLL 3OYWA 3MW2A 4XOGA 3KCYA 3LA7A 4JGZC 4CEWA 1PK6B 2UY8A 2BWAA 2XL7A 1EMNA 5EZWA 5JSOA 1RTVA 2R1BA 4CE8A 5FZLA 5IVYA 4I0AA 1D4M2 1TMF2 3NV2A 1NFUB 3AL6A 4FPLA 4GULA 5DG2A 1QQP3 1HN0A 3ALQA 4KMQA 2WNOA 2WZEA 4GJYA 5FXZA 4DNYA 2YBPA 1IG0A 2A71A 2B45X 4ASKA 1XE8A 1P0SL 1VRH3 2CSGA 2YC2A 4LK7A 3PVNA 4DUVA 1W9FA 3H3UA 2ZGQA 2WPKE 5K0UC 4JYVL 4QXBA 2EAKA 3N7MA 1WMDA 2HWB2 1HXS1 2Q30A 2YG0A 3PTRB 5FXWA 4DRVA 3WW2A 4P9YA 4Q4X1 2XQRA 4CEWB 2P6CA 3MI8A 1UZPA 3ENSA 4RS5A 5FFOC 4CCOA 2F17A 2WG3C 2VQTA 1H2KA 2JIJA 3DKWA 5DAPA 3ZFEA 3GISX 2W1WA 3E5XA 4WZCA 4XHBA 5LEKA 3EB7A 3WSOA 2PQSA 1KS4A 2VWOL 5C8CA 1PM7A 4COWA 4F8AA 2J4IB 5BNOA 3FLTA 3POFA 2MGPA 2VO5A 3B5LB 1V6LA 1XPWA 1DG6A 2XJTA 5JVZA 4GH4C 3T0DA 4OMDA 4YG0A 3FHQA 1X82A 6COXA 5IVCA 1KITA 4L2NA 2ETEA 2R1DA 2RS31 4MXWB 4D3WA 1AL21 1I9RA 3LAGA 2AUYA 3LFMA 3N9LA 4Z2WA 1HRFA 2JKBA 2A7AA 1Y9QA 2E7TA 4CDWA 2JDMA 1YUKB 4E4SA 3KCGL 3T2OA 3I49A 3KQEL 3EQEA 3JD72 4RS5B 5FYIA 3CFWA 4K20A 1P9JA 3ZFEB 4COVA 3U11A 2FDFA 3QBQA 5T52A 2Q5TA 1OFNA 4BZ4A 5C8CB 5K8SA 3J4UH 2ZHKA 2OVUA 2XBO1 1Y9GA 2R49A 2MGRA 2NMOA 4NRPA 3H7JA 3V64C 4Y4YA 1RUE1 1IOEL 4U2AA 3T4VA 5KC6A 4D90A 3POJA 3WNOA 1UYXA 1BXHA 1HB1A 4RYDA 4IEUA 1XC6A 3SLIA 4CXXA 5IK4A 1UY1A 5LK7B 5D8AC 3HS5A 5A33A 2A5ZA 4I01A 5A7PA 5LK5A 3RFRA 4UT5A 4CDQC 2VL4A 3BT2A 4Z0KB 1F7MA 2Q1FA 3N7KA 4OYUA 4YVWC 1R081 3IWZA 2UWOB 2F6BA 3VBOC 1AR91 2ZHLA 1Y3TA 2VH9A 4I0BA 2ZACA 4UYBA 3EBRA 2D43A 1YRZA 3POSA 1K3IA 4AFDA 1ZZ7A 4QD2A 1F9KA 1WCDJ 3W20A 4MH0E 3ZSMA 1D2QA 1UXXX 2QUOA 2ARAA 2HOXA 3TK5B 1ND3A 2ATFA 1M4WA 1FT9A 2A3WA 4LXLA 5FYCA 4K8RB 1YFWA 3G6JB 4UW4A 4FPGA 2WKKA 1VB2A 1IPJA 2ZX3A 2D6OX 3GJAA 4BXSV 2HWF3 2ARBA 4QDSA 1QJU2 4GB33 3ZYBA 1JTZX 1PGL2 1IQAA 4FTBA 2PLV1 4ARXA 5GZCA 2CDOA 3K4AA 3ACIA 3MO4A 2VZQA 4QKDA 1MVEA 1Q3EA 4DZGA 1LGBA 4RGAA 2MEV2 4LJHA 4HK9A 1VBE3 2A3XA 4V2VA 4YVSC 5C3PA 1UXZA 3KF5A 1V1IA 3RMXA 3X29B 5FYUA 3KHCA 1ND3B 5F3GA 1OPOA 2ZMNA 2VZSA 4OQ8A 5EPAA 5K7PA 4LO4B 3QH7A 2BNNA 4Y33A 1UY0A 1D4M1 1TMF1 4QX1A 2ERFA 4YZ3A 4GXLA 3PUHA 4IV3C 1LQDA 1BHGA 2HEYF 1BLZA 1HRV2 5FPZA 2CYFA 3WW3A 1QIQA 5FYSA 3KT4A 2VH0B 1C3HA 5HXVA 3VBUB 1O6UA 1F4HA 2VU9A 4EN6B 1JU3A 1XQNA 5T5OA 2ENRA 1PHMA 1W8BL 2J1AA 2VCMA 4BQYA 5BUVA 2ET7A 3W9AA 1FMD3 1RL3A 2VE1A 4UW5A 1OLMA 4LBMA 2IXCA 4FPJA 3VDCA 3F1SB 1LOAA 1HCGB 1U8CB 3E6CC 2R062 5IJRA 2XWJB 4TTGA 1K5MB 1EYBA 3JU9A 5J96B 1DDLA 1W7XL 2W46A 1OI6A 1RUC2 3RZGA 4XJAA 5EP9A 5JIAA 4AOCA 5LB6A 2Y6LA 2A70A 3OB8A 4RD7A 3K4DA 2H6CA 1LJ7A 4NO4A 1AHSA 3ZFGB 3ZR5A 1H2LA 3LD8A 4NN0A 2Y80B 2WPHE 4LE3A 5FXXA 2R6QA 2VOXA 3O0WA 3PL0A 1A78A 1VB4A 2HWE2 2PAEA 3R4UA 4PI0A 4XUOA 4YZ2A 1G2MB 3JD71 2VUDA 1H1IA 2VBDA 4MV2A 1O4ZA 2Q8EA 1OVPA 1JOBA 2Y5HL 2JJLA 5A7SA 1ULEA 3UKTA 1Q5OA 1YFUA 2BUKA 1XNCA 2D97A 2J95B 4NPMA 1XXNA 3MLJA 2DCTA 1AR81 2XWBB 1KLOA 3GHNA 5J3UA 5K0HB 4RGGA 4D7TA 3LN1A 1ND2C 2ZOEB 5HCFA 2XHNA 5GLUA 1K12A 3NMBA 3ZN4A 3N35A 2DV9A 4Y1VA 4QMAA 5ABJA 2TGFA 3M3OA 2RG4A 1F15A 1W2OA 4ET7A 4DY3A 1NLSA 4IEOA 1WW5A 1K42A 4Y71B 1AXKA 1JW6A 2PHBB 1LU2A 3ZYRA 1AR71 2W39A 3ZDVA 3ZFFA 3KGLA 4GU3A 2WO2A 1D7PM 2V73A 5K9YA 3PVEA 2RVAA 2WN3A 2G9GA 3P3NA 2LUWA 1OXCA 3AZZA 3H3ZA 1EV12 1KJRA 4PLOA 3OLTA 4D6RA 1MVQA 4B8EA 3ECQA 2FCTA 2JKXA 2YV8A 4MGKE 2LTNA 1CZSA 2WQ8A 1QJU1 2BNOA 2DYCA 1J83A 1WCKA 3KV5A 3VBHA 5ABJB 1PGL1 1POV0 1GU3A 4PIXA 1W8HA 4XF3A 2IXIA 3VDBA 1LOFC 1YUGA 2SLIA 1HIXA 3ZFFB 2HKXA 1OF3A 2BBAA 4A3XA 3DCQA 3K3OA 4SBVA 2XMLA 5FMOL 4DO0A 5CZKA 5EYYA 3JQXA 4XJ9A 1NXMA 4CCNA 3WG3A 2W26B 4M11A 1VAKA 1AR63 5CKMA 2BRTA 1BK1A 2W1UA 4FPYA 4J6GA 1EPGA 3Q3KB 2XLAA 1LOCA 3LA3A 1B9WA 4XACA 4OUMA 3WP5A 3H1MA 1WW6A 2WZ8A 4MADA 1F5JA 5IK5A 4YRDA 4AEKA 3FLPA 4M3CA 1JZ4A 4WZFA 1GMMA 4TYSA 5J98B 3CKHA 2E51A 3K75B 5L2YL 4AEJA 5C33A 3LEIA 5IKTA 1NUKA 4IERA 4DQAA 3RZHA 3PMEA 2W3KB 3T08A 1FF7A 1AXZA 3HVDA 1D0GA 5K4LA 3DYPA 2W08A 3OGJA 3M4FA 2XBYL 2JG8A 1WCSA 2R061 1XSQA 3GCXA 4ZU7A 5FJHA 5F3CA 1B35A 5JZGA 1JYTA 4ONUA 4UBHA 3B02A 4JRLA 3TN93 1GZWA 2JX9A 4AEDC 1GQGA 1TME3 1JYCA 3OEBA 2XVLA 1RUC1 3U7UG 2Y8KA 4PIYA 1PK6C 1UKGA 1H4GA 4IETA 3TK6B 2W91A 4E1GA 1GICA 3PJQA 1HKDA 2ID4A 1J84A 3GXUA 4NIAA 3RS6A 3U37A 4K1YA 3VZMA 2HEWF 3EGFA 5C3OA 5JWPA 3AKPA 2A6WA 1UU6A 3MEPA 1OQ1A 4NUBA 3ZMOA 3VGIA 1C57A 1OB1C 3DKQA 4QGLA 4QU2A 4O65A 4GD4A 3POGA 4RUTA 4BYYA 5FMBA 1FOD3 4DIQA 1JZ2A 2HWE1 3FUOA 2JG8B 1GWKA 1JU4A 4RHV1 1DQ6A 1R1A2 3ZOIA 3BGAA 3FHAA 4AQSA 5JZGB 1GZWB 1RMU2 3PJYA 4FFFA 5H9RA 4ZH8B 2WFPA 3WD5A 4QKNA 1WMFA 2YU1A 3WXPA 3ZX7A 4ASMB 4LO6B 3E1F1 2ORXA 4RSUA 4RQPC 5A70A 4NG9L 1ZRDA 2WA3A 3WQ0A 4DFSA 5F19A 2WFXB 4KQ7A 1J1TA 1Z6CA 3M3IA 3MIEA 4XF1A 1EUTA 3S30A 4YZ5A 5L9VA 2CGPA 3NQHA 2Y5GL 1IPSA 3GCWA 3O5SA 4MOAA 5CISA 1ZREA 2ZBJA 4XCAA 4TSVA 4L11A 3ZIWA 5LA0A 1IS6A 3VBSA 2B9VA 4A6SA 1SACA 3JBG2 4H55A 1LOEA 3FL7A 2O8OA 4IV1C 1QHDA 2Y0OA 1A34A 1V70A 3O1SA 5D1IA 5IVFA 4Y76B 4JZDL 1WU1B 2P17A 4WM8B 5H9QA 1L5GB 1S0EA 3T0BA 3AX4A 3LE0A 3BN6A 1GLHA 2ZMLA 3WG4A 1E57A 3G7DA 2VXJA 3INAA 3OEAA 2WNVA 3T2PA 4Q4X3 3WF4A 4Y1ZA 3CS7L 3SKJE 3R4DB 4PDWB 3VDAA 3SCGA 4AYUA 5DUWA 1SEFA 3TRSB 1JV2B 3SW2A 4NHKA 4W6XA 1TG7A 4XUQA 3NWKA 2ZGLA 2GD4A 1QOOA 5GZDA 4L92A 4Q4W3 4O9EA 1U0AA 1G7YA 1CVNA 2HWF2 3VBSB 3V0AA 5JDBA 4FFGA 5F5AA 3O12A 3U14A 1NCRC 1V6KA 2D5FA 1PTHA 1RUH2 2OUJA 3WQBA 4B29A 2RS12 3RZJA 2OX0A 1LPZA 1C8NA 1W8WA 2X05A 4C0BA 5HV0A 3BTZA 2UWLB 2YGPA 3Q9OA 4LE4A 1UMIA 2CHHA 1KFUL 2BMGA 5B4NA 1REDA 2VUCA 2YC0A 5IVEA 1VBE2 1G9DA 3M3EA 1ATDA 3K48A 2L9LA 3AZYA 1BQPA 1JHNA 2PHUA 4MGSA 3MPPG 1K5JA 2VMHA 4WVVA 3AL5A 1SDDB 2BGOA 1OVSA 2E31A 1QQP1 4Q29A 4ZU5A 4BPZA 3V0AB 1POV1 1G2LB 4IEQA 4Y6DB 2IFWA 4QGNA 4QX3A 1WMXA 4A6OA 1OH3A 1RUE3 3KB5A 4JVAA 3SH5A 4A3ZA 2VR4A 1MS3A 2AEZA 2YMZA 4M4RA 3H8UA 3J7MA 2J7MA 5FZ0A 1LHOA 3NNMA 2VGDA 2RR13 2WUHA 1PX3A 3QH0A 2YC4A 3KSCA 1ZYBA 3I2FA 4D0EA 2BFUS 3SHRA 2R043 3C7EA 1HAFA 1DYPA 4LBNA 4QQPA 1R083 5C70A 4Q4Y3 4X8UL 1AR93 1MS9A 4R4ZA 2JE7A 1CAWB 3ZYPA 4QB1A 2V5YA 4CDXC 1OURA 3B69A 1CQEA 5EYXA 1LTEA 3URFA 2W1QA 2Y7XB 1CJDA 1F0SB 4UFHA 5DPNA 3RYRA 4ZHAB 5A6YA 4FFHA 1LNSA 3LEGA 1CONA 1KQRA 1SBEA 5A3UA 3KZ4C 5JXGA 2PXJA 3GBGA 3I54A 3KMHA 5CFDA 3VBUC 3HNYM 5LBCA 3AP4A 1ZVFA 2LALA 1R1A1 4MHUA 4ZS3A 3ZR6A 5GKAC 3C7GA 1F4AA 1RMU1 3I2DA 4R9DA 5AC92 2KA3A 2WNUC 2FDHA 5GZEA 3D5OA 1UO9A 2GAUA 1JODA 3H8OA 1UPSA 5CYYA 3USUB 2JE8A 3Q8AA 3CENL 3KT7A 3FUQA 3UKNA 3MIDA 2WZPP 2Y6JA 4IDZA 1H8TC 4FPKA 1OKQA 4J25A 4O1ZA 5JB8E 1RGSA 4LKSA 5CNAA 3QH6A 4Z92B 2D5HA 2G9ZA 1CWPA 5GLWA 1D4M3 1FV3A 1TMF3 2P3JA 4YYOA 3SCHA 5CFDB 2QQPA 4M3CE 3N8VA 3FBMA 3JBG1 2W2ME 3VV1A 3CJIC 3HPTA 3LZZA 4Q0PA 4C16A 5FOBB 3VD9A 3ZYIB 2B5HA 1LB2A 2W5FA 1UZVA 1E5SA 3AB0A 5EJ3A 1SLAA 4YW5A 1YFYA 1UWWA 3C9AC 4U36A 2LM3A 2HWB3 4XL1A 4NPLA 5C7GA 1ENSA 1DYOA 2VVCK 3VL9A 1BYHA 2ZHMA 5T50A 1NLQA 4RR3B 4XAAA 1JYNA 2XC4L 4ITCA 2IFRA 3RZLA 3OUJA 3WZ1A 4LPLA 4OTJA 4QQLA 1W6QA 2HWF1 3CF6E 2VZVA 3E5QA 3AVRA 4B3NA 4OVEA 4I02A 3N8ZA 3RMYA 2RS11 2Z4FA 4JKMA 5FY0A 1MZ5A 4AVBA 4Z0LA 1O5DL 4L0PA 5L7OC 2R16A 1MACA 3GDBA 2BBVA 3EYPA 4QPIA 1VBE1 4XABA 1O7FA 1QKQA 4CDQA 1HRI2 1REEA 3BTXA 5JR7B 2ADEA 3VBFC 3JD73 1N1IA 1AR62 2LRPA 1XFEA 3MLLA 5FR3A 1W0NA 3IN9A 3K77A 4L9BA 1TOZA 4ZXEA 2P3TA 1NOVA 3RJRA 2ZX4A 1DIWA 1LODA 4KGGA 4IESA 1X7NA 5DAVA 5FQ0A 4E9KA 5FZFA 2HORA 5A3WA 3WT3A 3VL8A 2VNVA 4IUGA 4IGPA 3TEWA 4YGBA 2WPIE 1R092 1DYKA 4YM0A 1YUFA 1XSRA 2Y60A 2ZAAA 5GZFA 5IK7A 4AQ6A 3WLUA 5E8AA 4FP3A 3N8WA 2YGOA 2FZ1A 2ZZJA 4CDUA 5KR7A 5KXEA 3L2YA 1NFXB 4AI0A 1TVGA 3KCCA 1AJOA 1IQFL 3APBA 5JOWA 4N43B 1N1SA 1XJAA 3NSTA 3NJYA 4LMFA 3H42B 4YGEA 2OYZA 4HVQA 3A0KA 1DGWX 3PVBB 1VRBA 2YHJA 2A6VA 3CIHA 3VBRB 3ZXLA 5I8YA 1RHI2 3AP7A 3OG2A 1HREA 4YGDA 1F5FA 4P9IA 1FI2A 1V6MA 5C5UA 4BK4A 2XJRA 3CJXA 1L3JA 1LRHA 2QVSB 5CBLA 4XMAA 1QJU3 5DZGA 4W50A 1RUJ2 3ACGA 1PX4A 5FZ7A 2FZZL 1RUNA 2P37A 4CDUB 4BXFA 5AC91 2CU5A 4MGTA 1ZAQA 1CIYA 3O1VA 1FOD2 2GP5A 2VZRA 4OTYA 1SQ4A 2QQLA 3RZMA 1H4HA 2FLGA 4P9XA 4A4AA 2MEV3 3H1WA 5ACA2 4B4PA 4CSWA 1OT5A 5BNNA 3GALA 1YC61 2JDNA 3ZLIA 2VUJA 3O1TA 5JW1A 2P34A 3DEMA 1HJGA 4ORFA 2OT7A 2XVGA 1GBGA 3P5BA 1NCQC 2DUOA 4G4FA 1YNAA 5FK7A 3AKTA 3D0SA 1STMA 4C1XA 5IFTA 2BJSA 1LOBA 2CGNA 1HRV3 3HN3A 3POIA 3K51A 3M3CA 4AI3A 4OZOA 4RFT0 4QPGC 2E6VA 1RJ7A 3PU3A 1LMJA 3P1IA 3T09A 2J38B 2P3KA 1F7EA 2B46X 2Y33A 2H0VA 4CP9A 1IP0A 5BNNB 4JZFL 3JZVA 4O9GA 1DVAL 1BJQA 4N53A 1DDXA 4AFCA 5F3IA 4X8NA 3WV6A 4YW1A 4NR1A 3WDYA 2R063 4JTOA 4BE3A 3ZO0B 1COUA 1IPKA 5JVVA 2Q8CA 2GNTA 1ENRA 3WNKA 2JG9A 1HJ7A 5ANNA 3OPTA 4K1ZA 3AJZA 2JEMA 4OHZA 3VDDA 3N8XA 4Q1PA 2EI8B 3TAYA 5JLVA 5DDJ3 3N9QA 1VBC2 3LIHA 3ZKUA 1SPPB 5EIYB 4NA9L 4AHZA 3LFIA 3C7OA 4XXAA 3BALA 3ZSJA 1NZIA 2VCCA 4IE0A 5FP4A 5A3NA 5JCTA 2D6MA 4NIHA 4Q4W2 5I46L 1UZKA 1E5RA 2ZGMA 3MIBA 4CP9B 3C7FA 5LRSA 2BEOA 1G1QA 2YFUA 2ZS6B 4QXKA 4GJZA 1WCUA 1HRI1 5I8TA 2HWE3 3I2IA 4ASLA 3I4IA 4E4HA 1AR61 4PH9A 3D6EA 3LGRA 1FFMA 2JG9B 2TNFA 3MV01 2NM1A 2WPLE 3E5UA 2XUEA 3VDDB 1U5XA 1W2UA 4ES9A 1RB8G 4PDWC 1VMFA 4IE4A 1NA1C 1TQ5A 2EVXA 4XJWA 2BOIA 2Z42A 1R091 4Q0UA 1IQJL 1OOPA 5FZKA 5FKCA 3CBNA 3KRKA 2G19A 2WA4A 4NAMA 4Y3OA 3ZN6B 1FX5A 1XU2A 2BT7A 3M70A 3PTYA 3TNPB 3E97A 2AGSA 2W87A 4HVOA 3IM0A 4XUPA 1QJY2 4UBGA 5LASA 4GWNA 4ZXYL 3ETQA 2JDPA 5AVAA 1GANA 2RR12 4BLJA 3TN91 1BMV2 1CCFA 2R32A 1TME1 1HQWA 2OYEP 2R042 1JOPA 1GNHA 3AXDA 2VZUA 1EV13 4G9SB 4Q4Y2 4CUBA 1SHWB 1HLCA 4KL1A 4NOTA 4MVTA 1R64A 1SFNA 3PUQA 1TZOA 3KF3A 4PLNA 3V65A 4AXOA 1OOPB 3WR0A 2WAAA 1AUTL 3J8F2 5A6XA 1ZNPA 4PJYA 1OA4A 1RUJ1 2I9AA 2FMYA 4Y4RA 5FMDA 2KNIA 1OBNA 5I0TA 5A7QA 2KL7A 2D93A 4SLIA 2WO3A 1FOD1 4CEYB 4PQ9A 2W52A 1HB4A 5J48A 1LENA 2QTWB 4TLFA 2C1FA 2YBKA 3R4SA 2ZABA 1RUG2 4W8JA 5ACA1 1H6YA 2ZGRA 2V5DA 1FXZA 3D82A 1PZ8A 5EJZB 1ZA7A 3O14A 1DHKB 4FAHA 4M00A 2FQPA 1VBD2 1N1VA 2GDFA 1X9PA 4XHXA 1IGZA 3NKTA 4LIUA 3HNBM 4XBMA 3M1HA 3OSDA 5FY9A 1ST8A 5A7WA 1MS5A 4AEDA 1VALA 5J1XA 5KXBA 4NWWA 3KHBA 1FV2A 1JH5A 1LEDA 2XH6A 3SCFA 4HLTA 2NN8A 1UIJA 1T6BX 4UFJA 1J9CL 2F9BL 3M7AA 2J94B 1AYN2 1L7RA 1OUSA 1OLRA 2Q8OA 4N90A 3NV4A 1POV3 5F2WA 5FREA 3O1MA 2W95A 2RJ2A 4UF0B 1EZQB 4QWNA 3VKLA 2XBWL 1N3QA 3FBYA 4RRWA 2WWUA 1S2EA 1WBFA 2VTFA 3JB4C 1DZTA 4FO9A 2A6YA 5T55A 4CCDA 5IVJA 1TE1B 2GSYA 2X09A 1AX0A 4ZAEB 1HV1A 3FHIB 3OD4A 1T2XA 3OYWB 3D0JA 2RM23 3QACA 2JDKA 1ONAA 2Q0AA 2ZJCA 2ES3A 1IQHL 3RDIA 2P5BA 3HO3A 2QZ2A 1MQTC 3M36L 1AYM2 3ACHA 2PHFA 3AKSA 1CX2A 2RJKA 4Q4W1 1J58A 1UMHA 4HOOA 1CVUA 1UZWA 4TN7A 5CFCC 5C3SA 2X53S 1R1ZA 1FSBA 1NE4A 1YQ8A 4AG4A 2VOVA 1JZ7A 3MQEA 1LGCA 2F4PA 1AF9A 1GZ9A 4A94C 2K2TA 1R1A3 2QJVA 3ORJA 3DL3A 4IV1A 4AEMA 4AQ2A 1RMU3 2W1SA 4ATFA 2YFZA 3WCRA 1YIPA 4BMEA 2VNOA 2JIGA 4XLWA 4CU9A 4H2AA 1OUXA 3NJPC 1VP6A 2BQPA 1QJX3 1UF2C 1WLTA 3ZN5A 4HETA 3WCSA 3IB3A 4F3JA 5FYHA 4XXPA 2ZKLA 2H9EL 1S0JA 3ZPYA 5BNOB 3W58A 1WMEA 3S6XA 5JB9E 1DQ1A 1W6MA 3NJXA 2RDRA 1HX6A 2BGPA 1GKBA 4YW4A 5LY2A 1VLNA 1QJY1 5EQUA 3JBG3 4QKFA 2J1TA 1ULPA 5FV3A 4XF9A 4BISA 3BT1A 1ENXA 1W04A 2RR11 2X5IC 3FFGL 1NCRA 1F35A 4Q8KA 2JE9A 3ZYJB 2R041 4W6WA 3WW1A 3WNLA 5JBBE 1C1FA 4Q4Y1 1JZ5A 2J1UA 3U10A 1L7LA 3HIFA 1A3PA 4YARA 4HZFA 1QJFA 3ZXJA 4COXA 3Q8BA 4YZ4A 1PVXA 3NAPA 3SC7X 1UYYA 1ADXA 2D98A 4JDOA 5JXIA 5CG8A 4MMZB 4A7ZA 2WWJA 2GALA 1I0UA 2KB9A 3ZPOA 3W5NA 4PHZA 4LORA 1DLLA 2FD6A 2W2IA 3PHMA 5DUXA 4COUA 2BZ6L 4MYEA 5FZ1A 2VTXJ 5FBJA 1W2NA 1JYVA 2UWPB 4LULA 1RUH3 4COYA 5A33B 3FX3A 2RS13 1KDKA 2XONA 1GZTA 4CCJA 2GC3A 2VQUA 4OZXA 4CSYA 4E4DX 1XE7A 4DXSA 3ELAL 4XF4A 4N43C 3LCPA 4BQ5A 3I2OA 2VXRA 4FM5A 2W94A 3SEPA 3NRUA 4IGQA 2ORZA 5LWBA 4IQPA 2BQ6A 4BTIA 3WNXA 3VBRC 3AP6A 1ENQA 4FPCA 1PGW2 5L9BA 3BOWA 5C4WA 2OUHA 1V6JA 1GOGA 3OD0A 4NWVA 3JCIA 1H30A 3MIGA 1FJSL 5F5CA 3T2TA 4CDXA 4ISIL 2VMDA 1AYN1 2UWCA 5JR2A 4AR2A 1UN1A 5JXHA 1VIWB 4DOUA 3GZEA 4TXWA 5A3LA 4QQ2A 1SZBA 4X8TL 4MGZE 2YGMA 3BOPA 5DAXA 3SQOA 2QZ3A 5BNPC 4Y26A 2WABA 1UZZA 4ZS2A 2W86A 1XU1A 1WLWA 2HWB1 2RJLA 2GMMA 4JV4A 3D3AA 5IHRA 1NG0A 4AWDA 4CVUA 5KHHA 4EE2A 2I07B 1ULGA 4YT7L 2XJPA 3T0AA 1XBFA 5FCCA 3I2JA 5I0UA 4B7EA 5C4WB 4NE9A 1HAEA 2OPKA 2VMCA 3ZXAC 5KIRA 2XDVA 1BMV1 2PQQA 2VG9A 4FOWA 4LBQA 2R7EB 4INDA 2BSFA 5JBAE 4XPVA 3USSA 1GWMA 5DDJ2 2HWD2 3AZVA 5FY7A 2GMPA 4OUSA 5FP8A 4C91A 1S2BA 2HBTA 3N7LA 4Y5SA 4BLIA 4MXVA 3RNSA 4JGYC 3QMOA 1OMIA 3UV9A 1IKPA 3RYPA 1QNWA 1CZTA 5IKRA 3CJIA 4FOQA 2EICA 1V6NA 4UFIA 2DVFA 3A23A 5AC93 2KD7A 2XC0L 4BQXA 1LHVA 2C9KA 2WQZC 3B01A 2WFF2 5ERLA 3T1MA 2GH2A 3LC5B 5E6HA 3THPA 1JL9A 3V0BA 3NNJA 1JXNA 5DAQA 3LIWB 1NPEB 3MF6A 1GOFA 2DUQA 4OQ9A 1US3A 4QM9A 5DZFA 4CUDA 1H0BA 4KBZA 2P3IA 2ZGTA 2VVEA 1W06A 3V56A 1SMVA 2DVGA 1ULFA 1VAMA 1ZZ6A 3ETPA 2Z69A 3SH4A 3NJZA 2JDYA 3SITA 4CUCA 3O1UA 3I3DA 4Y20A 3ACLA 3OGGA 5CKNA 1DBNA 1W9WA 3MUY1 2HYXA 1QDCA 1GNZA 3LA2A 3RG0A 2Q1ZB 2VM9A 2EI7B 2QQKA 4JX0A 5DG1A 1PMJX 2WZR2 1QXJA 1YLLA 4AK3A 1G8WA 3JXSA 2GN3A 2YY1A 1JZ8A 1WLCA 1XOYA 1BBT3 1PVC2 4K8FA 3K9XA 4MUVA 5C9AA 3AFKA 1YFXA 1DQ4A 5C5TA 3F6UL 3I3EA 5G05L 4AHYA 3LTGD 1AVBA 1RC6A 2VQAA 3VZOA 5T5PA 2VNRA 1NLRA 1US2A 4AVCA 2FCUA 4W65A 1OH4A 2ARXA 2EIBA 4QB6A 3VD5A 1LR5A 3OTFA 1I6XA 1MQ5L 1NAEA 1SCRA 4AGVA 1RITA 1ALYA 1W28A 2BO2A 2P95L 3PIGA 2ZA9A 4P02B 2D1JB 1E5HA 3IKWA 5GJ6A 5T5JA 4MMXB 4DPNA 5C3QA 1H1MA 5KHGA 2Y34A 5A3OA 4FXKB 5FDBA 4Q0VA 4FOYA 4XQWA 2BOXA 1Q8VA 1UQXA 1XRUA 2GNDA 2MEV1 2ZGKA 5EHDA 5H9SA 4LKDA 4XURA 5C9AB 4DUXA 4Y79B 4ZXXL 1HRI3 5AFBA 3TEYA 3T30A 4QHBA 1PGW1 5F3EA 3AM2A 3ZXFA 2FDGA 4BMBA 1ZZ8A 3U4SA 2HJIA 4LA2A 5F7UA 4XJ8A 3AMMA 1GP4A 1DP0A 1UPIA 4D0FA 1X9TA 3E6BA 4IL7A 2ZKNA 3KQRA 3VBHB 3CZUA 1HRV1 1M1XB 2BGCA 1R093 1T6GC 3KWVA 3ZXDA 4GKXA 4CEYC 3OGSA 1XNBA 4CUGA 5APAA 5FZBA 1LESA 5H9PA 3HQRA 3RRDA 3AYAA 4QDQA 2W47A 1V6OA 1KXGA 1N3PA 4JAAA 3HPNA 1C1LA 5FUPA 2PHWA 1KS5A 1G1TA 2BP6A 5L19A 2V72A 1Z7S2 4LQRA 4UAPA 4DMIA 3MW3A 2W2NE 1RHI3 4Z6AL 1XYOA 2VOTA 3DV8A 5DDJ1 2HWD1 2RM22 3UGGA 2J22A 2RMU3 4HMZA 4M3CB 1W8OA 3ZXGA 4LHKA 1PIV2 3B93A 4XFIA 5FJKA 5J37A 1LAJA 1FNZA 2WSVA 1RUJ3 1C5IA 2FD8A 3MFCA 4BXWA 1KLJL 4LEJA 2Y7ZB 2OIIA 4P14A 4XFBA 1X33A 2PTMA 2GN7A 5EWSA 2HWC2 4LBJA 1WW7A 3LQCA 4OLLA 3MIFA 5DQ0A 3SKVA 5ACA3 1B35B 3TGFA 4I2OA 4BQ3A 2EF6A 3IMNA 5HXMA 1IOAA 4A7YA 1IQNL 5F39A 3WDTA 3HQUA 4CEWC 3C8XA 4LIVA 1RYYA 4ZKTB 4XQ4A 3JB8A 4CU6A 2QDNA 4KG0A 3WF0A 1WKYA 4BQ4A 5J36A 1QJX2 3RGBA 2OW4A 2VMIA 1J59A 4YZ1A 2Z79A 3Q8EA 3WW4A 1X36A 3BPZA 5A1LA 3FWEA 4A42A 2E33A 3NW4A 1HQLA 3KVAA 2J34B 3L2HA 4BCUA 2XPJA 2WPME 1B09A 4URAA 4IW3A 4BDVB 1QU0A 2GC2A 1PVC1 4B4RA 4Q2FA 4BQ2A 5EJ1B 4EROA 1Q8PA 1JOJA 2B9UA 2OQ7A 3DECA 3IIAA 2FLRL 1A8MA 5F8PA 3WDUA 1EV11 2BOJA 2I74A 4RS5C 4UOJA 3ZFEC 1ODNA 2DFBA 2D7FA 3AP5A 3KGZA 1RUI2 4Y5Z0 5IATA 1LPGA 5FO8B 5C8CC 5A6ZA 1XKBA 4AZZA 4IEYA 4BK5A 1NXD1 1YEWA 1VBC3 4BJ0A 5BNOC 4CPBD 1NA1A 4M0HA 5ISLA 1WWYA 2HLEA 5IT6A 3Q8CA 2PUQL 4XETA 4R9AA 1Y9MA 1D0HA 4XTPA 2WT2A 1AL0G 5GM0A 3VHOA 1H8VA 3WOGA 4FTEA 2KM2A 2DTWA 1BEV3 5JSRA 2E7QA 2HBUA 1J3QA 2J42A 4CCLA 4CDWC 3SOVA 5FZHA 1PGEA 1JS9A 2YYOA 5JMOA 1BCXA 3OF1A 1QFKL 1DF0A 2YGLA 4UFKA 3Q7DA 5IKQA 2GH8A 2XJQA 3TEXA 3WDVA 4BHPA 2ZX2A 3NV1A 3OUHA 4Y22A 2JB8A 3RI8A 2PAMA 2WNVB 1OHFA 4FQZA 1OPMA 2FMDA 1QNYA 2IUWA 3MYXA 1JN2P 4I30A 2UWAA 2RDQA 4XUNA 1V1HA 1UOGA 4LNVA 1MPXA 4WM7A 5FZDA 1QMJA 3R0RA 2J2UB 4D69A 4UXAA 4XEZA 3WF3A 5FYYA 3HT2A 5GALA 3W59A 1QWRA 1UAIA 3VHRA 3U0ZA 1GOHA 5F37A 5IKVA 2RV9A 3A22A 4CDWB 1QJY3 1BKZA 1Z0HA 2O0OA 1HB2A 5FZ4A 1YQCA 1SFYA 3FFQA 2VZPA 1RXGA 3LTFB 1EQGA 2JECA 3DPRA 1UX7A 3GGLA 4LR4A 5IAVA 5KHIA 4DEQA 4FBFA 4Y22B 3TEZA 1SBDA 4LBOA 4UFLA 4I0WB 4JZRA 4AE2A 2OXBA 3I3BA 1HZ8A 1ND3C 2RM21 2WQ4A 1S0DA 3AYDA 4M01A 4LTAA 4LBQD 4QX0A 4ZY9A 1PIV1 3J8F3 1GUIA 3H5CB 2DF7A 1PZ9A 4IEVA 1LKNA 5KXCA 1QXRA 1EGFA 1MEC2 4JGZA 4E2SA 3RQ0A 3LPGA 3WNNA 3PMSA 1I1EA 5F5QA 3OOXA 1O8PA 1J1LA 2I45A 5CKQA 2NLRA 3HNMA 1CAXA 3OCPA 3T1LA 5IAXA 3N8YA 2GC0A 4PI2A 1RUG3 1X50A 3IAPA 3NNLA 3IZOA 4XFGA 3S6PA 3A7QA 2Z5WA 2A73B 3KL6B 1ACCA 2IVJA 2K9ZA 4NPRA 4C1WA 1ASJ2 4QB2A 2BFUL 1VBD3 4YZUB 1FPN2 2C26A 1APQA 2FCVA 2MHPA 1GQPA 5K0UA 4JKKA 4XW3A 1QJX1 1K5MC 2AACA 4FFIA 1E5IA 4LOSA 1FATA 1H9WA 2EXHA 2VD7A 3ES4A 4XTMA 5JI9A 4JGZB 4RRXA 3WUDA 4A45A 4A41A 4CXWA 1LHNA 1QH6A 2DCJA 4Y1UA 1CVWL 4ISRA 1AYN3 4Q4V2 3KV9A 1TNRA 3ZFGC 1U67A 3N8YB 1HDKA 1QOSA 1X8EA 5F6LB 5CFCA 4NRMA 2XJUA 4EV0A 5M0TA 4GH4A 1IQIL 5KXDA 3POEA 5GLVA 1SLIA 2QKDA 4LHSA 1EAH2 3LN0A 1VJ2A 1WLDA 1Y7BA 2PHRA 1RUI1 3A21A 3JQWA 1BBT2 1O5UA 3MLKA 5I0DA 3LEKA 5BPXA 1H1AA 2PHDA 1WA4A 3WINE 3AYEA 1W8ZA 5JI7A 3UETA 2GZWA 2QQWA 1ODMA 3SH3A 2WWSA 5A3TA 4QAWA 2W3JA 1AYM3 3BU7A 2G00L 1W9SA 4KU7A 1A6CA 2B42B 4GU4A 3BB6A 1RUH1 3IDBB 4UW3A 3V64A 1DFQA 2XXZA 4YG6A 2PYTA 4BA6A 4GH4B 4K21A 2VPVA 3LWCA 1CN1A 5A80A 3T2QA 3MUZ1 1EPWA 5D8AA 3ZIXA 4BB3A 5KC5A 1JUIA 1UL9A 1EP0A 3KK6A 3GBFA 1Q43A 5L30L 1BZWA 3PLQA 3PNAA 4K7JA 4KG8A 4YVWA 4CRQA 1W8TA 4K6BA 3VBOA 4Q8LA 2AZ5A 4JCKA 4CP2A 2J1EA 3WVJA 4YT6L 3WNMA 4E8DA 1AUYA 2K0GA 2VZOA 3BKZA 1UW8A 4HKLA 2GP3A 1W6QB 4HN1A 2I9BA 5ABJC 3TOJA 5KHKA 3OLUA 3BVCA 2P28B 5F2SA 1ULCA 5LBFA 3HBZA 2MNGA 1ZBE2 2Y0IA 1QDOA 4CCMA 3K2OA 2CTVA 2BV4A 2FDKA 4CCEA 3MF9A 3ZFFC 1IKQA 1OSGA 4ZZ5A 4LO5B 5D8AB 4XYXA 5T54A 1ULDA 1IS4A 4QPIB 3WEZA 1JYWA 5FLIA 4CDQB 1CGPA 4AF9A 1RUOA 2AH2A 2VVDA 4YVWB 3VBOB 2WNEA 2QCSB 2VCBA 4HPKA 4XUTA 3AJYA 4EJRA 3DXUA 4KU8A 1O3RA 2P3UA 4L97A 1IQML 2QQJA 2BWCA 4YVSA 3AMQA 3ME2A 2C4XA 3P6BA 5FQ0B 4AFBA 1MEC1 5FY5A 1SDWA 5IW0A 2P16L 4FOVA 2UU8A 1G9BA 3LOBA 2RMU2 5JBCE 2YU2A 3IT8A 1KKEA 3QD6A 3TH3L 1MZ6A 1JBUL 1UOFA 4IV3A 4N7IA 3UT0A 3CEWA 5F9TA 5FLJA 3N8WB 4WBBA 5B4XA 3EHKA 2O8QA 1XDTR 1K36A 1ASJ1 1MS0A 1W6PA 3M3QA 3NVCA 3HO5A 5HCBA 5FK8A 2WIIB 1FPN1 3RYKA 5BNPA 1W03A 4H14A 5FXVA 2WFTA 4HPKB 3O0XA 1ATBA 4LLFA 3LC3B 3AMHA 2E7AA 2P2KA 2VECA 5A32A 1TNFA 4YVSB 3SISA 4AFAA 3ON7A 4MGYE 1OD3A 4M0NA 3ZYGA 2DBIA 3KCXA 2RDSA 1ATAA 1NQLB 5FRAA 1AXYA 2UWBA 3AKRA 1SLTA 5F32A 4E4ZA 4BQWA 1AX2A 1VBA2 2CL2A 1KEXA 4D7SA 1LGNA 4P08A 1IQDC 1OF4A 1WHFA 1U12A 3U73A 4IV3B 4YLZA 4YNIA 1MZEA 2EIGA 3VKOA 3BYWA 5FPAA 5IK8A 5LRRA 5LZ6A 2LROA 4JGYA 3U07A 3O1OA 2JG8C 2Y6KA 4MGQA 1EAH1 1UY3A 4BDWA 1B35C 5JZGC 1BBT1 1KSNB 5CEHA 2IC1A 1IQKL 2R30A 3MV11 3UNPA 1HW5A 3UK9A 4AL9A 5IFPA 5JXJA 4HKOA 4K9SA 1CPMA 3LOIA 4AI2A 1RFNB 5FPLA 2FHRA 3ZSLA 3ILRA 1LOGA 4CXYA 2VBPA 3W21A 2PA7A 2QNKA 2W92A 3ROUA 5BY5A 2WG4B 3GHMA 5L73A 3VHNA 4PF1A 4GAZA 4Z8BA 1BF9A 1N3OA 2HWD3 3VKFC 1UY4A 3S57A 5IYYA 4MG2A 1ND2A 2RS52 1POQA 4XE9A 1IS3A 5F5IA 2PAKA 2Y64A 1RUF2 4YG3A 2D3SA 4Z82A 2NZ9A 1G9AA 1YQ5A 4N53B 1X8MA 4QHZA 1BEV2 3FJSA 4XMIA 1K37A 1FNYA 1N1YA 4CYDA 1V00A 1F8VA 2WFF3 2ZX1A 4LK6A 1WUVA 4WM8C 4CUAA 3GF6A 4D8MA 5A3PA 1IHMA 5DUUA 1IQGL 4M3CF 4R8HA 1RJ8A 2ZXQA 1VBB2 1HXS2 1O4YA 2GNMA 2OZ6A 1OQEA 2IXJA 1LPKA 4LHNA 5IWFA 1F31A 1ZA4A 4GWJA 4GALA 3S7EA 1DZRA 1G9CA 1OQDA 3DYMA 3K3NA 2EIEA 1UU5A 1HB3A 1JZ3A 3KQCL 4FPEA 4URTA 4IEXA 3VBSC 4EZHA 3H8XA 3J26N 2P1BA 2XJVA 4HANA 2EXIA 5F6KA 1NYWA 4OHYA 5T3NA 5KHJA 5FZIA 1JYIA 4Q0SA 2YPDA 2WZR3 1LOFA 1MZFA 4YFWA 3KQDL 1VMHA 4PQQA 3P5BL 4QX2A 1Q8QA 2BOKL 5E8DA 1PVC3 2XLFA 4QQHA 3B9CA 2CAUA 1EPIA 1M06G 1C8M3 3HQXA 4GWMA 4HVRA 1YI9A 3DN7A 1SG3A 1RIRA 1JMUB 1RHI1 1ZZBA 4DS0A 2A6XA 3PUIA 1N47A 4QPWA 4IGOA 3LSDA 4FPHA 1IQEL 2RMU1 4PF5A 2P94L 4Y24A 5FYTA 4BQ1A 3LAQA 1GWLA 4H3WA 2DCZA 1QXPA 4YFZA 2ZHNA 4JZEL 2IZWA 2XBO2 2CWSA 2WDBA 4BIFA 4BXSA 3NT1A 3BTAA 2D6PA 2A75A 3H0OA 3MW4A 3VN4A 4ISQA 3NTGA 3AMPA 1V0AA 1V9U2 4HFSA 1XNAA 3FZ3A 5CU1A 2P3FL 4FXGB 1W0OA 3VZKA 4BIOA 4IEZA 1NX9A 3MDPA 1CJPA 2BU9A 4FCAA 4ZONA 2V09A 2P3FN 5BYNA 3V65B 1VBA1 5JOZA 2EIDA 2OYUP 5E89A 5KWRA 1Z6EL 1PXXA 1XNDA 1PK6A 1S2KA 2V4AA 3B00A 4OULA 4OI2A 3PIJA 5FMCA 5DN2A 4XAEA 3AP9A 4YM3A 3I2GA 2WS92 4LO7A 5TSWA 1EY2A 1LECA 2UY9A 4OHXA 4LUMA 3SOBB 1UZ0A 3SMHA 1KRIA 3QLQA 4NHXA 4X8SL 3S5QA 3POBA 2Y26A 4O7XA 3ACFA 2MHFA 3N3HA 2PLV2 4EWAA 1CEJA 2MPFA 3OY8A 4OHWA 4C90A 1S0CA 2GMEA 4GIQA 5L36A 4AAPA 2YB7A 1BVVA 3N9NA 4I3GA 2W2OE 5A7WB 3S7IA 1Z7S3 4IEWA 4XFHA 4XDPA 4AEDB 4XILA 1CESA 5A3MA 2ZEWA 1PO13 5JOYA 4XJUA 4DY5A 1S4CA 2VW1A 4HL0A 5LBBA 5CG9A 3MIHA 1VBC1 1NY72 2DFCA 4B1MA 1IVOC 4OFGA 4RQPA 5JMCA 1ZX5A 2RS51 3TZIA 3B94A 5FOJB 5JUVA 1PIV3 3PVOA 5CFDC 4FPFA 1RUF1 3KM5A 4MHRA 2DU0A 4XDQA 2G4IA 4FPOB 1PM4A 5F1AA 3IPVA 2CY6A 1BEV1 2WN2A 5AFEA 3DF0A 3OY8B 4HT1T 5FP9A 4ARYA 2HWC3 3VD4A 4BTTA 5DUVA 2B4KA 5FZ3A 1DCSA 3MBWA 1GK5A 2CDPA 3I3QA 3KD4A 4MXWA 5HPOA 5JPMB 1NE6A 1VBB1 2BOUA 4LLOA 1CD3G 1FE2A 4LKFA 1U5YA 2QFEA 3SNMA 1CPNA 3LF7A 3VUOA 3ELNA 2WLQA 2X10A 2AEYA 4RR3C 4RQPB 1NKGA 5DABA 4BWOA 4P00B 4MGIE 5A6QA 1LCLA 3OBRA 4EWDA 3BODA 5SV8A 3IPVB 3K4ZA 4XZUG 4TZDA 1YO8A 2D40A 3I3MA 2GU9A 4FQ4A 1NQDA 1HN1A 1PMIA 2ZGSA 4QT6A 5D2AA 4UFMA 4XFAA 3TBDA 1DGWA 3B3QE 4IV1B 1MQ6L 3N9MA 4HN0A 3TNQA 4HXCA 1NQJA 1GQHA 4XC9A 2VY0A 2FLBL 1MS4A 2BVVA 4L99A 4D0QA 3M37L 1RUI3 1GFF2 2VAUA 2ZEZA 5E88A 4J1WA 4CU8A 4LO8A 4LITA 3J8F1 2VTXA 3BCWA 4QX8A 3WG2A 2JDHA 5GLZA 1GYKA 5JPNB 1MS1A 1AR82 4I3PA 2EAAA 2A3YA 2J1RA 1W6MB 3WG1A 4CPBA 3CO2A 4Q27A 2JD9A 4DXRA 2QQOA 2B8MA 1V9U1 3KVBA 4XFCA 3ZVXA 1RUG1 2NMNA 2XKOA 4JHZA 1NCRB 4QPIC 4ZXKA 5FPVA 5FUIA 1P8JA 1YUDA 1GP5A 3T3YA 5T5LA 1DIYA 2XQXA 2CNAA 1VBD1 2SBAA 1AR72 3KS7A 4D7YA 4PBPA 1HV0A 2CV6A 1GR3A 4XDOA 3NAPB 3D4KA 5FY1A 2QQMA 5C3RA 3A0NA 2G9FA 4D94A 3LDRA 2FDJA 4QX7A 2WS91 4XQDA 3UGFA 4Y1YA 2VMGA 2WRAA 2YROA 2XJSA 3NKGA 5BNQA 3HS7A 1YWKA 3VHPA 2ZEXA 4OMCA 3I2HA 4CDUC 2RNLA 1PGSA 5B2GB 2QBXA 4XF0A 3WX5A 3MPBA 1H2NA 2ADXA 3VBUA 1I5ZA 1QIUA 3KQ4B 4NAOA 4Q26A 1CZVA 3NO8A 4YW3A 5EXOA 2JICA 4DINB 3ENRA 2WNUA 5HBAA 3M2MA 1NY71 4HONA 1O4TA 4PLMA 4A7KA 4IE7A 5JIUA 1O91A 3LIGA 4QKBA 4CDXB 4AHWA 1K5MA 3FMGA 1URXA 3PURA 1AYM1 1RVF2 1GZCA 1MEC3 2VBBA 1H8TA 4OI4A 4A2UA 5CA6A 3O1PA 3NV3A 3CNAA 5FYZA 2VZ1A 3RI9A 2H0BA 1UZQA 4KGQA 3ZFGA 2ZPXA 5BNNC 2JKHL 1LK9A 1REFA 1UMZA 3T4HB 3H3LA 4CCCA 2W2PE 4TLGA 4XIOA 1RXFA 1ASJ3 2NQYA 2TUNA 2UYAA 4KH9A 4GMP3 1WBLA 2WNUB 1FPN3 3LB9A 5FZAA 2ZCWA 4EN9B 4P9WA 2YDEA 4C0HA 1A3KA 4B4QA 1LHUA 3J7LA 4LBQB 4EN7B 4UI9L 5FY4A 4O02B 1LEMA 1H8TB 1N7DA 5FAXA 3KQBL 2ZTNA 3HBKA 1COV2 1W99A 4LA3A 1IQLL 4Q4V3 2HH9A
chains in the Genus database with same CATH topology
1O3SA 1MOXC 3EXUA 2B7DL 3CJIB 4R9CA 4N53C 3VKNA 3B7MA 1SCSA 3GBWA 3WHTA 1UIKA 5L7OA 1EAH3 3EO6A 3V0BB 2R073 4N9HA 4RHV2 3R6SA 2JG9C 1C8M2 1IGOA 3AZXA 3VDDC 4GKYA 3WHUA 1HX2A 3VBFA 1AX1A 5GZGA 1H2MA 2IXKA 3HO4A 2YZ4A 1A8DA 3H9AA 4Y20B 4RS0A 1RUD2 4BH9A 5KBFA 1F0RB 1DGLA 3HS6A 1TLEA 2BNMA 3SXWA 5EFUA 3U4XA 4K40A 1SLCA 1OA2A 4FP2A 3HT1A 2A6ZA 5L7OB 5FMOS 1EAIC 1LHWA 5F1RA 4DB5A 1U5IA 3RZZA 3AK0A 1DQ0A 3IBMA 1PO23 3H50A 1ZRCA 1IOXA 1QF3A 1O3QA 1LULA 3MGUA 3VBFB 2W3IB 5FLHA 1KD7A 1DQ2A 2ZZQA 2XC5L 3WQ7A 3UL2A 2C0ZA 1OOPC 4KWKA 5BXXA 2EXJA 1EPJA 2IXLA 2AENA 2AYHA 1W6OA 2YPJA 1ZBE3 1V3XB 2BPA2 4G3YC 2BQ7A 4OI0A 1ZZ9A 5E16A 2BW8A 5I0SA 2DVBA 1S0GA 2VW2A 4WVWA 1WW4A 4EN8B 2RA0L 5FPXA 1Z78A 3ZSKA 1FAYA 5HCAA 3DGTA 1DZQA 3GZUC 1QY4A 2C9AA 5SV5A 4META 3EJKA 3TYJA 3WY6A 1CAUA 2PFWA 5I91A 1RVF1 1HQNA 1PO12 5KN5C 2CWMA 4MZUA 2VQ0A 1W6OB 1Q4GA 2PHLA 4LT5A 5CAZA 2AREA 1YXWA 3RJ2X 1NCQA 4NVPA 1ZRRA 4BDXA 2DTYA 3O7OA 1QQP2 5L2ZL 4IXLA 3ST7A 1UCXA 2D3RA 2Q1MA 4S2HA 4JQRA 1VRH2 2WFF1 4H7MA 4JC1A 2H9EC 4N7UA 3FC0A 4GQ7A 4QPGA 4WVZA 4XBNA 2HEVF 1G1RA 4BOWA 2IXHA 1CAUB 2VH6B 1WGPA 2N7GA 3I8TA 1FAXL 1PZ7A 4CUEA 3HMYA 4AQTA 1COV1 1C5MF 1KLIL 4RA0A 1VBA3 3R05A 1S0FA 3GZTB 5EV7A 4X8VL 1NCQB 4M10A 1UKRA 1X7AL 1UU4A 1QOTA 3ZXEA 2JJ6A 2VWNL 3LSEA 4AVSA 2WZR1 2XKPA 1YJKA 3VZJA 4QPGB 2TEPA 4AHXA 4COZA 1NZCA 4L8QA 3SOQA 1ZBA3 4V1PA 1C8M1 5CADA 4WM8A 2C5DA 1ZM1A 1HT8A 1DQBA 1APOA 2E63A 4DRRA 1CIWA 2UYBA 2Q4SA 4IEPA 1DGRA 2WLPA 2P93L 4P9LA 1RUD1 2VVFA 5JOXA 4PDWA 1CCVA 4MMYB 2RS53 1IS5A 4HSLA 3PGHA 2NPRA 1RUF3 4AGGA 3MFAA 2DURA 1IJQA 1NT0A 1SLLA 3JUUA 4JDNA 3UJQA 3VLBB 1AZDA 1YGCL 1G9FA 3B9IA 4MX3A 2D6NA 2RHPA 1S1AA 1VBB3 1HXS3 3UKVA 3IJEB 1V6IA 2YGQA 2WL1A 2Z2SB 1NA1B 3I7DA 3AKQA 1EPHA 2UURA 3N7JA 2VW0A 2D3PA 5COXA 2DVAA 4GB32 1OLQA 5FTTC 4QX5A 2Y82B 4FT8A 4GMP0 4LHLA 3UJOA 4P5HA 2VWMK 5GLTA 1EBVA 2RS33 1AL23 1Z7S1 1OD5A 2Q1JB 3NAPC 3FLRA 2QDRA 1PO11 3WP4A 1CAWA 3HAGA 4WM7B 4AGRA 4E27A 4G1MB 4Z07A 4X6RB 1PRHA 1APNA 2XBO3 1L3YA 1G86A 2X8KA 4Z1VA 1VRH1 2GNBA 2OA2A 2HWC1 2KXLA 3GZAA 3N4MA 2EI6B 1CR7A 1V9U3 4WVMA 3RR3A 3DPRB 2ZMKA 1C28A 1KJLA 3ES1A 1DQ5A 3HN1A 1PNFA 3P3PA 2PHXA 4HSJA 2FZ2A 1FMD2 1DGRN 1EPZA 3AYCA 4DXZA 5C4WC 2XGXA 4QPYA 2WYJB 2ZGUA 4W6YA 4EWEA 2WT1A 4P9GA 3POYA 3USUA 5FDQA 1G1SA 4YW2A 2PELA 4WV8A 5JSPA 1W39A 5CVRA 3MICA 3FCSB 1Q8OA 2WPJE 4QM8A 4JTNA 1JUHA 2W68A 2DU1A 2WS93 5E1RA 1CAXB 3HWJA 1SLBA 4S2FA 2ZX0A 1Y43B 1MQTA 4WVMB 5LEJA 1YCIA 4K3UA 1LU1A 2K2SA 4TWTA 2PLV3 5C6CA 3AMNA 2VOKA 2CGOA 4OI1A 1VR3A 1EMOA 1U5ZA 1G6NA 2O1QA 5BV6A 1XKAL 2R072 4LBKA 2B39A 1IGXA 2BYVE 2XB6C 4FAGA 1YHFA 2NP0A 4S2DA 2VUAA 4RR3A 5JAXA 3NTBA 2I2SA 4HK8A 4JDMA 4ZU4A 3VZNA 1J3PA 1ZRFA 1SBFA 1MQTB 4XZPA 3CU7A 3OPZA 3OJBA 1D4VB 2JD4A 2K2SB 3KLSA 3BIWE 5CFCB 4MLOA 2VNGA 5IUQA 4Y7AB 4QQOA 3C2UA 2DVDA 2HYKA 4XBQA 3ATGA 3IDEA 2VJ3A 2X5IA 1QH7A 2DCYA 4MSVA 3GCXE 3POWA 1PO22 1YYNA 2W2QE 4RL7A 1CAVA 4H7LA 3CLPA 4NHMA 4QGMA 1W0PA 3OBTA 5HI0A 3ASIA 4GB31 2ZGNA 4NHLA 1H9PA 1UZYA 3AXEA 3ZDSA 2Y81B 3KT1A 4PCRA 4XJZA 3WP6A 2X5IB 2GC1A 3LKJA 5DZEA 4HKWA 5CB7A 5C9AC 3WQ1A 2EALA 5I0RA 1CAVB 2WINB 2X29A 1TPGA 2XVKA 1YIFA 4N43A 4AVAA 2FBEA 2CAVA 3D8CA 1BVP1 1UX6A 2RE9A 1YJLA 3RWNA 4AVTA 3VBRA 2BOHA 3VBHC 3IITB 2AYLA 1AR83 2XG3A 2M74A 2XUMA 3J9SA 3GCWE 4KNCA 3VZLA 1XYNA 2JXAA 1F2NA 2ILMA 1C5HA 1MR5A 4AW7A 2XHKA 4F83A 2D44A 2DDUA 1FMD1 2CJIB 2BTVC 1DU3D 3DUIA 4GMP1 4I09A 3L9JT 1AR73 3ILFA 3TN92 5CIRA 1TME2 3ILNA 2JENA 5FBZA 3WDWA 2NYYA 3FFZA 1WD4A 4LBLA 4N9IA 3NL1A 2XBXL 1PFXL 2TBVA 4Q4V1 4R9BA 2XBVL 3TB0A 4A7IA 1D2SA 1IZ3A 4XIKA 2VULA 1DX5I 1AJKA 2YXSA 5AVPA 4S2GA 1Q56A 2R0FA 4AI8A 3VKMA 1W6PB 3MDLA 4LUKA 5BNPB 4Y7BB 3CL1A 3ZMNA 4HBNA 4AVVA 1UD1A 2R071 1OA3A 2WJSA 5A32B 4FSJA 4KWLA 4BTUA 1NFYB 1ZBA2 3H7YA 4J1XA 2VVVL 5I8SA 3ZSEA 2E53A 1KIGL 1W6NA 4TGFA 1RVF3 2EA7A 4X6QB 4OHVA 5FO9B 4JYUL 4AI1A 2QE3A 4UW6A 1XNKA 3S0MA 3HR9A 5FO7B 2Y38A 4JGYB 4PIZA 2WYGB 3CA7A 1S0BA 3THTA 4YSFA 2H6BA 4KBBA 1EQHA 1S55A 1PO21 4ES8A 1KFXL 1GV9A 2P26A 2DWRA 4Y1XA 5K0UB 3TWIA 5JVYA 3AZWA 3GYDA 4YGCA 1W6NB 4GA9A 2ZAHA 1RUC3 4CUFA 4Q4X2 3O0VA 1COV3 1YI7A 2D6LX 3RSJA 1ZBE1 1ND2B 2WT0A 4E2GA 2IWGB 2D6KA 2JDZA 1J3RA 2ET1A 2XL9A 1Q8SA 1LMMA 3N36A 5J7MA 3ZN6A 4PBOA 1URKA 4Q1RA 1C4RA 4FTSA 2PN5A 1JBCA 2ZGOA 4CP1A 1HT5A 1MS8A 4P9JA 4CP0A 2AR6A 1GSLA 5DXDA 4X8PA 1N1TA 4R4XA 4RHV3 3FE5A 2RS32 2ZGPA 2VVUL 5EGMB 1AL22 2OZJA 3WDXA 4CTEA 4B7KA 2WNVC 3WP3A 1FAKL 2VOWA 2KV4A 2XLGA 4YM1A 1QGLA 4BM8A 2WSUA 1RUD3 3H1YA 5J09A 4R52A 4AFMA 4E2QA 1FYUA 4RRZA 1RUE2 1VAVA 2DCKA 2BQWA 3C3VA 4CEYA 4KWJA 1O5LA 1NFWB 3I59A 1UZJA 2EXKA 2BVBA 2E9QA 2PHTA 1RINA 1WHEA 4JRAA 1R082 1WD3A 3M8LA 1AR92 1S0IA 3ZXKA 4RRYA 4WM7C 3IDCB 3RPQA 4NGAL 2B7YA 1XYPA 2R0HA 3AFGA 4XBLA 5I93A 4FVVA 4ISHL 1TEIA 3HD8B 4XFFA 3QCWA 3E6DA 1PNGA 2NPIA 1ATEA 2W0XA 2WC2A 4Q0QA 3WUCA 3BPSE 1O3TA 3DPRC 3I59B 4ATEA 2PR3B 1ZBA1 4EN0A 1KDMA 3A4UA 1I3HA 3QOPA 5C8WA 3GNEA 2YUEA 1CQ9A 1CX4A 1OFSA 1QJZA 4YM2A 1ZZCA 2DUPA 4CZSA 2Y5FL 2VWLL 3OYWA 3MW2A 4XOGA 3KCYA 3LA7A 4JGZC 4CEWA 1PK6B 2UY8A 2BWAA 2XL7A 1EMNA 5EZWA 5JSOA 1RTVA 2R1BA 4I0AA 1D4M2 1TMF2 3NV2A 1NFUB 4GULA 4FPLA 5DG2A 1QQP3 3ALQA 4DNYA 2A71A 2B45X 1XE8A 1P0SL 1VRH3 3PVNA 3H3UA 2ZGQA 2WPKE 5K0UC 4JYVL 2EAKA 3N7MA 1WMDA 2HWB2 1HXS1 2Q30A 4DRVA 3WW2A 4P9YA 4Q4X1 4CEWB 3MI8A 5FFOC 1UZPA 3ENSA 4RS5A 2WG3C 3DKWA 1H2KA 3ZFEA 3GISX 3E5XA 4WZCA 4XHBA 5LEKA 1KS4A 2VWOL 5C8CA 1PM7A 4COWA 4F8AA 2J4IB 5BNOA 3FLTA 2MGPA 3B5LB 1V6LA 2XJTA 1DG6A 5JVZA 4GH4C 4YG0A 1X82A 6COXA 1KITA 4L2NA 2ETEA 2R1DA 2RS31 4MXWB 4D3WA 1AL21 1I9RA 3LAGA 2AUYA 4Z2WA 1HRFA 2JKBA 2A7AA 1Y9QA 2E7TA 4CDWA 4E4SA 1YUKB 3KCGL 3KQEL 3EQEA 3JD72 4RS5B 3CFWA 4K20A 1P9JA 3ZFEB 4COVA 3U11A 3QBQA 5T52A 2Q5TA 1OFNA 4BZ4A 5C8CB 5K8SA 3J4UH 2ZHKA 2OVUA 2XBO1 2R49A 2MGRA 2NMOA 3H7JA 3V64C 4Y4YA 1RUE1 1IOEL 4U2AA 5KC6A 4D90A 1BXHA 4IEUA 3SLIA 5IK4A 5LK7B 5D8AC 3HS5A 5A33A 2A5ZA 4I01A 5LK5A 4CDQC 3BT2A 4Z0KB 1F7MA 3N7KA 4YVWC 4CDWB 1R081 3IWZA 2UWOB 2F6BA 3VBOC 1AR91 2ZHLA 1Y3TA 2VH9A 4I0BA 2ZACA 3EBRA 2D43A 1YRZA 3POSA 4AFDA 1ZZ7A 4QD2A 1F9KA 1WCDJ 3ZSMA 4MH0E 1D2QA 2QUOA 4DS0A 3TK5B 1ND3A 2ATFA 1M4WA 1FT9A 2A3WA 1YFWA 3G6JB 4UW4A 4FPGA 2WKKA 1VB2A 1IPJA 2ZX3A 2D6OX 2HWF3 2ARBA 1QJU2 4GB33 1JTZX 1PGL2 1IQAA 4FTBA 2PLV1 5GZCA 1MVEA 1Q3EA 4DZGA 1LGBA 4RGAA 2MEV2 4HK9A 1VBE3 2A3XA 4YVSC 3RMXA 3X29B 1ND3B 1OPOA 2ZMNA 5K7PA 4LO4B 3QH7A 2BNNA 1D4M1 1TMF1 2ERFA 4YZ3A 4GXLA 4IV3C 1LQDA 2HEYF 1HRV2 5FPZA 2CYFA 3WW3A 3KT4A 2VH0B 1C3HA 5HXVA 3VBUB 2VU9A 4EN6B 1XQNA 5T5OA 2ENRA 1PHMA 1W8BL 5BUVA 2ET7A 3W9AA 1FMD3 1RL3A 4UW5A 4LBMA 2IXCA 4FPJA 3F1SB 1LOAA 1HCGB 1U8CB 3E6CC 2R062 2XWJB 1K5MB 1EYBA 3JU9A 5J96B 1DDLA 1W7XL 1OI6A 1RUC2 4XJAA 5JIAA 2A70A 4RD7A 2H6CA 1LJ7A 4NO4A 1AHSA 3ZFGB 1H2LA 4NN0A 2Y80B 2WPHE 4LE3A 2R6QA 2VOXA 3O0WA 1A78A 1VB4A 2HWE2 2PAEA 3R4UA 4YZ2A 1G2MB 3JD71 1H1IA 4MV2A 1O4ZA 3UKTA 2Y5HL 1ULEA 1Q5OA 1YFUA 2BUKA 1XNCA 2D97A 2J95B 1XXNA 3MLJA 2DCTA 1AR81 2XWBB 1KLOA 3GHNA 5J3UA 5K0HB 4RGGA 4D7TA 3LN1A 1ND2C 2ZOEB 5HCFA 5GLUA 3ZN4A 3N35A 2DV9A 4Y1VA 4QMAA 5ABJA 2TGFA 3M3OA 4DY3A 1NLSA 4IEOA 1WW5A 4Y71B 1AXKA 1JW6A 2PHBB 1LU2A 3ZYRA 1AR71 2W39A 3ZFFA 3KGLA 2V73A 5K9YA 3PVEA 2G9GA 3P3NA 2LUWA 3AZZA 3H3ZA 1EV12 1KJRA 4PLOA 3OLTA 1MVQA 4B8EA 3ECQA 2YV8A 4MGKE 2LTNA 5ABJB 1QJU1 2BNOA 2DYCA 3VBHA 1WCKA 1PGL1 1POV0 4PIXA 4XF3A 2IXIA 1LOFC 1YUGA 2SLIA 1HIXA 3ZFFB 2HKXA 4A3XA 4SBVA 5FMOL 5EYYA 3JQXA 4XJ9A 1NXMA 3WG3A 2W26B 4M11A 1VAKA 1AR63 5CKMA 4FPYA 1BK1A 4J6GA 1EPGA 3Q3KB 2XLAA 1LOCA 3LA3A 1B9WA 4OUMA 3WP5A 3H1MA 1WW6A 5IK5A 1F5JA 4YRDA 4AEKA 3FLPA 4M3CA 4WZFA 4TYSA 5J98B 2E51A 5L2YL 4AEJA 5C33A 5IKTA 4IERA 4DQAA 3PMEA 2W3KB 1FF7A 1AXZA 1D0GA 2W08A 3OGJA 3M4FA 2XBYL 2JG8A 1WCSA 2R061 4ZU7A 5JZGA 1B35A 4ONUA 4UBHA 3B02A 4JRLA 3TN93 1GZWA 2JX9A