3TBDA

Crystal structure of domain vi and le1 of human netrin-g2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
331
Chain Sequence
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ligand binding domain of netrin g2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Netrin-G2
total genus 81
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00053 Laminin_EGF Laminin EGF domain
A PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3tbdA01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3tbdA02
4ISHL 1G1RA 4ZHAB 1IQIL 4C16A 3FFGL 1U67A 4NG9L 1Z6CA 2J38B 2Y80B 4E1GA 3CENL 5F19A 3R05A 1I0UA 1UZJA 3OLUA 1KIGL 1XKBA 4BDXA 4X8SL 1HAEA 3NTBA 2WG3C 4ZXXL 3F1SB 3FBYA 1HX2A 4M11A 2XC0L 4Z6AL 1LPGA 1IQLL 1KLJL 2BQ6A 1EQHA 2BO2A 3LTGD 1EZQB 5KN5C 4JZDL 1LMJA 2XC5L 1EMOA 2WPJE 3RR3A 3LIWB 3TGFA 1C5MF 2EI8B 5JB8E 1ATDA 1L3YA 2W2OE 3KCGL 1HRFA 1F0RB 1NPEB 2F9BL 2P28B 1YUKB 5JBBE 1JV2B 1KSNB 4YT7L 3CA7A 4URTA 1COUA 2YGOA 2WYJB 3P5BL 3BPSE 1EPGA 3Q7DA 1UZKA 5COXA 2BZ6L 2Y82B 5CKQA 4JZEL 4YT6L 4MMXB 3KL6B 5JB9E 2G00L 2WG4B 3Q3KB 2WPKE 4YZUB 1A3PA 1IQEL 1FSBA 4XBMA 1DDXA 2P3UA 4JYVL 1PGEA 1V3XB 3V65B 3U7UG 1GK5A 2XBXL 2Y7XB 2I9BA 4ISIL 3CS7L 3M37L 1HREA 2W2QE 1NFWB 1EPIA 2WFXB 3NT1A 4Y6DB 6COXA 1G2MB 1PFXL 2W86A 1BF9A 2P26A 4JYUL 2M74A 5L2ZL 2VH0B 3OLTA 1N1IA 3HO3A 2CJIB 2H9EL 3TK6B 1ATEA 4Z0LA 1IQFL 1LQDA 1APQA 3TBDA 2Y5HL 3KQEL 2OYEP 2W2NE 2EI6B 4MMYB 3SW2A 2VWNL 2BQWA 2PR3B 3F6UL 2VWMK 3NJPC 1PTHA 2W3IB 5K0HB 5JBCE 1CVUA 2J94B 4NGAL 2MHPA 4OTJA 4BTTA 3N8ZA 3KRKA 4Y7BB 3ELAL 3BT2A 3MQEA 2UWOB 4RRZA 2B7DL 3IITB 3SOBB 1B9WA 2XBWL 2PUQL 3N8XA 1IOXA 3HPTA 1IGZA 2VH6B 1ADXA 4FM5A 1KLIL 3LC5B 1W7XL 1YUFA 2AYLA 3LC3B 1F7EA 2Y5GL 5IKVA 4BTIA 4Y76B 2P3TA 1DQBA 1ZAQA 2P95L 3H5CB 1TOZA 2BMGA 1U8CB 3HS5A 3ZYJB 2Y81B 5IKTA 2WFTA 3TK5B 5JVZA 2WPLE 1L5GB 2FLRL 1XFEA 3HS6A 3HS7A 3QCWA 1M1XB 1FF7A 3ZYIB 1EBVA 2UWLB 2VWLL 1EAIC 3IJEB 4NA9L 4BXSA 1O5DL 1URKA 1EPJA 1NT0A 3U73A 1UZPA 2RNLA 2Y38A 2BOXA 2DDUA 3NTGA 2P93L 2W26B 1UZQA 1XDTR 1IJQA 3TZIA 1WHFA 4D90A 2WPME 1Q4GA 4G1MB 1G1TA 1PRHA 3CFWA 1HT8A 2GD4A 2W2PE 3N8VA 2W2ME 4Z0KB 3POYA 1APOA 1G1SA 2RHPA 2MGRA 2MGPA 2FLGA 1QFKL 1OB1C 4MMZB 2Q1JB 2NPRA 2J2UB 3N8YB 4Y71B 1LPZA 5L30L 2VVCK 1HJ7A 1FFMA 5FDQA 4AQSA 4X8TL 3HO4A 1CX2A 5I46L 1KLOA 2WPHE 1DIYA 3ENSA 1AUTL 3C9AC 4RRWA 2VVVL 3DEMA 2FD6A 1G1QA 2K2SB 2J34B 2XBYL 2WYGB 3SOQA 3BT1A 4Y79B 1NFUB 3QMOA 1IQGL 1EQGA 2WPIE 1NZIA 2XBVL 4TGFA 3HO5A 1DVAL 4A7IA 4RS0A 2FLBL 4CUDA 2JKHL 2J4IB 3TH3L 3N8WA 3LN1A 1F7MA 2W3KB 5E8DA 1YUGA 2P3FN 4PLNA 4BTUA 1IOEL 1IQML 2D1JB 4O02B 2YGPA 5IKRA 1RFNB 3PGHA 3MDLA 2P16L 5IKQA 2KB9A 2XC4L 4COXA 1ATBA 1DX5I 4PLOA 2Y7ZB 4OTYA 5JW1A 1IQJL 4CUEA 4ZH8B 4D0FA 1IVOC 1FJSL 1LPKA 2VVUL 5JVYA 4CUFA 4OVEA 3EGFA 2KV4A 2RA0L 1J9CL 2BOHA 4D0EA 1CCVA 2FZZL 1CCFA 1IQKL 2EI7B 5L2YL 3M36L 3GCWE 2BQ7A 3FCSB 1P0SL 5EGMB 4RRXA 1K36A 1CVWL 5CKNA 1MQ6L 1XKAL 4X8UL 3LAQA 4CSYA 1IQHL 1K37A 1Z6EL 4XLWA 4PH9A 1P9JA 1NQLB 2P94L 1HAFA 3ZYGA 1JL9A 1F0SB 1IGXA 3KQBL 1YO8A 2KL7A 1FAKL 4M10A 2I9AA 4O1ZA 2K2TA 1EPHA 1IP0A 1NFXB 1MOXC 1G2LB 2ADXA 4Y7AB 1MQ5L 3SOVA 1CEJA 2Y5FL 1ATAA 1HCGB 4RRYA 2J95B 4BXWA 5CISA 3GISX 3N8YA 4PLMA 2TGFA 4ZAEB 4LORA 2BOKL 3KK6A 3LN0A 1WU1B 2P3FL 5CKMA 1YGCL 3LTFB 3KQCL 2OYUP 1HT5A 4LMFA 1FAXL 5F1AA 2VWOL 3K9XA 1NFYB 1HZ8A 4BDWA 5KIRA 1JBUL 1SZBA 3ASIA 4RUTA 3QH0A 1FE2A 2VJ3A 4ZXYL 2BOUA 1TLEA 1EMNA 3KQDL 1X7AL 4AQTA 5JBAE 1EGFA 1N7DA 4XL1A 3V64C 1CQEA 1W8BL 1WHEA 1IQNL 1PXXA 3N8WB 2PHBB 4JZFL 2UWPB 4X8VL 1TPGA 3GCXE
chains in the Genus database with same CATH superfamily
3AK0A 3HQRA 4EJRA 5F2SA 4ISHL 1JOPA 1IQIL 4W6YA 2IXHA 3SCHA 2VW0A 1AL21 5CAZA 5EYXA 2JJ6A 4XBNA 4NG9L 1PO21 2XG3A 2ZCWA 5E1RA 3ZO0B 5C5UA 1A34A 1ZRIA 1K5MB 1OLMA 4XAEA 1SLCA 5A3OA 3R05A 3ECQA 4X8PA 5ANQA 4ISQA 5EYYA 1I0UA 1TG7A 1UZJA 5FZ4A 3AP4A 4BDXA 5A3NA 3RZZA 4X8SL 1HAEA 3GBWA 4CCEA 3VBSB 1V9U3 3ME2A 1W2NA 5JWPA 3JCIA 4NROA 4JKMA 1D2SA 4P9WA 3ZR6A 4GALA 3RZJA 4X8NA 1YNAA 2EF6A 4OCTA 5IFPA 1COV3 2YU2A 1DQ6A 1HX2A 2WO2A 2IWGB 2GC2A 4RHV3 4BHPA 2XC0L 2GNTA 5EV7A 4ARXA 4NIHA 5C8CB 2XUEA 1LPGA 3T0DA 1KLJL 1O6UA 1AYM2 2HLEA 1EQHA 2JENA 3LTGD 1LECA 3P5BA 4LO8A 1YFUA 5B2GB 1GV9A 3GZEA 1IKQA 2C0ZA 4NPRA 3N4MA 1LMJA 1CQ9A 4UBGA 1AXZA 2XHNA 3AMMA 1EUUA 2P6CA 2BGCA 4BM8A 5C3QA 5DZEA 1VRH1 1W8NA 2D6KA 3I3MA 4AVSA 4HMZA 1CX4A 4DUWA 4M4PA 4YVSC 4A6OA 4DMIA 1GNHA 5LASA 1OQ1A 2ZKLA 2PHWA 1X82A 3ZYFA 4L97A 2VECA 4Y1ZA 2HYKA 4A94C 1GICA 3LPGA 2C4XA 2XBO1 1ATDA 4PDWA 1L3YA 1EV11 2W2OE 1ZREA 4B3NA 1C8M2 1JZ2A 1F0RB 1NPEB 5F8PA 1VRH2 2QQLA 1UYYA 3M3QA 2WN2A 3WNLA 5JBBE 4YG3A 4TZDA 1TMF2 5J3UA 5BNPC 2D6OX 4P08A 1X33A 4PI0A 2VZQA 4DINB 2YGOA 4RHV2 1LOBA 2TBVA 3C2UA 3GYDA 4S2HA 3ETPA 3FBMA 2GNMA 4M00A 4GWMA 1EPGA 4ZY9A 4HN1A 5E8AA 3ZKYA 2BZ6L 2Y82B 5CKQA 1JN2P 4R9CA 4RGAA 4I0BA 2WT1A 4X6RB 5IFTA 4QX0A 1RUD3 5BYNA 2UY8A 2CTVA 3IKWA 2A6XA 2PHTA 2Y0OA 1CIYA 4FTSA 4L0PA 1PGEA 1V3XB 5E6HA 1LHOA 5JXGA 1L7RA 3I2DA 1NA1A 2Y7XB 2I9BA 4YW7A 2ADDA 1HREA 2W2QE 3AMHA 3OB8A 1ST8A 4BB3A 1UQXA 5FMOS 1NFWB 3NT1A 4Y6DB 6COXA 1G2MB 1AHSA 1P8JA 1UOGA 1APNA 3I2HA 1PFXL 1K42A 1NG0A 1UOJA 4XQ4A 1BF9A 4HOOA 4NHYA 4YNIA 5LWBA 1G9AA 4GD4A 3VBHC 3VKNA 5L2ZL 5FY7A 1DLLA 3HO3A 4XHBA 2CJIB 4CUBA 2P3IA 5K0UB 4NHKA 2DWRA 2VUJA 1S2BA 3ZXEA 2B45X 1ATEA 1I5PA 4LKSA 1IQFL 3IT8A 4O9GA 1APQA 1IPSA 3TBDA 5L36A 5A70A 2OX0A 3THTA 2ZEZA 1PGL2 3RZLA 3KGZA 1IS3A 3I2IA 1O5LA 3LIGA 4XC9A 1AR63 2BPA2 2WZ8A 2Q1MA 5I93A 1VBD3 3U75A 5AC91 3PJYA 5FYIA 2CL2A 4LXLA 2PR3B 3F6UL 3NJPC 1CVNA 2RM21 2WA4A 2QFEA 2VMEA 1WBFA 5FZ3A 5I8TA 1ZZBA 4QX7A 3G7DA 2R063 1G9CA 3LPFA 5K0HB 3PVEA 2D97A 1KFXL 2SLIA 2BNOA 2ARXA 2YG0A 2J94B 4NGAL 4OMCA 4YVSA 3N8ZA 1UYXA 2JXAA 3KRKA 2PAMA 1VJ2A 2CU5A 3LEMA 4CP9B 2O14A 1OFSA 4Y7BB 1EV12 1UWWA 3NAPA 3BT2A 5AFEA 3U10A 2YY1A 4RRZA 1CZTA 2DVBA 3P6BA 2B8MA 1RUNA 4HLTA 5LY2A 1KDMA 5FZCA 3M70A 1QJY3 1EPWA 1H8TB 4OI1A 3N8XA 1S0JA 1LEDA 3HPTA 1UIKA 2MPFA 2RS11 1RUJ2 2HWC3 4QDSA 4RR3C 5GLUA 1JH5A 2WNUC 3TEZA 1RUC3 4QGMA 3N3HA 1KLIL 4FP3A 3ZFFB 1BEV1 2RR13 4LNVA 4WM8A 1UKGA 5KC6A 1W7XL 2WNVA 4WVWA 5TSWA 1CAWA 4KGGA 1YUFA 3OD0A 4AVCA 5DDJ3 5L7OA 3WD5A 1DZRA 5JZGA 1VBE2 2AYLA 1YQ2A 2O1QA 4G9SB 2IFRA 1F7EA 2Y5GL 2GN7A 1VBD2 4QKFA 1H2LA 4BMEA 2GDFA 4NO4A 1TVGA 3O5SA 2D93A 1WD4A 5BY5A 5JXHA 1ZAQA 2Y6HA 1YI7A 5J36A 1DQ1A 1EPZA 1OHFA 4I2OA 5A7WA 4LHKA 5CVRA 1GOFA 2BMGA 1FATA 5FAXA 2V09A 4NPLA 4RD7A 3H3LA 1LESA 1TQ5A 1Q56A 3H8RA 3TWIA 4HXCA 3NWKA 4Z2WA 4DQAA 3NNLA 2FLRL 4Y5SA 5L7OB 4Q4Y2 4IEQA 3RYPA 5IK4A 2K2SA 5F3CA 3ZSKA 2XL7A 2AR6A 1NE4A 2WWJA 2JD9A 4XIOA 2RG4A 2PHUA 1MEC3 4PQ9A 3ZFFA 3V64A 4K21A 2VWLL 1AR83 1DHKB 1ZA4A 3KT7A 4QT6A 1GNYA 1MZFA 3KHBA 2XONA 5KHIA 1YFXA 2D6PA 3LZZA 3VZMA 3WUCA 3BIWE 1O5DL 3RZMA 2BGPA 5B4NA 2HWE3 4CUAA 4AYUA 5C3RA 4AI9A 3FFQA 4MGQA 4K1YA 4HSJA 1SCSA 3U73A 1QF3A 3AJZA 4BISA 3WP5A 1OLQA 2XWBB 3ZYBA 4Q4X3 3NTGA 4QX3A 4OFGA 4AXOA 1Y4WA 2D7FA 1W2OA 5FUPA 2Z79A 3E5UA 5DUUA 3TYJA 1TME1 4KL1A 1A6CA 1G6NA 1RUE2 2O0OA 1UU4A 3KVAA 5FZ8A 5FYYA 3O1VA 2A5ZA 1RB8G 3AL5A 3PTYA 5BXXA 3EB7A 4EROA 4MYEA 5J96B 5A80A 2I07B 2WPME 3N7LA 2VQAA 3RPQA 4YSFA 2UWBA 1HT8A 1S55A 5HV0A 1PGL1 1JBCA 4KBBA 1ACCA 4QXBA 1APOA 4COVA 1D4M3 2WLPA 2RHPA 4CRQA 2JDNA 1QQP1 4KMQA 3ZX7A 4MXWB 1JYTA 2MGPA 2FLGA 5CYYA 3I54A 4PT6A 1CX1A 1UYPA 2AEYA 3J7MA 2Q1JB 1WUVA 1DGRA 1OURA 2ZGTA 3LD8A 3ZFEA 4Y71B 5L30L 3MIGA 1XNBA 1WA4A 2LALA 5D8AA 2R071 1ODNA 3PU8A 2E9QA 2Q30A 3AP5A 4YW6A 1FFMA 3ZXDA 4X8TL 3UK9A 1PIV3 4ZHNA 4CP1A 3QLQA 2CAUA 1CAVA 1WMXA 3CIHA 1KLOA 5FYUA 1S0DA 4FXGB 5JR2A 1OQDA 3UL2A 2WPHE 1HRI3 3WQ0A 3MEPA 3VBFA 3GBGA 4J25A 4UXAA 3WW3A 1AUTL 2E33A 2IVJA 1W6PB 2E53A 1N3QA 2WDBA 4NWVA 1Q8PA 2G19A 1UD1A 1LTEA 5FV3A 2XBYL 1D4VB 1SMVA 3SOQA 2ZHLA 3BT1A 4GAZA 2D3RA 1V6JA 4Y79B 2DURA 1ZM1A 2WZR2 4QPIB 3C7OA 4P9GA 4K3UA 1YEWA 2VH9A 2EA7A 2I2SA 3K4AA 4GJYA 5DAWA 4C1XA 1ZRFA 1ASJ1 2BUKA 3P1IA 4HPKB 4MV2A 4PBOA 2XPJA 4JQTA 3UKTA 1UOFA 3BTXA 2JECA 3HO5A 1GANA 1DVAL 4JQRA 3RMYA 4IDZA 2WT0A 2X8KA 2YXSA 4PBPA 4RS0A 1LOCA 4RN5A 3VB9A 2GN3A 4IE0A 2HWB2 1MZ5A 2B39A 4Y3OA 4ZU4A 3WF0A 3K4ZA 3N8WA 3LN1A 3U0ZA 1UZYA 4Q5OA 1JMUB 3MIEA 3JQXA 3MYXA 1SPPA 5E8DA 1UIJA 2A6YA 2TNFA 5T5PA 4ZXKA 4ET7A 4F8AA 4WV8A 5GLVA 1L7LA 4DEQA 5IAVA 1GZWA 1MS4A 2P3YA 1IQML 3DYPA 4J6GA 4Q4X2 4CUGA 1W8OA 2BTVC 2D1JB 3NL1A 5JOWA 2NP0A 1POV1 2YGPA 1POQA 2BFUS 5IKRA 3LFMA 5JI9A 2XQRA 1JS9A 4NRPA 3BI3A 2PAKA 1LOEA 1SFPA 4XURA 1STMA 4CXXA 4A7ZA 3UGFA 1TEIA 4R4ZA 3RWNA 1S2EA 3V0AB 2XC4L 4COXA 3IAPA 3SHRA 4LPLA 5AC92 1UMZA 1MQTC 1IG0A 2JDYA 4HK8A 4PLOA 1UCXA 1S0BA 4QX1A 5L9BA 1W04A 3D82A 4Q4V3 3S6XA 4QB2A 4PIXA 3BB6A 4ES9A 1IQJL 4E4DX 5T55A 3SMHA 1RHI1 2IFWA 2Z69A 5GZCA 4GWNA 5GLZA 3RSJA 2XR4A 3KV6A 2QJVA 1QJU2 3OCPA 1CAUB 4CUFA 2XL9A 1CJPA 3EGFA 2FHRA 4OVEA 4A3XA 5F7UA 3BALA 1RMU1 2RA0L 2GH8A 3OG2A 4ZZ5A 4LKDA 4R9AA 5FYBA 1AR62 4LUMA 3S5QA 5FMOL 2EALA 2QQWA 1GWMA 3E97A 4E2SA 3UNPA 3QH6A 2ZXQA 4K7JA 5GM0A 5T5OA 1G86A 1H0BA 2KR2A 3DPRB 3GXUA 1JZ8A 4MGTA 4FFHA 1SG3A 1RUG3 3N9PA 5CFCC 1YQ5A 2ZX3A 3I3QA 5FZIA 4DRVA 3AMNA 3Q8AA 2BVBA 3TN91 1TE1B 1S0FA 2E7AA 2VQUA 3HD8B 3KV5A 5KXCA 1XE7A 1OBNA 2QQOA 4E8CA 3U11A 3WG4A 1MQ6L 1XKAL 3NV1A 4NPMA 1ZBE1 3AB0A 5CIRA 3LE0A 4NIDA 4JKLA 3MLJA 5J1XA 4Q0VA 4CPBD 1IQHL 3OF1A 1VBE3 1MVQA 1LU2A 2OVUA 1HQWA 3E6DA 3APBA 1SLAA 1JYXA 2P94L 2P37A 2Y64A 2WNUA 3NV2A 1UF2C 4XACA 2A1XA 5GLWA 1IGXA 2VW2A 1DLCA 4RR3A 5EJ3A 4HN0A 2SBAA 3WOGA 2RM22 2XJPA 5EFUA 1LCLA 1WCQA 2DV9A 2VBDA 3MGUA 5A6QA 2E51A 1FAKL 4IEXA 2CV6A 3WDWA 3TOJA 4QPIA 3BIEA 1SBDA 1HV1A 3NAPC 3NQHA 1Q8OA 4O1ZA 5DDJ2 4OHZA 4XTMA 3ZDVA 2RJ2A 1EPHA 1HB3A 5FZLA 1IP0A 2YFZA 1NFXB 1W6NB 4XXAA 3UESA 1QY4A 1QGLA 3DL3A 5FXXA 1C1LA 3ZXKA 1OUXA 1Y3TA 1HDKA 1VBC2 1YFYA 3RZKA 1IPJA 4DS0A 4XJWA 2AH2A 2W94A 2VY0A 1CEJA 3WW2A 3AX4A 4GMP3 3RWKX 2ZGPA 4A6SA 1F9KA 2D6NA 3ACLA 1AR73 3WNOA 5IWFA 2AACA 5T5JA 5A7PA 2ILMA 4PF5A 4LIUA 4QQ2A 1GZTA 1RUE1 3HNMA 5CG8A 3OY8B 5FPBA 5CFDB 5T52A 5CFDA 2WNOA 4RRYA 1AL0G 3OJBA 4XF4A 4YZ1A 5EIYB 2GMEA 5FBZA 5JOXA 3HQUA 2CYFA 1CR7A 1DBNA 4C91A 1UL9A 4E2GA 3GISX 1W05A 1G7YA 2D43A 3CZUA 1U5YA 2WZEA 2TGFA 4B1LA 2J7MA 1WMEA 4EYUA 1FV3A 5LK7B 1A8DA 2QQUA 4Z8BA 2A73B 2ZGUA 4KWUA 4UW5A 1DZTA 2IC1A 2JDMA 4A42A 4CCOA 3KK6A 1GFF2 3NKGA 1FAYA 3LN0A 2X53S 4BQ3A 1YHFA 5A33A 1WU1B 2P3FL 3MBWA 2ORXA 2VUCA 5FLHA 5DG2A 4WVMB 2XUMA 4AHYA 3O1RA 1KDKA 3HN1A 3HR9A 2VMFA 3JD72 4CSWA 4EZ4A 1OA4A 1FXZA 3FLRA 4HONA 2OYUP 3OYWA 4LULA 1HT5A 1H1MA 3GNEA 4UBHA 4TYSA 2WABA 1OOPC 3SCGA 4S2GA 1RVF3 4IV1C 5BV6A 2VWOL 2RDSA 1OMIA 5IATA 1VBA3 2VZRA 5C4WA 3IPVB 4JTNA 3KLSA 5FWEA 4BDWA 4IE4A 3T4HB 4EN9B 3H0OA 3ZKUA 4QD2A 4TSVA 2OZ6A 4WVVA 2W52A 5FZBA 5FZOB 3FHIB 5A7QA 3MV01 4TLGA 5M0TA 3GF6A 1QXRA 2CAVA 5FZ9A 4LLOA 4Q4W3 2JIGA 1FE2A 2VJ3A 1CZSA 2E63A 3KGLA 4U2AA 1V0AA 4AI3A 3WNXA 1OKOA 1EMNA 3J9SA 3URFA 4CU8A 4IW3A 5K9YA 2VCAA 4YZ3A 4RQPB 1GQPA 2A75A 4GMP0 1E57A 1ONAA 4XL1A 1AYM1 1ND2A 4RA0A 2VZSA 5JUVA 3MIDA 3ZFGC 4BK5A 1PXXA 2DCTA 2WWSA 4O7XA 1ZBE3 1CPNA 3PUHA 1K3IA 2PHBB 4R52A 3ZSEA 1JZ4A 5CFCB 2IXIA 4CDUA 1O7FA 1TPGA 1HRV1 1RYYA 4FFGA 3GCXE 4RGGA 4NMIA 4UW3A 3IDEA 1GQHA 1YLLA 1XU1A 3WQ1A 4ZU5A 3VZOA 1G1RA 1X50A 1ZRCA 4Z82A 1NKGA 4NAMA 1O3TA 1TNRA 1U67A 1RUH1 4XJAA 4BQWA 4YVWB 2OPWA 1CAWB 4QDRA 2W9XA 5DAPA 1ASJ2 3ZR5A 4E1GA 4A44A 4LHNA 3CENL 5F19A 2WQZC 2HYXA 1J3RA 3W9AA 2QKDA 4O9EA 2GC0A 3USSA 1LULA 4W8JA 2ORZA 3OLUA 1IS4A 3BODA 1S0CA 4UI9L 5JIAA 4NHXA 2XLGA 1X9TA 1EYBA 1XRUA 5FPVA 3NTBA 3IPVA 4WM7B 5JZGC 2VOTA 2XXZA 2WG3C 4RR3B 4CTEA 2QBXA 3F1SB 1HLCA 3N9OA 4AEDC 2R49A 1CJDA 5FOJB 4M11A 3SH4A 2N7GA 4YGCA 4OI0A 1UX6A 3JZVA 2IZWA 1H30A 2BSFA 2WQ8A 2YFUA 3VD5A 1XNTA 3FLPA 3SLIA 2DCJA 3AXEA 1IQLL 3AYDA 1UMIA 1ZBA1 4CEYC 5I0DA 2LRPA 1EZQB 4YLZA 4WVMA 3MFAA 3R4DB 4UF0B 1O8SA 4JZDL 4M3CF 2BQPA 3CJIA 1EAH1 1YXWA 5HXMA 4QWNA 5CU1A 1OVPA 1POV0 3DF0A 4N43B 1GR3A 2ES3A 3MDPA 5DAVA 1IG3A 3SQOA 5I0RA 3NO8A 5K8SA 2PA7A 1W8TA 3DECA 3VKOA 2XQXA 4KU8A 3BYWA 2YMZA 4BJ0A 1U5XA 4NOTA 1W8FA 5T5LA 1JYVA 3RR3A 1BHGA 3KWVA 4AE2A 3TGFA 1JOBA 5LATA 3H1YA 5E89A 4Z1VA 1HXS2 3J4UH 2EI8B 2BOIA 3RQ0A 4PIYA 5HBAA 4P00B 1HRFA 5FYMA 1FOD3 1ZVFA 2HWF2 5FYTA 2F9BL 4S2FA 5FO9B 1RUC2 3JBG1 3BCWA 1GYKA 4OLLA 3VHNA 5K7PA 3B94A 4YT7L 1UOBA 4XMAA 5C3OA 3HVDA 1PNFA 5IAXA 1AXYA 2J1EA 1MVEA 1X8EA 4TTGA 5DZFA 3MHZA 3T30A 5LK5A 3Q7DA 1NOVA 3T1MA 2AREA 2O8OA 4ISRA 3O12A 3KL6B 4FVVA 1A3PA 2BNNA 3W59A 4A41A 4CDWA 3LA3A 3K48A 3B7MA 4N9HA 2A6ZA 1V6LA 2DCYA 3WF2A 3ZSJA 4YARA 1ENXA 4LOSA 1VAVA 1K5MA 4P9JA 1GP6A 3WQBA 2JKXA 4JYVL 4E27A 3WG3A 2AEZA 3MO4A 2VU9A 3R0RA 2XBXL 4DEVA 4LIVA 2DUPA 1JW6A 3B00A 4HBNA 1ULPA 4FOWA 3U1XA 3WG2A 4RYDA 1FMD3 2R7EB 5SV5A 4M3CB 2OYZA 4KGQA 1LOAA 4BQYA 3THDA 2VMIA 5F3IA 3DV8A 4MGYE 4GJZA 1ALYA 3MZHA 3SH5A 2R072 2D98A 3I2FA 1PMJX 4A3ZA 1AYN2 2M74A 1C1FA 3B5LB 4Q4Y3 2VH0B 4DB5A 2WZPP 1W90A 5LRSA 1N1IA 4B7KA 3ACHA 4UYBA 5KHKA 2H9EL 4YW5A 3ZYRA 3FC0A 2O8QA 2E32A 4KWLA 4BQXA 1ODMA 4M3CA 1VBC1 1UY3A 4Z0LA 5FMDA 1B09A 1HRV3 3MI8A 4BOWA 4L92A 2GU9A 2Y5HL 1WW7A 4XFFA 3I49A 1XE8A 4GA9A 5GKAC 1VAMA 2OYEP 1I9RA 2NN8A 3Q8BA 4AGGA 4FTEA 1VBD1 5AVPA 1AZDA 3AMPA 1AL23 4RS5B 2GAUA 4Z07A 3S7EA 1PO23 4MMYB 1PHMA 3S0MA 2BQWA 2BDRA 2G9ZA 1Q5OA 4YVWA 1PTHA 5LA1A 4D3WA 3HN3A 3VKFC 1UXXX 5JBCE 4N7UA 4FBFA 1CVUA 3D0SA 1CAVB 2J22A 5FY0A 5FYVA 4HVRA 2OKXA 1H6YA 3MQEA 1QOOA 3BGAA 1DYOA 2W92A 2ZGQA 4KWJA 1IHMA 1HB2A 4K6BA 2OIIA 5L9RA 1B9WA 1UPSA 4XIKA 5GZEA 2PUQL 3VHPA 1IOXA 4IEZA 4JHTA 4AVTA 1ND2B 1AR93 1Z7S3 2XGXA 3A4UA 4QHBA 3VDAA 4FM5A 5IVYA 3LC5B 1RVF2 1SQ4A 4LBLA 4E8DA 5IW0A 3LGRA 3G6JB 1HQNA 4PI2A 5FK7A 3W20A 5JI7A 3HT2A 2Q5TA 3KB5A 3BN6A 1OLRA 4CEYB 4FPEA 4QKNA 3T09A 1R092 2W5FA 4I3PA 4I09A 4XTPA 1XC6A 2CY6A 2XOMA 3BPSA 4LE4A 5IKVA 2ID4A 5KC5A 1G8WA 1J59A 4XBLA 2HH9A 2HWD3 2WBKA 2P3TA 1DQBA 3UKVA 1NCQA 5A3PA 1AF9A 3JUUA 2P95L 2PHXA 3LDBA 3M7AA 2YC0A 3I2GA 3KV9A 3MUY1 2JG8A 1FOD1 3NVCA 4QQLA 3VZJA 5B4XA 3HOBA 1TOZA 4DOUA 1QKQA 5FY5A 1U8CB 2DUOA 3OOXA 1F5JA 4G4FA 2RS52 3KHCA 4CCLA 3WF4A 5JVZA 1WWYA 1GWLA 2QVSB 1WZXA 2GMMA 1L5GB 1PO22 1XBFA 2BW8A 2EXHA 2W08A 3HS6A 3B9CA 3OGVA 2YGQA 1VPHA 2Z5WA 3NW4A 3HIFA 1ZZ7A 3DXTA 2R16A 4Z92B 3ZXAC 1H9PA 3M3OA 5LBBA 1M1XB 2ZX0A 4MSVA 4BH9A 4GKYA 3U14A 4URAA 4HVOA 4GU4A 3ATGA 3L2YA 2RR12 3H50A 2R041 1EBVA 1UU6A 2UWLB 1EAIC 1HRV2 4NA9L 2ZGMA 3VBFB 4ATEA 4BXSA 1J3QA 4XFIA 2HWE1 2VBBA 1QWRA 1B35A 3VLBB 2WT2A 2VOVA 4I0AA 1V9U1 4UW6A 1C8NA 4XUQA 3USUB 5CG9A 5K0UA 1T6BX 5FYCA 2ET7A 4HKWA 3ZFEB 3I59B 4RHV1 5JR7B 4MO3M 4GH4C 1LR5A 4QPGC 3FUOA 4L99A 5IYYA 3TZIA 1B35B 2IXJA 4CDQC 2WZR1 1PNGA 4FAGA 2WR9A 4U36A 1HQLA 3AP6A 5ANNA 4RFT0 1LOFA 5FMBA 2PHDA 1WBLA 3JU9A 2VW1A 2VUDA 1URXA 1W6OA 2ZMNA 4QAWA 3RFRA 3AM2A 5LBCA 3N8VA 1RUI1 4JTOA 2XJSA 1W6NA 1HXS1 3J8F3 5AFBA 1QNWA 1YQCA 1G1SA 2EAKA 2Y33A 1VRH3 4B4QA 3VD9A 3BKZA 1WGPA 3IDAA 4QU2A 4H14A 4X6QB 1OB1C 4MMZB 5FZMA 4FQ4A 4MVTA 4BXFA 3BUCA 3ZXFA 4DUVA 2OZJA 4LUKA 1MPXA 2J2UB 3E1F1 4I0WB 1SLLA 2V73A 3CNAA 1LPZA 3ELNA 3H1WA 5C4WB 4XAAA 3UETA 2C9AA 3T1LA 4DRRA 1BMV1 4BQ2A 2W47A 5DABA 1OLME 1PIV1 1R093 3VKMA 3WR0A 3VL9A 3KZ4C 4QGNA 3N9QA 3HO4A 5FLJA 1PO11 2B4KA 4WM7C 5I46L 3FWEA 5ABJC 5GALA 2XMLA 4B8EA 4AEMA 4IGOA 3GHNA 5FP8A 1W3VA 4FPYA 1HJFA 3MIFA 1TMF3 3OUHA 4K40A 3WG1A 5CFDC 3C9AC 2VVEA 3EMRA 5FYSA 4RRWA 1F5FA 2ZABA 2VVVL 3DEMA 2FD6A 3WDTA 4HT1T 2K2SB 2FCUA 3DUIA 4W6WA 3SC7X 4QM8A 3TN92 4AZZA 3LFIA 2JJLA 1NFUB 3IIAA 4AFAA 1VBB3 3U07A 2UURA 3LF7A 3MIHA 1IQGL 1XXNA 3ALQA 1WCDJ 3MW2A 4FPCA 2WPIE 5L73A 2VQ0A 5CBLA 2YYOA 1HIXA 5FXVA 2EXIA 4ASKA 3RZGA 3UJOA 5DAQA 2HWD1 1KXGA 2JKHL 1RUF3 5JCTA 3TEWA 3WDXA 2HKXA 1AUYA 1V6IA 1QXPA 2WAOA 2VOXA 1FV2A 2ZGOA 3IMMA 3I3EA 3MUZ1 4MZUA 4ORFA 1YUGA 1KJRA 2WS93 4DXRA 3ETQA 1QNYA 4TN7A 3TEYA 1E5RA 1IOEL 4IL7A 5F6LB 1NA1B 1QJEA 4MLOA 1U12A 3EBRA 3DXUA 4XF3A 5FP9A 3VBSA 2ARCA 3FJSA 3POIA 1W2AX 1N3PA 4XJUA 2VULA 2Y0IA 2Y6GA 2J1UA 1R1A2 3S6PA 4CCKA 4OUMA 3VHRA 5FDBA 1ZNPA 5FO8B 4TLFA 2HWB3 1G9BA 2X10A 1NLQA 5FYHA 4P9IA 3VZNA 5JXJA 2XVLA 4IXLA 1DX5I 3IMNA 3NKTA 3VZLA 2XLAA 3CDZB 3EYPA 1HKDA 3WP6A 3WDVA 4BPZA 3O1UA 2RV9A 1W06A 3N7KA 3ZLIA 3CZJA 3AVSA 2MEV3 2FZ1A 2VZOA 3GZAA 2GMPA 1GSLA 2ADEA 5ISLA 3OUJA 5FZ0A 2PMWB 1IVOC 5J98B 4LR4A 4NR1A 3AFGA 3HPNA 5H9RA 2A7AA 1LPKA 2PHFA 2XLFA 2QNKA 2VVUL 2Y26A 4AR2A 1HW5A 1OXCA 1MZEA 4FT8A 1JYCA 2KV4A 2ZGRA 1MZ6A 4LHSA 3VBHB 2PQSA 4HPKA 2BOHA 2CWSA 4ZS3A 2NM1A 4D94A 1VBB2 2KXLA 4HZFA 3JD73 2A71A 5KHJA 4XJZA 1O3SA 1N1YA 1VMHA 4AW7A 2R1BA 4PIZA 4B7EA 2BQ7A 1W9YA 1PGW2 2QUOA 3FCSB 1PVC3 4BA6A 1P0SL 3C8XA 4CDWB 5EGMB 3S5AA 2PLV3 5JAXA 4RRXA 3MF6A 3ZPOA 1RUF2 2ZX1A 3F95A 5GZFA 4X8UL 5DG1A 2BWAA 4PJYA 3LAQA 2ZPXA 2K46A 2VAUA 3LA7A 2Y60A 2LS6A 4MXVA 1Z6EL 2Z42A 4HK9A 4N90A 4CP2A 4OQ8A 5G05L 1E5IA 1SBFA 2VZVA 3IDCB 4PH9A 1OT5A 2J42A 4D8MA 5A32B 3VD3A 1R091 5D8AB 1GUIA 4NWWA 1YO8A 4P5YA 1ZX5A 1VBA1 4DXTA 4IE5A 1S1AA 3UJQA 2AYHA 5C7GA 3V0AA 3OTFA 2WNEA 2LROA 3I8TA 4M10A 1W3XA 2YDEA 1NXMA 2WFPA 3KD4A 2K2TA 2QCSB 1XNKA 5FUNA 4YPJA 2VZPA 1SHWB 2HWE2 4XE9A 5EJZB 2FMYA 1RUD2 2PHRA 4UFHA 1W03A 5FZHA 3ROUA 2QQPA 3DKQA 1DGLA 3N7MA 3SOVA 1Q43A 1AR71 2EIBA 2HWD2 2JE7A 3FN9A 5I0TA 1GZ9A 3WP3A 4ES8A 4YZ2A 3IBMA 4Y4YA 2KM2A 5JPNB 1HCGB 2WJSA 2XDVA 1XSRA 4JCKA 3WF3A 1RJ8A 5FCCA 3ZFFC 2EXKA 2RS31 3EQEA 3FLTA 4EZHA 4TWTA 4LA2A 1PZ8A 3SEEA 3AYAA 3VBRB 1JYWA 1UW8A 2BERA 4UFIA 5F5AA 5IVJA 5CISA 1DGRN 4PLMA 1UN1A 4K8RB 3CJIC 1PVC2 2EVXA 4D0QA 2QQKA 1WW6A 2WO3A 3QBQA 4MHUA 2YUEA 5HV4A 3ACIA 4TXWA 2VZTA 4Y33A 5BPXA 4CCCA 5BNPB 2Q1ZB 1SLIA 3LKJA 1X7NA 1LK9A 1VMJA 5F5IA 3VBRC 1D4M1 1HX6A 1R64A 1W6OB 4BQ1A 1C5HA 2L9LA 1YGCL 5BNNC 1YRZA 5C3SA 3ORJA 2G1MA 3ACGA 1A78A 3ZPYA 4Y4RA 1HJGA 3P3NA 1CAXA 1KEXA 5FPXA 2VNGA 3GBFA 3NV4A 2I74A 4QX2A 1RVF1 5C8CA 2TEPA 3K46A 1DF0A 3WDYA 4CUCA 1COV1 1RUJ1 3SKVA 5F1AA 3WZ1A 5LEJA 3OSDA 2VPVA 2WO1A 3QH7A 3SISA 1HZ8A 4CDXC 5DUVA 1WMDA 1DZQA 2HEYF 5FZEA 4YW2A 4AAPA 4L9BA 2EIGA 4RQPA 1SZBA 3B3QE 4XJ9A 4CU7A 4K8FA 5DDJ1 4RUTA 5K0UC 4OMDA 1DQ2A 5AVAA 5ERLA 1YYNA 4ZXYL 1IQDC 2ET1A 3HNBM 2BOUA 1TLEA 4KBZA 3KVBA 1B35C 4CDQB 2WNVB 4M3CE 5FQ0A 2PHLA 2ZMLA 3VDDA 1BBT1 5JBAE 4OUEA 5FZOA 4LBMA 2A3XA 3A7QA 1RUG1 2JE8A 4NAOA 5ACA1 2B5HA 1W8BL 3LSDA 3TNPB 1UU5A 1WHEA 2VCBA 4IE7A 2BYVE 1DCSA 1BVP1 4YZ4A 4YVWC 1I1EA 4CZSA 2ZMKA 1V70A 4ZONA 1W99A 2UWPB 4Y20A 2FDHA 1XYPA 2WFF2 4LBNA 5DMYA 3HQXA 3IB3A 2R32A 2Z4FA 3IAQA 2Q8CA 3WHUA 2XJVA 4C16A 5D1IA 1HV0A 4MGZE 1W9FA 5JSPA 3FFGL 2ARBA 3N7JA 4DUXA 1MEC1 1IS5A 2RVAA 4CU9A 3CO2A 3M1HA 5FQ0B 1H8TC 4HETA 5C4WC 4KU7A 4NHMA 3I2OA 2ZEWA 1PMIA 5FO7B 2W1SA 4LBJA 2GH2A 1KIGL 1XKBA 1JXNA 2JDPA 3UKNA 3N9NA 1J84A 1YIPA 1XB9A 1A3KA 3E6BA 1AX0A 2OT7A 2WFF1 4QU1A 1SFYA 5FP7A 5HPOA 2W39A 4LO6B 3BTAA 5SV8A 3I3BA 2WIIB 2J1RA 4QHZA 5DPNA 4CDUB 2E7TA 3FBYA 3B02A 3VBUB 4AF9A 3H3UA 1BYHA 1N3OA 4QQHA 2WQ4A 2ZEYA 3RVHA 4Z6AL 1RITA 4UFMA 1ZBA3 4L8QA 4NRMA 1VE0A 3VGIA 4XUOA 5FOBB 2VCMA 2WA3A 2DFBA 1RC6A 1NXD1 1EY2A 1WLDA 3VDCA 1WKYA 4ZKTB 3ZVXA 1XNDA 2XC5L 2P3JA 3X29B 1QJX2 4XILA 1Q8QA 1DQ4A 3GGLA 4CDUC 1BK1A 3PMEA 3Q8EA 4QHOA 4XXPA 5C8CC 3GCXA 1QQP3 3CHXA 3D8CA 1EMOA 4AVBA 5HI0A 3RGBA 5IK5A 2ERFA 2ZA9A 2NYYA 1J3PA 2BT7A 1FI2A 1AXKA 1V6KA 4HANA 1PM4A 5AC93 4D7YA 2BWCA 1JYNA 2ZOEB 1OKQA 2EXJA 2P4EA 1IGOA 4QB6A 4AVVA 2FZ2A 1Q3EA 4XF0A 2ZX4A 1R082 3GALA 2BP6A 3HJRA 4IEYA 4Q27A 3WV6A 1RUG2 1DP0A 3VBOA 3ZOIA 4AFDA 3FX3A 3CA7A 3OGJA 1LOGA 2XJUA 1COUA 1LHNA 4URTA 2VMCA 3ES1A 3UGGA 5KHGA 3M4FA 2WYJB 3LWCA 4K1ZA 1S4CA 1ND3A 3P5BL 3S7IA 4D6SA 3BPSE 2YPJA 1WCKA 4UFKA 3WNMA 4FAHA 5COXA 2JD4A 3WCSA 4YT6L 4H7MA 4MMXB 1BQPA 3CEWA 3POGA 2CGNA 2G00L 2C1FA 4YZUB 2WPKE 4Q0UA 3DYOA 3Q8CA 4COYA 1BCXA 3N36A 1OC1A 1FSBA 1W9SA 3D6EA 3QOPA 2XBO2 3LOIA 4IETA 4CDQA 5I8YA 5KXBA 1Z78A 2V5DA 3B9IA 2VZ3A 4CEYA 4BXSV 4FPOB 4LBQB 2R042 3SXWA 2P3UA 1GK5A 4FSJA 3S30A 2V5YA 3VD4A 5FIXA 1N1SA 3KF3A 4AG4A 1OH3A 4QPGB 3FMGA 4CVUA 3W5MA 4XYXA 2WFXB 1W6QA 3OEBA 5C6CA 4CE8A 5FPZA 4CEWB 2QQMA 1QMJA 3I3DA 2W86A 4BQ5A 1BMV2 1D0HA 1WLTA 4UAPA 3RYKA 3OBAA 1YUDA 2FDJA 3USUA 5LBEA 4F3JA 4LO5B 5KBFA 4XFHA 5IK8A 1XE0A 3QACA 3O0XA 3U4XA 5GZDA 3RRDA 1LQDA 5C9AA 2BT8A 2QQJA 4Y1XA 1XQNA 4KQ7A 3KQEL 1POV3 4FPJA 3ZDSA 4E4HA 2J1TA 4YFZA 2W2NE 4OQ9A 3K3NA 4CCJA 1FYUA 2KD7A 3JB4C 5ACA2 2EI6B 1Q8VA 4C0HA 3SW2A 4BDVB 2VWNL 2YHJA 1NY72 2XBO3 4S2DA 2VWMK 2ZHNA 2GSYA 4AFMA 1QH7A 1LAJA 1YCIA 1WW4A 4LO4B 1H9WA 1FT9A 2H0VA 1YJKA 5A6XA 4PQQA 1VB2A 4BU2A 1NAEA 5HCAA 3C7GA 4M4RA 1QH6A 2UWOB 3BOWA 3IITB 3SOBB 3EJKA 4BLJA 3KCCA 3O0VA 1HN0A 3AYEA 1AYN3 1Y9QA 2XBWL 4Z2AA 1W2TA 2RDNA 1TME3 4WM8C 5FY4A 4NIAA 1G9FA 1V6OA 1ENSA 1IGZA 2VH6B 1ADXA 1BEV3 1GP4A 1O91A 2RR11 2YBKA 3AZZA 4P02B 1D2QA 2HWC1 5FK8A 5KHHA 4AEJA 4BYYA 1D7PM 2AZ5A 1QJX1 3ENRA 3H9AA 1H2NA 4AI0A 1XYOA 2H6CA 1AJOA 1BBT2 1IKPA 2W3JA 2PTMA 3BPZA 4C0BA 4IV1A 3IDBB 2YGMA 1D0GA 1VR3A 1ZRDA 2IXCA 3M3EA 5FWJA 4ZPIA 4CPBA 1K45A 3O14A 1ZZ6A 1N1TA 4GKXA 4R9DA 1I6XA 2A70A 1UY2A 1W8ZA 2ZGSA 4AAXA 2VCCA 3ES4A 4IV3B 1VIWB 4W50A 2Q8DA 1LHWA 1V6MA 2XKOA 3WW1A 5HCFA 3WNPA 1YWKA 4N53C 3K4DA 1X9PA 4LITA 5BNQA 4N9IA 3ZYJB 2Y81B 4QPWA 1H6XA 4FPLA 3MPPG 2WFTA 2DU1A 3TK5B 4XCAA 3VUOA 2UWCA 1PO13 1W6QB 4CP0A 4YGDA 2WPLE 1AR61 1BKZA 4IV1B 2NPIA 1XPWA 1UY0A 2Y6FA 1ZRRA 4KI5M 3T0AA 4SLIA 1BEV2 1ULCA 3QCWA 2YBSA 4KG0A 3PJQA 3CL1A 3ZYPA 4YFWA 4QB1A 5H9QA 4UFLA 4YM3A 3IN9A 3ZYIB 1PX4A 5L19A 5CEHA 3VBHA 2XB6C 2ZX2A 3VDDC 4A7KA 3D5OA 2V4VA 2OUHA 4XFCA 5E88A 2NMNA 1JZ5A 5BNOB 1ASJ3 1EPJA 2VZ1A 1NT0A 5F37A 4FP2A 1H8VA 2X05A 5A1LA 3NNJA 2E31A 4IESA 1CZVA 3POJA 1UZPA 2RNLA 3T08A 2X29A 3POFA 5F3GA 3EO6A 2R0FA 4NIIA 5FLIA 4JKKA 3GJBA 5GZGA 3VBOB 4RQPC 2W26B 2RS13 4XFBA 1UZQA 4Y5Z0 1WLCA 1XDTR 3DGTA 3PU3A 4YM0A 1IJQA 3B93A 2JICA 4Q26A 1WHFA 3H42B 4HSLA 5A3WA 4CDWC 5LB6A 1C8M1 4G1MB 1RINA 1G1TA 1HXS3 3J8F1 1J83A 1PRHA 3CFWA 5GLTA 2W2ME 4Z0KB 1RXFA 4Q29A 3POYA 2F4PA 3WSOA 3ZMOA 1JYIA 2QQNA 2MGRA 2DTYA 3AKRA 5EZWA 1V1IA 5ABJB 4NUBA 5LEKA 3T2QA 4FPHA 1XYNA 3M3CA 5FKCA 2QZ2A 5DUWA 1QXJA 3HAGA 5EJ1B 3AKTA 4MGSA 1GU3A 2RS53 2VD7A 2W0XA 3H7YA 3PIJA 4P9LA 4XPVA 2VOWA 5CFCA 2HOXA 1NCRA 2DBNA 1LOFC 2R073 5A7WB 2JG9C 1W8HA 4AQSA 5JPMB 2WO7A 1CX2A 4AFBA 1HRI1 1HB4A 4MUVA 3SH3A 5JLVA 3BU7A 1U5IA 4QPGA 2WL1A 4AHZA 1ND3C 1R083 1Z0HA 2Z2SB 3C7EA 4XUTA 1W2UA 4D7SA 5C8WA 5C33A 2JDAA 4C1WA 5JZGB 1AR91 1Z7S1 1H4HA 1DFQA 2JEMA 1G1QA 3A0NA 1W9TA 1LU1A 2WYGB 4HKOA 1PK6B 3RYRA 2BV4A 1K5JA 2GP5A 4AOCA 3AKPA 2P5BA 1PO12 1ZYBA 2A6WA 4WM8B 4QDQA 4FFFA 2YC2A 3POWA 3TEXA 4UF0A 3DCQA 2JWPA 3ITQA 3V0BA 4XFGA 3ZN6A 1NZIA 2XBVL 3DN7A 3TRSB 3J26N 4A7IA 2AUYA 2RDQA 5FY1A 3J7HA 3SKJE 2GP3A 4EN0A 2FLBL 4CUDA 1DYKA 3KCYA 2HWF1 4N43C 4YYOA 5DZGA 2YGLA 2J4IB 3MFCA 4NN0A 1JHJA 3TH3L 3MPBA 1OFNA 3NSTA 4FO9A 4AI8A 4BMBA 3ACFA 1ULGA 1F7MA 1FMD2 2ZGLA 4H7LA 4Y1YA 4ZZ8A 4GIQA 2W3KB 5JIUA 3SCFA 2P3FN 3U78A 4DFSA 4HL0A 4FPKA 1PZ7A 3AMQA 4EWAA 5HCBA 3K3OA 4HG6B 4BTUA 3QD6A 1SEFA 1SCRA 4IV3C 5G04L 1VALA 1ZZCA 2W87A 5T3NA 4QQPA 4E9KA 1NLSA 2IUWA 4ZU7A 3WP4A 1LHUA 3M3IA 2NLRA 3N9LA 1GOGA 4JGZC 4JRAA 4FPFA 4O02B 2R062 3L9JT 4WVZA 5FY9A 3AFKA 2FDIA 1UPIA 1JOJA 3W21A 3H7JA 1SLTA 2C26A 5IKQA 3NNGA 4JGYA 4GWJA 4Q2FA 1FNYA 3ON7A 4Y22B 1LJ7A 2P17A 4MX3A 1FNZA 3ZFGA 4BE3A 1OH4A 3PUAA 4H55A 3MICA 3PIGA 2Y7ZB 4OTYA 1PGSA 1UKRA 1QDCA 4YRDA 1JI6A 5JW1A 3RG0A 3I59A 4CUEA 2HEWF 1N47A 2MHFA 1IOAA 3AP9A 3OY8A 4PF1A 1OVSA 4LHLA 3F2ZA 1XSQA 3VV1A 4ARYA 1FJSL 2UY9A 1COV2 3ZFGB 5DQ0A 3ZSMA 1MQTB 4NE9A 1S2KA 5I0UA 1QJY1 2HORA 1WCSA 3JD71 2GALA 1J9CL 3BTZA 1RMU2 1QIUA 1ZZ8A 4XF9A 2FCVA 1CCFA 1C8M3 1QOTA 3CF6E 3OBZA 5DAXA 5L2YL 4Y5TA 5H9PA 2JG9A 4W4ZA 1BK0A 2W1UA 4RS5A 3RI8A 1T2XA 1R1A3 4EWDA 3O1SA 2OS2A 1RHI2 4DY3A 3RDIA 2E7QA 5FJKA 4DNYA 2X09A 1CVWL 2VTFA 5JSOA 3D3AA 1RUI2 4GH4B 5FUIA 4LT5A 5FZDA 3ZN4A 5HXVA 3BTYA 3KQ4B 1M06G 4COUA 4CSYA 1K37A 2F17A 4Q1RA 1OPOA 4R8HA 2DFCA 2WS92 4C8DA 4EQVA 3ILNA 3BOPA 1O5UA 1AJKA 1NQLB 2JIJA 4XQDA 4F7ZA 1SDWA 1NCQB 1C4RA 3ZYGA 2VZUA 1F0SB 4CU6A 1TME2 4XDOA 3V0BB 3KQBL 2JDZA 1BZWA 2B7YA 1DGWX 2ZAAA 2ZS6B 2BFUL 3HBZA 5BNOA 2VC9A 3POEA 2VXJA 3AVRA 1PZ9A 2JDHA 3V65A 2A3WA 4COZA 1LGNA 1O3QA 1W0NA 1DQ0A 2I9AA 3C7HA 1IQAA 2Y34A 2H9EC 3R4SA 5T54A 2NZ9A 1Y9GA 3GM8A 2VTXJ 1G2LB 1UZ0A 5KWRA 3T2PA 3AZXA 3R6SA 1S0GA 3AXDA 4IQPA 4WZCA 2MEV2 1JZ6A 3WY6A 4B4RA 1AR81 1W6MA 4UW4A 2DVFA 1CAUA 2GC1A 1Y9MA 4Q4Y1 4IEVA 1RUE3 5F3EA 1KJLA 4GMP1 3WVJA 5A32A 3PUSA 2FDGA 5FZ1A 1GWKA 1C5IA 3NJZA 1IZ3A 3S57A 1UXZA 1WD3A 1NYWA 2J95B 1FPN1 1WMFA 3KV4A 3ZSLA 1OQEA 3PUIA 2RMU3 3PNAA 2QZ3A 2FMDA 4NHLA 4QPIC 4YW4A 1OD3A 2X5IB 3RNSA 1LMMA 3ABZA 2VXRA 3WNKA 2XJRA 2XVGA 3Q8FA 1NCRC 5A3UA 4ZAEB 1OSGA 2WYFA 3MLLA 1HB1A 4AL9A 1W28A 2BRTA 2P34A 4MXWA 4EWEA 5LA2A 1KS5A 3CLPA 2E26A 3LB9A 2EICA 2UYAA 2BOKL 1RUI3 2CDPA 3TN93 1EV13 2VVDA 1EP0A 1GZWB 3T4VA 4K9SA 4QKDA 2W95A 3EHKA 5CKMA 1M4WA 3NJYA 2R0HA 4FPGA 4OUSA 4XMIA 4CDXB 2CNAA 1LB2A 2WAAA 4P5HA 3KQCL 3CJIB 1UZVA 1KGYA 2DVDA 4ASLA 3LDKA 5LA0A 1RUJ3 4LMFA 2HWC2 2XH6A 1PVXA 4CCDA 4YZ5A 3MV11 4RGKA 5L7OC 1FAXL 3FE5A 3ILFA 1NQJA 3K9XA 2MEV1 5A3MA 1CPMA 3DYMA 5EXOA 1ULOA 5BNOC 5BNNB 3E6CC 2XWJB 3FUQA 5DXDA 1RUD1 2P1BA 1DYPA 1LNSA 2DCZA 4HKLA 4GH4A 2IXKA 3ASIA 1BVVA 5CADA 2JX9A 3THPA 4H2AA 2J1SA 4XF1A 1YQ6A 3PVBB 3QH0A 1W8WA 5FBJA 5IVBA 1LEMA 1EAH2 4LKFA 1SBEA 4AQTA 3KQDL 1X7AL 4PDWC 1W6PA 2LM3A 3NV3A 2VL4A 1MS3A 2OW4A 4JRLA 5IVFA 3BVCA 5C3PA 1N7DA 5D21A 4CXYA 2UU8A 4LK6A 4YGEA 2VMHA 1MQTA 1GLHA 2VM9A 4KNCA 4D7TA 1IQNL 2R1DA 2VNRA 2W2IA 1C57A 2ZZJA 4GWIA 1UY1A 4ITCA 4JAAA 4JGYC 1YJLA 4FTBA 3HT1A 4X8VL 5FFOC 4ZS2A 1RUF1 3D0JA 4JZRA 1JHNA 4IGPA 2DU0A 4QX5A 1DDLA 3NMBA 3VBSC 1LKNA 4ZHAB 4INDA 4OZOA 1IPKA 4XCBA 1RXGA 2E6VA 2BOJA 3C3VA 1Z6CA 4D6QA 2J38B 1VAKA 2CGOA 4I30A 2Y80B 1RUH2 1KQRA 3KF5A 4JGYB 4LBQA 4AK3A 3OPTA 1NCQC 3FZ3A 1R1ZA 2RJLA 1ND2C 2BEOA 4Q1PA 3LEIA 2PELA 1D4M2 4XJ8A 2WFF3 3IWZA 2FQPA 2TUNA 2DUQA 4AHXA 1QJU1 1WLWA 4UOJA 2D6LX 2YV8A 2YZ4A 4CA9A 3PLQA 5FTTC 3PVOA 4P9YA 4ZXXL 5JMCA 1CWPA 5LA9A 3AC0A 1ND3B 5IVCA 2OXBA 5F32A 1H8TA 5FREA 1XOYA 2R30A 2LTNA 4OI2A 4RL7A 4XDQA 3R4UA 4Q4V1 4OZXA 1E5SA 5F2WA 3RJRA 2B9UA 3JQWA 2BQ6A 3LCPA 4O65A 4XFAA 2RDRA 1OA3A 4EN8B 3FL7A 2BO2A 3KT1A 2MNGA 2AGSA 3LDRA 2ZGNA 2JB4A 5KN5C 3H1MA 3NAPB 2HBUA 1F4HA 4H3WA 4CDXA 4FI9A 2Y8KA 4UFJA 3ZN6B 1JTZX 1DGWA 2XVKA 1EAH3 4DPNA 4WZFA 3VHOA 2VG9A 5CA6A 4RFRB 1U5ZA 2ZACA 1KITA 2C24A 1AR82 3C7FA 2WPJE 1GQGA 2FCTA 3LIWB 4A7YA 4OHYA 5C9AB 1F4AA 1F15A 1C5MF 1YIFA 4FFIA 3A22A 2X5IC 4I3GA 5J37A 2FDKA 5JB8E 1X8MA 1NE6A 3J8F2 3KCGL 3E5QA 5F5CA 4AEKA 3GCWA 4QXCA 2C5DA 4XOGA 4MGKE 5FXWA 2P28B 2ZAHA 1YUKB 1ENQA 3THCA 5IVEA 1JV2B 1RTVA 3E5XA 1KSNB 1NA1C 4FQZA 4LE3A 4QM9A 4YGBA 1FX5A 5IT6A 3PURA 5F9TA 4FOYA 1XJAA 4Q0QA 2CGPA 1NCRB 2ETEA 3AZYA 3VBUA 3JXSA 1CN1A 4AQ6A 1ZBA2 5LCWL 1TMF1 4KWKA 1UZKA 1OPMA 1RUH3 4JZEL 4Y22A 2ENRA 5A1AA 2Q8EA 3ZIXA 5L9VA 4E4SA 1UAIA 5JB9E 2G9FA 2LUWA 2WG4B 3Q3KB 3KS7A 1U0AA 4P9XA 4R4XA 1J1TA 3VL8A 5JMOA 1IQEL 2HBTA 4QXKA 2OPKA 1MACA 3WNNA 1PX3A 1S0IA 3OBRA 3NNFA 4XBMA 1DDXA 1C3HA 1DIWA 1X36A 2W1QA 2VO5A 3V65B 2GC3A 2YC4A 3U7UG 3O1TA 3Q9OA 1JU3A 3SITA 1PM7A 3VBOC 3GDBA 1PGW1 4ISIL 3O0WA 2Y6JA 3CS7L 3M37L 4MGIE 4C90A 1L7QA 3ZXGA 3CJXA 2NMOA 1EPIA 2CSGA 2LW8A 3SEPA 4MHRA 5IVVA 1RIRA 3N35A 1AL22 4GQ7A 2P26A 3I2JA 2ZHKA 1W8UA 3OUIA 4JYUL 4CXWA 4EV0A 4B4PA 4HVQA 4RS5C 3OLTA 4XZPA 4LOTA 3LSEA 4CCMA 4ASMB 4CP9A 4KH9A 3TK6B 4XDPA 3DPRC 5JDBA 1WW5A 4XUNA 2PYTA 3A23A 2XJTA 2WYSA 1QQP2 2PAEA 5EWSA 4LEJA 3RI9A 1OF4A 3DKWA 2VQTA 2A6VA 4PDWB 5DUXA 2H0BA 4BK4A 3AZWA 5FR3A 5FP4A 3ZXLA 2Y6LA 4XQWA 2D6MA 3WW4A 1A8MA 2BJSA 2KA3A 4JV4A 3BU0A 4JX0A 2D44A 1K12A 4Q4W2 3HWJA 2RMU2 4N53A 4BIOA 5C5TA 3CKHA 2W91A 4JDNA 1QHDA 4R9BA 3LIHA 1PMHX 1J1LA 4XUPA 3WHTA 1H4GA 2F6BA 2NQYA 2R043 5FRAA 2W3IB 1MEC2 3N9MA 5LY1A 1HN1A 3U37A 2ZHMA 1RUOA 3JBG3 1QJU3 2R061 2MHPA 4OTJA 4BTTA 5JVVA 3B01A 2WN3A 3K77A 5CZKA 1CESA 3ELAL 2DVAA 2BGOA 2QDNA 4AWDA 2VTXA 2B7DL 1MS9A 2C6SA 2DTWA 1YQ8A 3AKSA 4G3YC 5FPLA 4DZGA 2B42B 1O3RA 3K75B 4XEZA 1CD3G 3H3ZA 4Y26A 2V72A 3T2TA 3L2HA 1MS8A 4O61A 1QIQA 1H1AA 1UMHA 1US3A 3CU7A 3PL0A 1YC61 2JG8C 2CDOA 3J7LA 4BIFA 4DY5A 4BWOA 3GZTB 5HCHA 2UYBA 4AGVA 2BBVA 4Q4W1 5FJHA 3FFZA 3NJXA 3LC3B 3A21A 3MIBA 4Q0SA 4Q4V2 4BTIA 4A45A 3GJAA 4Y76B 4EE2A 1GOHA 4V2VA 1AR92 1Z7S2 2A3YA 2WSUA 4NRQA 5BNNA 3H5CB 1SPPB 1UO9A 1XU2A 4W6XA 5J48A 1UZZA 1F31A 3HS5A 3VKLA 5FZFA 3WLUA 1FPN2 2FD8A 4Y1UA 5IKTA 4IGQA 4JHZA 4E2QA 4QKBA 1Y7BA 4DXSA 3RS6A 4MH0E 1CONA 1PIV2 2OQ7A 5C71A 1XFEA 5C9AC 3H8UA 3ZYHA 3HS7A 5FZ6A 4XZUG 4IE6A 4EN7B 2BNMA 1GP5A 2EAAA 2YBPA 3DPRA 1LRHA 4YW1A 2RM23 2GNDA 2ATFA 1AR72 1FF7A 2PXJA 2BBAA 3SNMA 4FCAA 2PLV2 5GJ6A 3KM5A 2Q1FA 4LO7A 1OOPB 1REEA 3WINE 3IJEB 2WWUA 2FDFA 2BZDA 3TB0A 3ZN5A 1N1VA 1URKA 1SLBA 3JB8A 3HMYA 3K2OA 4Q8LA 3MLKA 4GU3A 1W39A 4OHVA 5IK7A 4DO0A 5KR7A 2Y38A 4YG6A 2BOXA 4AQ2A 2VRSA 2DDUA 1OF3A 4JGZA 4YW3A 3A0KA 1KFUL 2P93L 2CHHA 1QOSA 2P2KA 1F8VA 3WUDA 4IV3A 1MS5A 1I3HA 2D40A 2VNVA 3T3YA 4JDMA 5CB7A 1GMMA 1QDOA 1RUC1 2D3PA 3CQOA 3JBG2 4LBOA 4QPYA 5ABJA 4CEWC 1W6MB 2JDKA 2WS91 1GZCA 5F1RA 4D90A 5I91A 3VDBA 1Q4GA 4JVAA 2HJIA 1VMFA 2WZR3 2HWF3 4FOVA 1OOPA 3VN4A 4GB33 5KXDA 2PN5A 2W2PE 2GD4A 1SDDB 2RJKA 4YM2A 3ZFEC 1VLNA 3LEKA 4KG8A 4IERA 4EN6B 4L11A 4BZ4A 1OUSA 1SFNA 2WUHA 4RSUA 1QFKL 3TNQA 1HRI2 2HWB1 3UT0A 3ZM8A 3HEIA 3VBRA 4LK7A 1AVBA 2NPRA 5FZ7A 3N8YB 4Y24A 2VVCK 1J58A 4IUGA 4M01A 4MOAA 3ZXJA 2WINB 2WSVA 4NIGA 2WC2A 3PTRB 1HJ7A 2BU9A 2G4IA 5J7MA 5FDQA 1PK6C 2CWMA 2RE9A 1WA6X 3P3PA 3OGRA 5D2AA 1MS1A 4AHWA 4FOQA 5E16A 4LTAA 4XABA 1LENA 2Q4SA 1DIYA 3VBUC 2QDRA 4WM7A 3ENSA 2GNBA 5FPUA 4FXKB 3I97A 5IJRA 1QJFA 2DCKA 4PCRA 2EIEA 4E4ZA 2J34B 3POBA 2JG9B 1O59A 2JE9A 3W58A 5CNAA 2D5HA 3VZKA 4BLIA 2V4AA 4OULA 3QMOA 4GB32 5ACA3 1V1HA 4YM1A 1F35A 2AC1A 2X5IA 1BJQA 4I02A 4J1WA 4META 3OPZA 4CCNA 4Q8KA 1EQGA 2ZEXA 1MR5A 3CBNA 1VBB1 5JOZA 1KKEA 5LW9A 1R1A1 1QEXA 1WCUA 1S0EA 3O1OA 4TGFA 4A4AA 5F39A 1XNCA 4IEUA 1AX1A 3CMGA 4BCUA 2JDUA 4Q4X1 3WF1A 3ZIWA 4W65A 5H9SA 1O4ZA 1QJZA 5FZGA 2OA2A 1JUIA 4L2NA 3H8XA 1CGPA 3UV9A 3AYCA 4MG2A 2P3KA 2QQVA 2YB7A 4YWAA 1US2A 1JZ3A 4CEWA 3K51A 1OD5A 4A2UA 4AGRA 3LOBA 3FHQA 3I2KA 4PLNA 2AENA 2ZTNA 5K4LA 1LGCA 4LQRA 2XHKA 3WT3A 1UNBA 3KQRA 1F2NA 1ULFA 3B69A 2FBEA 4N53B 3ZMNA 3AL6A 1RFNB 3PGHA 1JUHA 1VB4A 3MDLA 4AI2A 5BUVA 2P16L 1RJ7A 4D69A 1ZA7A 1V6NA 2P6HA 1C28A 3PDQA 4N43A 2WRAA 1VP6A 4HFSA 4OHXA 2KB9A 1REFA 1UZWA 2W46A 4GULA 1KRIA 1ATBA 1QU0A 1Y43B 1YFWA 1FOD2 1ZBE2 3OGSA 2WNVC 3GHMA 2HEVF 2VUAA 2W1WA 4ZH8B 1RGSA 3MW3A 4JDOA 4ZXEA 3NJVA 2JKBA 3M2MA 4IEOA 4D0FA 1O4YA 4IEWA 5A3TA 1REDA 4P14A 1V00A 4ONUA 3UGHA 4AI1A 4CYDA 5JVYA 2QTWB 2VOKA 2QQIA 1NUKA 3PHMA 2XJQA 4UT5A 2H6BA 1AYN1 3NNMA 3VBFC 2ZKNA 4D0EA 3LEGA 4J1XA 3PMSA 3VD7A 5FYZA 3AP7A 3VDDB 1CCVA 3OGGA 4SBVA 2FZZL 1ZZ9A 2B46X 1IQKL 2EI7B 4V2WA 1XNAA 3M36L 3GCWE 2R6QA 2VBPA 1I5ZA 1PK6A 1QJX3 2VMGA 3IZOA 4GB31 3D4KA 4N8MA 4UWDA 5EHDA 4AVAA 2EIDA 5D8AC 1O8PA 1K36A 1PVC1 3RJ2X 3WQ7A 5CKNA 2VGDA 2K9ZA 3LQCA 2K0GA 2QE3A 4ATFA 3OEAA 2VJXA 2J1VA 1ULEA 4JC1A 2IVIB 4V1PA 4B1MA 1LODA 1GNZA 1JU4A 3PVNA 4OHWA 5APAA 1YI9A 4XLWA 3AKQA 3LAGA 1P9JA 4LBQD 3KSCA 4F83A 5A7NA 1O4TA 1K5MC 1VBE1 3KT4A 1HAFA 3I7DA 5IHRA 1DG6A 3I4IA 1JL9A 1EUTA 4AEDB 2DBIA 4XW3A 1KS4A 2DF7A 4MADA 5DN2A 1CAXB 1Q8SA 2KL7A 2ARAA 2YPDA 3ILRA 3POSA 4QMAA 4QXHA 5I8SA 3IIIA 5C70A 1R081 2DYCA 3AZVA 4QX8A 5FPAA 3HNYM 5F5QA 5I0SA 4NJ4A 1ENRA 1W0OA 1MOXC 2ADXA 1FMD1 1TNFA 3MW4A 3OD4A 4M0NA 4PHZA 3T2OA 4OYUA 4I01A 4Y7AB 1H1IA 1MQ5L 2JB8A 5IUQA 4M0HA 1CIWA 3O1PA 5FMCA 3LA2A 1NZCA 2D5FA 2Y5FL 1ATAA 3M8LA 1RHI3 4LJHA 4N7IA 3WXPA 1UY4A 1VBA2 2WNUB 4IEPA 4Y20B 4DIQA 1LGBA 3WX5A 1FPN3 1GBGA 2BVVA 2JG8B 3OYWB 4YG0A 1NQDA 1NY71 4XHXA 2RMU1 1BLZA 2Y6KA 4YVSB 4BXWA 1RMU3 4Y1VA 4COWA 4NVPA 5FP3A 5T50A 2IXLA 3OPWA 5A33B 1JODA 5EQUA 3N8YA 4WBBA 5A3LA 1OA2A 1OI6A 1V9U2 3IM0A 4K20A 5JOYA 2WLQA 3WEZA 1MS0A 4GXLA 2G9GA 1RL3A 3T0BA 3UYJA 5LZ6A 4LORA 1TZOA 4DXZA 5JSRA 2PLV1 2VNOA 2D3SA 1NLRA 1UYZA 4XBQA 5F6KA 5LBFA 2VE1A 2F4LA 4XETA 4BQ4A 2YROA 1H2KA 2WKKA 4AEDA 3GZUC 3LTFB 2RS32 3AJYA 1GKBA 5FXZA 1QJY2 2J1AA 1L3JA 5FY8A 2Q8OA 5LRRA 2YU1A 2PFWA 4QGLA 5FKBA 5FZAA 3RMXA 5J09A 3HBKA 4XVHA 3TAYA 2ZGKA 2RS51 3U4SA 2RS12 1JZ7A 3EXUA 1IS6A 2PQQA 1H2MA 2B9VA 4JGZB 3WCRA 4GZ9A 1NFYB 5KIRA 2OUJA 4Q0PA 5A6YA 2UWAA 1JBUL 2ZBJA 1G9DA 3PUQA 2Q0AA 1DU3D 1NX9A 4AFCA 4QQOA 5BNPA 5A1FA 2W68A 3RZHA 2XKPA 1W9WA 4LLFA 3WDUA 5A7SA 5A7OA 5KXEA 2OQ6A 3NRUA 2KNIA 4LBKA 1E5HA 4D6RA 3H8OA 2VMDA 2ZZQA 3MF9A 4LKEA 2C9KA 3W5NA 3V56A 2GZWA 1EGFA 4B29A 1VRBA 4LA3A 3KMHA 1ULDA 1BBT3 3V64C 1KD7A 1T6GC 1CQEA 1UX7A 2VVFA 4OI4A 3ST7A 5A6ZA 2I45A 1LHVA 3J7NA 1BXHA 1AYM3 3KCXA 5JXIA 3OBTA 3O1MA 2RS33 3N8WB 1DQ5A 2DVGA 3INAA 5EP9A 5EPAA 4JZFL 1SACA 2ZJCA 1VBC3 2VR4A 5FZKA 3FHAA 1AX2A 3O7OA 1W0PA
chains in the Genus database with same CATH topology
3AK0A 4EJRA 4ISHL 1IQIL 4W6YA 2IXHA 3SCHA 2VW0A 1AL21 5CAZA 5EYXA 2JJ6A 4XBNA 4NG9L 1PO21 2XG3A 2ZCWA 5E1RA 3ZO0B 1K5MB 1SLCA 3R05A 3ECQA 4X8PA 5EYYA 4ISQA 1I0UA 1UZJA 3AP4A 4BDXA 3RZZA 4X8SL 1HAEA 3GBWA 3VBSB 1V9U3 3ME2A 5JWPA 3JCIA 1D2SA 4P9WA 4GALA 4X8NA 1YNAA 2EF6A 1COV3 1DQ6A 1HX2A 4BHPA 2IWGB 2GC2A 4RHV3 2XC0L 2GNTA 5EV7A 5C8CB 1LPGA 1KLJL 1AYM2 1EQHA 2JENA 3LTGD 1LECA 4LO8A 1YFUA 5B2GB 1GV9A 4NPRA 1IKQA 2C0ZA 3N4MA 1LMJA 1CQ9A 4UBGA 1AXZA 3AMMA 2BGCA 4BM8A 5DZEA 1VRH1 2D6KA 4AVSA 4HMZA 1CX4A 4YVSC 4DMIA 1GNHA 1OQ1A 2ZKLA 2PHWA 1X82A 4L97A 2VECA 4Y1ZA 2HYKA 4A94C 1GICA 2XBO1 1ATDA 4PDWA 1L3YA 1EV11 2W2OE 1ZREA 4B3NA 1C8M2 1F0RB 1NPEB 1VRH2 3M3QA 5JBBE 4YG3A 4TZDA 1TMF2 5J3UA 5BNPC 2D6OX 1X33A 4DINB 2YGOA 4RHV2 1LOBA 2TBVA 3C2UA 3GYDA 4S2HA 3FBMA 2GNMA 4M00A 4GWMA 1EPGA 4HN1A 5E8AA 2BZ6L 2Y82B 5CKQA 1JN2P 4R9CA 4RGAA 4I0BA 2WT1A 4X6RB 1RUD3 5BYNA 2UY8A 2CTVA 3IKWA 2A6XA 2PHTA 2Y0OA 4FTSA 1PGEA 1V3XB 1LHOA 3I2DA 1NA1A 2Y7XB 2I9BA 1HREA 2W2QE 3AMHA 5FMOS 1NFWB 3NT1A 4Y6DB 6COXA 1G2MB 1AHSA 1APNA 1PFXL 1NG0A 4XQ4A 4YNIA 1BF9A 1G9AA 3VBHC 3VKNA 5L2ZL 1DLLA 3HO3A 4XHBA 2CJIB 2P3IA 5K0UB 4NHKA 2DWRA 2VUJA 1S2BA 3ZXEA 2B45X 1ATEA 1IQFL 3IT8A 4O9GA 1APQA 3TBDA 5L36A 3THTA 1PGL2 3KGZA 1IS3A 1O5LA 1AR63 2BPA2 2Q1MA 5I93A 1VBD3 5AC91 3PJYA 2CL2A 2PR3B 3F6UL 3NJPC 1CVNA 2RM21 2WA4A 2QFEA 5I8TA 1WBFA 1ZZBA 1G9CA 3G7DA 2R063 5K0HB 3PVEA 2D97A 1KFXL 2SLIA 2BNOA 2ARXA 2J94B 4NGAL 4YVSA 3N8ZA 2JXAA 2PAMA 3KRKA 1VJ2A 1OFSA 4Y7BB 1EV12 3NAPA 3BT2A 5AFEA 3U10A 2YY1A 4RRZA 2DVBA 2B8MA 1RUNA 4HLTA 1KDMA 3M70A 1QJY3 1EPWA 1H8TB 4OI1A 3N8XA 1S0JA 1LEDA 3HPTA 1UIKA 2MPFA 2RS11 1RUJ2 2HWC3 4RR3C 5GLUA 1JH5A 2WNUC 1RUC3 4QGMA 3N3HA 1KLIL 4FP3A 3ZFFB 1BEV1 2RR13 4LNVA 4WM8A 1UKGA 5KC6A 1W7XL 2WNVA 4WVWA 5TSWA 1CAWA 4KGGA 1YUFA 3OD0A 4AVCA 5DDJ3 5L7OA 3WD5A 1DZRA 5JZGA 1VBE2 2AYLA 2O1QA 4G9SB 2IFRA 1F7EA 2Y5GL 2GN7A 1VBD2 1H2LA 4BMEA 2GDFA 4NO4A 3O5SA 2D93A 1WD4A 5BY5A 1ZAQA 1YI7A 5J36A 1DQ1A 1EPZA 1OHFA 4I2OA 4LHKA 5CVRA 2BMGA 1FATA 5FAXA 2V09A 4RD7A 1LESA 1TQ5A 1Q56A 3TWIA 3NWKA 4Z2WA 4DQAA 2FLRL 5L7OB 4Q4Y2 4IEQA 3RYPA 5IK4A 2K2SA 3ZSKA 2XL7A 2AR6A 1NE4A 4XIOA 2PHUA 1MEC3 4PQ9A 3ZFFA 3V64A 4K21A 2VWLL 1AR83 1DHKB 1ZA4A 3KT7A 4QT6A 1MZFA 1YFXA 2D6PA 3LZZA 3VZMA 3WUCA 3BIWE 1O5DL 2HWE3 4AYUA 3FFQA 4K1YA 4HSJA 1SCSA 3U73A 1QF3A 3AJZA 3WP5A 1OLQA 2XWBB 4Q4X3 3NTGA 4OFGA 4AXOA 2D7FA 2Z79A 3E5UA 5DUUA 3TYJA 1TME1 4KL1A 1A6CA 1G6NA 1RUE2 2O0OA 1UU4A 2A5ZA 1RB8G 3PTYA 5BXXA 4EROA 4MYEA 5J96B 2I07B 2WPME 3N7LA 2VQAA 3RPQA 4YSFA 2UWBA 1HT8A 1S55A 1PGL1 1JBCA 4KBBA 4COVA 1APOA 1D4M3 2WLPA 2RHPA 4CRQA 1QQP1 3ZX7A 4MXWB 2MGPA 2FLGA 3I54A 2Q1JB 1WUVA 1DGRA 2ZGTA 3ZFEA 4Y71B 5L30L 3MIGA 1XNBA 1WA4A 2LALA 5D8AA 2R071 2E9QA 2Q30A 3AP5A 1FFMA 3ZXDA 4X8TL 3UK9A 1PIV3 4CP1A 3QLQA 2CAUA 1CAVA 1KLOA 1S0DA 4FXGB 1OQDA 3UL2A 2WPHE 1HRI3 3WQ0A 3MEPA 3VBFA 3GBGA 4UXAA 3WW3A 1AUTL 1W6PB 2E53A 1N3QA 4NWVA 1Q8PA 1UD1A 1LTEA 3ZVXA 2XBYL 1D4VB 1SMVA 3SOQA 2ZHLA 3BT1A 2D3RA 1V6JA 4Y79B 2DURA 1ZM1A 2WZR2 4QPIB 4P9GA 4DY3A 4K3UA 2VH9A 2EA7A 2I2SA 4C1XA 1ZRFA 1ASJ1 2BUKA 4HPKB 4MV2A 4PBOA 2XPJA 3UKTA 2JECA 3HO5A 1GANA 1DVAL 4JQRA 3RMYA 4PBPA 2WT0A 2X8KA 2YXSA 4RS0A 1LOCA 2GN3A 2HWB2 1MZ5A 2B39A 4ZU4A 3N8WA 3LN1A 3U0ZA 1UZYA 3MIEA 3JQXA 3MYXA 2TNFA 5E8DA 1UIJA 2A6YA 5T5PA 4ZXKA 4F8AA 4WV8A 5GLVA 1GZWA 1MS4A 1IQML 4J6GA 4Q4X2 2BTVC 2D1JB 3NL1A 5JOWA 2NP0A 1POV1 2YGPA 2BFUS 5JI9A 5IKRA 2PAKA 1LOEA 4A7ZA 1TEIA 4R4ZA 3RWNA 3V0AB 2XC4L 4COXA 3SHRA 5AC92 1UMZA 1MQTC 4HK8A 4PLOA 1UCXA 1S0BA 4Q4V3 3D82A 3S6XA 4PIXA 3BB6A 4ES9A 1IQJL 4E4DX 5T55A 3SMHA 1RHI1 2IFWA 2Z69A 5GZCA 4GWNA 5GLZA 3RSJA 2QJVA 1QJU2 3OCPA 1CAUB 4CUFA 2XL9A 1CJPA 3EGFA 2FHRA 4OVEA 4A3XA 3BALA 1RMU1 2RA0L 2GH8A 4R9AA 1AR62 4LUMA 5FMOL 2EALA 3E97A 4E2SA 3QH6A 4K7JA 5GM0A 1G86A 1H0BA 3DPRB 1RUG3 5CFCC 2ZX3A 4DRVA 3AMNA 2BVBA 3TN91 1TE1B 1S0FA 2E7AA 3HD8B 5KXCA 1XE7A 3U11A 3WG4A 1MQ6L 1XKAL 3NV1A 1ZBE1 3AB0A 5CIRA 3MLJA 4Q0VA 1IQHL 3OF1A 1VBE3 1MVQA 1LU2A 2OVUA 1HQWA 3E6DA 3APBA 1SLAA 2P94L 2P37A 2WNUA 3NV2A 1UF2C 5GLWA 1IGXA 2VW2A 4RR3A 5EJ3A 4HN0A 2SBAA 2RM22 2XJPA 5EFUA 1LCLA 2DV9A 3MGUA 2E51A 1FAKL 4IEXA 2CV6A 3WDWA 3TOJA 4QPIA 1SBDA 1HV1A 3NAPC 1Q8OA 4O1ZA 5DDJ2 4OHZA 4XTMA 1EPHA 1IP0A 1NFXB 1W6NB 4XXAA 1QY4A 1QGLA 3DL3A 3ZXKA 1C1LA 1Y3TA 1HDKA 1VBC2 1YFYA 1IPJA 4DS0A 4XJWA 2AH2A 2VY0A 1CEJA 3WW2A 3AX4A 4GMP3 2ZGPA 1F9KA 2D6NA 3ACLA 1AR73 5T5JA 2ILMA 4PF5A 4QQ2A 1RUE1 5CG8A 3OY8B 5CFDB 5T52A 5CFDA 4RRYA 1AL0G 3OJBA 4XF4A 4YZ1A 2GMEA 5FBZA 5JOXA 2CYFA 1CR7A 1DBNA 4C91A 1UL9A 4E2GA 3GISX 1G7YA 2D43A 1U5YA 2TGFA 1WMEA 1FV3A 5LK7B 1A8DA 4Z8BA 2A73B 2ZGUA 4UW5A 1DZTA 2IC1A 3KK6A 1GFF2 3NKGA 1FAYA 3LN0A 2X53S 1YHFA 5A33A 1WU1B 2P3FL 5FLHA 4AHYA 5DG2A 4WVMB 2XUMA 1KDKA 3HN1A 3HR9A 3JD72 1OA4A 1FXZA 3FLRA 2OYUP 3OYWA 4LULA 1HT5A 1H1MA 3GNEA 4UBHA 4TYSA 1OOPC 3SCGA 4S2GA 1RVF3 4IV1C 5BV6A 2VWOL 1OMIA 1VBA3 5C4WA 3IPVB 4JTNA 3KLSA 4EN9B 4BDWA 3H0OA 4QD2A 2OZ6A 4WVVA 2W52A 3FHIB 3GF6A 1QXRA 2CAVA 4LLOA 4Q4W3 1FE2A 2VJ3A 3KGLA 2E63A 4U2AA 4AI3A 3WNXA 1EMNA 3J9SA 3URFA 5K9YA 4YZ3A 4RQPB 2A75A 4GMP0 1E57A 1ONAA 4XL1A 1AYM1 1ND2A 4RA0A 3MIDA 3ZFGC 1PXXA 2DCTA 2WWSA 1ZBE3 1CPNA 4R52A 2PHBB 3ZSEA 5CFCB 2IXIA 4CDUA 1O7FA 1TPGA 1HRV1 3GCXE 4RGGA 4UW3A 3IDEA 1GQHA 1YLLA 1XU1A 3WQ1A 4ZU5A 3VZOA 1G1RA 1X50A 1ZRCA 4Z82A 1O3TA 1TNRA 1U67A 1RUH1 4XJAA 4YVWB 1CAWB 1ASJ2 4E1GA 4LHNA 3CENL 5F19A 2WQZC 3W9AA 1J3RA 2QKDA 4O9EA 2GC0A 3USSA 1LULA 3OLUA 1IS4A 3BODA 1S0CA 5JIAA 2XLGA 1EYBA 1XRUA 3NTBA 3IPVA 4WM7B 5JZGC 2WG3C 4RR3B 4CTEA 3F1SB 1HLCA 4AEDC 2R49A 1CJDA 5FOJB 4M11A 3SH4A 2N7GA 4YGCA 4OI0A 1UX6A 3JZVA 2IZWA 1H30A 3FLPA 3SLIA 2DCJA 3AXEA 1IQLL 3AYDA 1ZBA1 4CEYC 1EZQB 4YLZA 4WVMA 3MFAA 3R4DB 4JZDL 4M3CF 2BQPA 3CJIA 1EAH1 1YXWA 5CU1A 3DF0A 1POV0 4N43B 1GR3A 2ES3A 3MDPA 5I0RA 3NO8A 2PA7A 3VKOA 4KU8A 2YMZA 1U5XA 4NOTA 5T5LA 3RR3A 4AE2A 3TGFA 3H1YA 5E89A 4Z1VA 1HXS2 3J4UH 2EI8B 3RQ0A 4PIYA 5HBAA 1HRFA 1FOD3 1ZVFA 2HWF2 2F9BL 4S2FA 5FO9B 1RUC2 3JBG1 3BCWA 1GYKA 4OLLA 3VHNA 3B94A 4YT7L 4XMAA 1PNFA 1AXYA 1MVEA 1X8EA 5DZFA 5LK5A 3Q7DA 1NOVA 3T1MA 2AREA 2O8OA 4ISRA 3O12A 3KL6B 4FVVA 1A3PA 2BNNA 3W59A 4CDWA 3LA3A 3K48A 3B7MA 4N9HA 2A6ZA 1V6LA 2DCYA 3ZSJA 4YARA 1ENXA 1VAVA 1K5MA 4P9JA 4JYVL 4E27A 3WG3A 2VU9A 3R0RA 2XBXL 2DUPA 1JW6A 3B00A 4HBNA 4FOWA 3WG2A 5SV5A 1FMD3 4M3CB 2OYZA 4KGQA 1LOAA 2VMIA 3DV8A 4MGYE 1ALYA 3MZHA 3SH5A 2R072 2D98A 1AYN2 2M74A 1C1FA 3B5LB 4Q4Y3 2VH0B 4DB5A 2WZPP 5LRSA 1N1IA 4B7KA 5KHKA 2H9EL 4YW5A 3ZYRA 3FC0A 2O8QA 4KWLA 4M3CA 1VBC1 4Z0LA 1B09A 1HRV3 3MI8A 4BOWA 4L92A 2GU9A 2Y5HL 1WW7A 4XFFA 1XE8A 4GA9A 5GKAC 1VAMA 2OYEP 1I9RA 2NN8A 4AGGA 4FTEA 1VBD1 5AVPA 1AZDA 3AMPA 1AL23 4RS5B 2GAUA 4Z07A 3S7EA 1PO23 4MMYB 1PHMA 3S0MA 2BQWA 1Q5OA 4YVWA 1PTHA 4D3WA 3VKFC 5JBCE 4N7UA 4FBFA 1CVUA 3D0SA 1CAVB 4HVRA 3MQEA 1QOOA 4KWJA 2ZGQA 1IHMA 4K6BA 2OIIA 3VHPA 1B9WA 1UPSA 4XIKA 5GZEA 2PUQL 1IOXA 4IEZA 4AVTA 1ND2B 1AR93 1Z7S3 2XGXA 3A4UA 4QHBA 4FM5A 3LC5B 1RVF2 1SQ4A 4LBLA 3LGRA 3G6JB 1HQNA 5JI7A 3HT2A 2Q5TA 3KB5A 1OLRA 4CEYB 4FPEA 1R092 4I3PA 4I09A 4XTPA 2CY6A 4LE4A 5IKVA 5KC5A 1G8WA 1J59A 4XBLA 2HWD3 2P3TA 1DQBA 3UKVA 1NCQA 1AF9A 3JUUA 2P95L 2PHXA 3M7AA 3VZJA 2YC0A 4QQLA 2JG8A 1FOD1 3NVCA 4DOUA 1TOZA 1QKQA 1U8CB 2DUOA 1F5JA 4G4FA 2RS52 5JVZA 2QVSB 2GMMA 1L5GB 1PO22 2BW8A 2EXHA 2W08A 3B9CA 3HS6A 3WOGA 2YGQA 2Z5WA 3NW4A 3HIFA 1ZZ7A 2R16A 4Z92B 3ZXAC 1H9PA 3M3OA 1M1XB 2ZX0A 4MSVA 4BH9A 4GKYA 4HVOA 3ATGA 3L2YA 2RR12 3H50A 2R041 1EBVA 1UU6A 2UWLB 1EAIC 1HRV2 4NA9L 2ZGMA 3VBFB 4ATEA 4BXSA 1J3QA 4XFIA 2HWE1 1QWRA 1B35A 3VLBB 2WT2A 2VOVA 4I0AA 1V9U1 4UW6A 1C8NA 3USUB 5CG9A 5K0UA 2ET7A 4HKWA 3ZFEB 3I59B 4RHV1 5JR7B 4GH4C 1LR5A 4QPGC 3FUOA 4L99A 3TZIA 1B35B 2IXJA 4CDQC 2WZR1 1PNGA 4FAGA 4U36A 1HQLA 3AP6A 4RFT0 1LOFA 2PHDA