3TBDA

Crystal structure of domain vi and le1 of human netrin-g2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
331
structure length
331
Chain Sequence
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ligand binding domain of netrin g2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Netrin-G2
total genus 81
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00053 Laminin_EGF Laminin EGF domain
A PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3tbdA01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3tbdA02
3HO5A 1KIGL 2I9BA 3LC3B 2W26B 3TBDA 2WPME 3MQEA 1IQEL 3P5BL 2BMGA 1UZPA 2J34B 2FD6A 2WG3C 4RRYA 1M1XB 1HAFA 1C5MF 2I9AA 2XBXL 3NTGA 1ATBA 2J2UB 1TOZA 2BOUA 1MQ5L 1DX5I 5F19A 2XC0L 2Y80B 5CKQA 4OVEA 1IOXA 5IKRA 5I46L 5EGMB 1HCGB 1JL9A 4RRZA 2W2NE 5L2YL 4Z0KB 2VVCK 1P0SL 1NT0A 1GK5A 3HS5A 1F0SB 2B7DL 4Y79B 1L3YA 4BTIA 2UWOB 3TGFA 4JZDL 5K0HB 2WPJE 2PR3B 1DDXA 1NPEB 1ATAA 2P95L 2VWNL 1KLIL 2J95B 3OLUA 2M74A 5IKVA 4OTYA 1IVOC 1IQIL 1EQHA 1LPGA 1F7EA 1MOXC 2W3IB 3POYA 1V3XB 1BF9A 1G1QA 1NFWB 3KQCL 3C9AC 4YT6L 3KQEL 1FFMA 5IKTA 1NZIA 1YUFA 2BOXA 1IGXA 1JBUL 2MGPA 3M36L 1G1TA 3ZYIB 4CUEA 2P3FL 3ZYGA 3LC5B 3KK6A 1CEJA 5CISA 3N8YA 1QFKL 4D0FA 3KRKA 1LPZA 3ENSA 2F9BL 2KV4A 1ATDA 3DEMA 1HZ8A 3KL6B 4TGFA 3ZYJB 4PLNA 3RR3A 3LN0A 3LN1A 1P9JA 2VVUL 4JZEL 4RUTA 2YGPA 3GISX 2P28B 1WHFA 1EZQB 1YGCL 2FLBL 1HT8A 1TPGA 4ZH8B 3LTGD 5JBAE 2BQWA 2P3TA 3OLTA 5COXA 3HPTA 2PHBB 1J9CL 2Y5FL 1JV2B 1FE2A 1IQLL 4AQTA 4JZFL 1F0RB 4CUDA 2BOHA 1IQML 1IQKL 1FAKL 4XLWA 5L2ZL 2VWMK 3TZIA 1UZJA 1IQFL 2PUQL 2UWPB 2GD4A 3NT1A 3Q3KB 4M11A 1YO8A 4XBMA 1CCFA 2D1JB 2VWLL 3QMOA 3MDLA 4D90A 1NFYB 4YT7L 4BDWA 2J94B 1CQEA 1K36A 2FZZL 2P3UA 2UWLB 2XBWL 1I0UA 3TK6B 1IOEL 1FSBA 3PGHA 4URTA 5JB8E 4A7IA 1G2LB 3V65B 4Y76B 3CENL 2W2QE 3CA7A 1KLOA 1U67A 3QCWA 3U7UG 2VH0B 4D0EA 1CCVA 2W3KB 1APQA 1IGZA 4ISHL 2Y7XB 3GCXE 4MMXB 1DVAL 1Q4GA 1W7XL 4C16A 5JBBE 5CKMA 4E1GA 1G1SA 1YUKB 2K2SB 4XL1A 1APOA 1EAIC 1L5GB 2OYUP 2VWOL 4LMFA 2MHPA 1HREA 4X8TL 2WG4B 2RA0L 4ZHAB 3BT1A 1EPIA 4NG9L 4X8SL 1EPGA 2RHPA 2WPKE 4JYUL 1K37A 3TH3L 3SOBB 3KQBL 1PXXA 1XDTR 2EI6B 4Y7BB 1ZAQA 4RRXA 1G2MB 4AQSA 2JKHL 2Y5GL 1FAXL 2J38B 2AYLA 2NPRA 4PH9A 5JB9E 5JVZA 4MMYB 2OYEP 4BTTA 4OTJA 1XFEA 1F7MA 1SZBA 2W2PE 3NJPC 5KIRA 1N7DA 3KCGL 3LAQA 1TLEA 1LPKA 3CS7L 1HRFA 2ADXA 3N8XA 5E8DA 5F1AA 3TK5B 2MGRA 4PLMA 1CVWL 5JBCE 1MQ6L 3BT2A 3F1SB 3N8WB 4O02B 4NGAL 3QH0A 2VJ3A 3LTFB 3LIWB 3FCSB 2WPHE 1IP0A 5JW1A 4Z0LA 3SOQA 1PRHA 1UZQA 4ZXYL 1FF7A 2H9EL 2BO2A 1ATEA 4BXSA 1EPJA 3V64C 1ADXA 4RS0A 4YZUB 3N8YB 1N1IA 2XC4L 2VH6B 2YGOA 1OB1C 3CFWA 4ZAEB 3BPSE 1IJQA 5L30L 1A3PA 2BQ6A 1EPHA 4PLOA 1NQLB 2FLRL 1LMJA 3U73A 5IKQA 3R05A 1FJSL 2DDUA 2FLGA 2W86A 1U8CB 1X7AL 4O1ZA 1YUGA 1HJ7A 1IQHL 2KB9A 5JVYA 2TGFA 2CJIB 4COXA 1NFXB 1Z6EL 4Y71B 1COUA 4LORA 1AUTL 4CUFA 2Y81B 1WHEA 1KSNB 4FM5A 3GCWE 1CVUA 2VVVL 2K2TA 3ELAL 1HT5A 4ZXXL 2Q1JB 1EGFA 2Y7ZB 3N8ZA 2RNLA 2WPIE 3HS6A 1G1RA 1O5DL 4BTUA 2WYJB 1IQJL 2XBYL 1DQBA 1W8BL 6COXA 3NTBA 3KQDL 4Y6DB 3ASIA 2WPLE 3FBYA 4RRWA 1NFUB 2P93L 3M37L 2XBVL 1EQGA 5KN5C 4Y7AB 4BXWA 4M10A 3HS7A 2BZ6L 2WFTA 1KLJL 4Z6AL 4JYVL 2P16L 1DIYA 4ISIL 1WU1B 4BDXA 2G00L 4CSYA 2W2OE 1B9WA 1EMNA 1IQNL 3FFGL 1URKA 4MMZB 2Y5HL 1XKBA 2BOKL 2BQ7A 2Y82B 4G1MB 4NA9L 1UZKA 2W2ME 2Y38A 5FDQA 1RFNB 1PFXL 3K9XA 3H5CB 3HO3A 1PTHA 1XKAL 3EGFA 2J4IB 4X8UL 1HX2A 3IITB 2WFXB 1PGEA 3Q7DA 2P3FN 2EI7B 2P26A 3F6UL 1IQGL 3HO4A 2XC5L 3SW2A 2P94L 5CKNA 3IJEB 1EBVA 2WYGB 1EMOA 3N8WA 1CX2A 3N8VA 2EI8B 1HAEA 4X8VL 1Z6CA 3SOVA 1LQDA 2KL7A
chains in the Genus database with same CATH superfamily
5T50A 1CVNA 2Y34A 3V64A 4XHXA 5FTTC 1KIGL 4MGIE 1V9U3 1VAMA 4O61A 2W26B 1QJEA 4RSUA 3CZUA 4M00A 1G9DA 4ZHNA 1ALYA 3PJYA 2X05A 1WZXA 3VBUA 1G9FA 4ZKTB 1COV3 1FOD2 1NY71 3B7MA 4BQ3A 2FD6A 2W5FA 2WYFA 3MFAA 1ZZ9A 4RRYA 1FAYA 3HVDA 4L97A 4Y20A 5EWSA 4UXAA 3T2OA 4AEMA 4CXWA 3VN4A 1HAFA 4AE2A 5H9RA 1ULEA 3SEEA 4JRAA 4XCAA 4YW6A 5BNNC 1OI6A 1QU0A 1XNAA 1CAXA 5C8CA 1V6OA 1DX5I 1ZBE2 2RM23 1VBD2 2ADDA 2WFPA 2D3RA 3WNXA 5FXXA 5CKQA 1D4M3 2Q8OA 1IOXA 4JHTA 3HBZA 3VBRB 1DQ0A 1O4ZA 4A7YA 3BALA 4LKFA 5CG9A 2FBEA 2ZMLA 3KCXA 4OHWA 3TEZA 1JL9A 1NCRA 5BXXA 1GR3A 1C28A 1OKOA 2W2NE 5L2YL 1PO11 4COVA 1MVQA 4QDSA 4YZ4A 3ZFEB 4LBKA 3NAPB 4LBOA 4P9GA 3PL0A 5GZEA 4AYUA 1IS4A 1H2KA 4ES9A 1IQAA 1OLMA 3WSOA 2WQ4A 2LS6A 1LOFC 1DP0A 3E5UA 5LEJA 4BTIA 1W04A 4Q4Y1 1ND2C 5LA9A 1GZ9A 3D4KA 1D2QA 5K0HB 1LR5A 1UZ0A 2B39A 2GMEA 1UYZA 2GNTA 3K4DA 3L2YA 2VMEA 3S0MA 4XFAA 1DDXA 4CYDA 4I0WB 1LOBA 4JHZA 2WO3A 1DQ6A 4UW5A 2VOWA 2B42B 3ILFA 2ZOEB 3THDA 2VH9A 1LNSA 2CSGA 2GMMA 2HWB3 2BBAA 4IXLA 3BPSA 5JCTA 1DGRN 3ZR5A 1ZRCA 2PLV1 2VD7A 2DBNA 3BODA 4UWDA 3VV1A 5E88A 1GNHA 3JCIA 1BLZA 1IQIL 3WG3A 4ASKA 3K3OA 2WN3A 3J7LA 4QDQA 3RZZA 5C9AC 4HSLA 4YYOA 4XABA 1BVVA 1B35C 1WGPA 4IV3A 2W3IB 1ZRIA 2HORA 1VBC3 4AI3A 1BF9A 1QJZA 1G1QA 2P34A 4RS5C 4AVVA 4C0BA 1R1ZA 3C9AC 1HRV1 4NRPA 4GH4B 3J8F2 3T1LA 3R4DB 3IWZA 2HKXA 4Y22A 5DG1A 1X36A 2ZMKA 1KKEA 3NQHA 1YUFA 2MNGA 5FZCA 1YQCA 5T5LA 3E6CC 3SXWA 2BU9A 2MGPA 4FPEA 3ROUA 1G1TA 4LKEA 4B4QA 2ENRA 3ZYIB 1BXHA 2P3FL 2Y6HA 4N43B 3TNPB 4CUGA 4EYUA 2P5BA 4NHMA 4BQ1A 1Q3EA 5DG2A 4ISQA 3NL1A 1UY0A 2WBKA 3MF6A 1JN2P 5L7OB 1CAUA 4A94C 2WLQA 3OUHA 4LKSA 3I2OA 3BGAA 4D0FA 4RS5B 2GNDA 2MHFA 4P9WA 3AKQA 2F9BL 1HV0A 1VBA2 2QJVA 4KBZA 4AI2A 4NRQA 4Q8LA 2VR4A 4R4XA 3RMXA 1FNYA 4EN7B 4TGFA 3CEWA 3DYMA 4PLNA 2XLFA 3LN1A 1P9JA 1WA4A 4PDWB 5JOZA 1X33A 2ZEYA 4QM8A 1LEDA 3WP4A 5EYXA 2ZEXA 5F7UA 2IWGB 2R073 3O0VA 1S55A 4QXCA 4Q4X3 3HNMA 4WVZA 3U4SA 3J7NA 1FATA 2G1MA 1YGCL 3FX3A 2B45X 4L0PA 3ZYRA 4DY3A 5KBFA 1HT8A 4ZH8B 4DUVA 2OZ6A 2YROA 1UAIA 4AHZA 4LUMA 3FC0A 5A3NA 1GQPA 3VZJA 1AX2A 4GB33 1WBFA 2VZTA 2YZ4A 1B35B 5C71A 4N9HA 4LBQB 2HBUA 5BNOB 3OLTA 1OF4A 2EIDA 1DGRA 3GHMA 5T5OA 3HPTA 1PM4A 4HMZA 2W94A 1RUG2 4PQQA 3VKNA 2VO5A 1VB2A 3VLBB 1YJKA 4M4RA 4JVAA 1NE6A 4HETA 4QPGC 1OT5A 2BGCA 2BJSA 4J1XA 3ZXEA 1F0RB 4IGOA 3SCGA 2ZGLA 4FPLA 4YM1A 3NMBA 1OFSA 1RXGA 4M3CE 1JODA 4N90A 5FZ7A 1PGL2 1UU5A 1DZRA 2ZTNA 2VWMK 5DAWA 3TZIA 1UPSA 1K5JA 1BBT2 2PUQL 2E51A 4CDQA 4RL7A 3W20A 2D6NA 2WZ8A 1G9CA 3NKTA 4M11A 1APNA 2AACA 5FPZA 4XIOA 1PGL1 1YEWA 4YGCA 2EAAA 3W58A 2B9UA 1HB1A 2DCKA 2HWE3 2VWLL 1LU2A 2WNOA 4LE3A 2WFF3 2XWJB 1UZZA 1H6XA 5C7GA 1AL0G 2R16A 3KCYA 1GZWA 1QDOA 4JV4A 1OMIA 5FPXA 1NG0A 2O14A 4FP2A 3FWEA 2PA7A 2Y0IA 2WC2A 5FYIA 1K36A 1DLCA 2RV9A 4GMP1 2VVFA 2OQ7A 1D0GA 3GJBA 1POV3 3N9PA 5BPXA 3FLRA 3RMYA 3WNPA 4CCDA 2A1XA 5ANQA 3LGRA 4HVOA 2Q1ZB 5FXVA 2UWLB 1WLWA 1OH4A 4QKDA 4CXYA 3RZHA 3TK6B 4PHZA 1NCRB 2JX9A 3O1RA 3KB5A 1E5HA 1LMMA 1VBD1 5IK7A 3WF4A 3UKVA 1G2LB 4IW3A 1HQWA 1XU1A 3LOIA 3BVCA 3E1F1 4GJZA 1KLOA 1U67A 1NLSA 5FMDA 1UNBA 2HEYF 2YYOA 4H7MA 2EIGA 2OPKA 3NNMA 4P08A 2YPJA 1CCVA 3ILRA 2W3KB 3WP6A 4IUGA 1IS6A 5L9VA 4OLLA 4HLTA 1QHDA 2RS53 1CIYA 1G9AA 1JZ5A 2O8QA 3DN7A 2Y7XB 3VBOC 5C4WB 3U78A 1JYVA 3OBTA 4UFLA 4XF3A 2R6QA 2XVGA 4MMXB 3AP9A 1CAWB 4Y1YA 1Q4GA 1W7XL 5JBBE 3AYEA 2BVBA 4U36A 1G6NA 2JG8A 3POSA 3WF0A 5DDJ3 3VDDC 1ENRA 4QWNA 2K2SB 2FZ2A 3CHXA 1EAIC 2W0XA 4AHYA 2OYUP 2VWOL 3B9IA 5BNPB 2YFUA 4RGAA 2VOKA 3X29B 2MHPA 1WLTA 1HREA 4QPIC 2WG4B 1XNBA 5FZKA 1WW7A 2DV9A 2NPIA 1EPIA 4XXAA 3ZN4A 4BQ4A 4FAGA 4D6QA 2YY1A 2ARBA 5DMYA 3DPRC 3NO8A 2JDKA 3N7MA 1PVXA 5JMCA 2WPKE 4DIQA 1LGBA 4PI2A 2ZGMA 4K1ZA 3RDIA 3BKZA 4CEYC 1UXZA 2VZQA 4DXTA 3MIDA 3J8F3 2HLEA 2ZABA 2WN2A 5LA0A 4AFAA 2G9FA 4RRXA 3ORJA 3CO2A 4HKOA 1VBC2 2JKHL 4MXVA 1PK6C 4Y4YA 3K46A 3J9SA 3VL8A 3ES1A 3A22A 2J38B 1OH3A 2NPRA 5D21A 2DCYA 2RDQA 2XDVA 1IPJA 1C1LA 2ZKNA 1C5IA 3N9NA 1DLLA 5C70A 3VKLA 4BTTA 1F4HA 2PHFA 3VHNA 3MGUA 5A7PA 1QDCA 3WP3A 2VUDA 2UWBA 5EXOA 1JI6A 1XPWA 2HWC3 4Q5OA 4CP1A 5KIRA 2CYFA 3OYWA 1GFF2 3D82A 4MHUA 5DQ0A 5FY0A 5J36A 2JDHA 3K4AA 2I07B 1LGNA 1BKZA 1DGWA 1ZRDA 1YIPA 1QIUA 1RUI2 3N8XA 4HG6B 3D0SA 5E8DA 3TK5B 1W8UA 2VW0A 4Y5SA 3O1PA 3WDVA 1HB2A 4LIUA 4UFMA 4XBQA 5L36A 2WWUA 5C4WA 1CPMA 3HIFA 1QXPA 1YFUA 3LFMA 4U2AA 1UIJA 3HQUA 4QPWA 3JD72 3POGA 1BMV1 5GALA 5E8AA 4RQPB 5IAVA 4L99A 3PTRB 3LIWB 2HWD1 4I09A 2ZGRA 4B29A 5BYNA 1R1A2 4QHZA 4Z0LA 3E97A 4JRLA 2XBO2 1JZ8A 4L11A 3VB9A 3HT2A 4JC1A 4O9GA 1POQA 1XBFA 5T54A 5EFUA 4Q0PA 5A70A 2H9EL 2BO2A 1SLCA 2W1WA 1ATEA 4DXRA 1XYPA 1PO21 1R093 3MIGA 4AQ6A 1L7RA 1ASJ3 2C9KA 2DBIA 2VE1A 2HWF2 3MFCA 1REDA 3PVOA 3WUCA 5JSOA 4FTEA 1ADXA 2K0GA 3FMGA 3LB9A 4Q0QA 4W6WA 2Y6GA 1J83A 2RM22 3ZOIA 1HIXA 2GC1A 3AMNA 1O59A 1CAUB 1ZX5A 4CP0A 1DYOA 3ZXAC 5J98B 5KC6A 3O1UA 1AUYA 4ZZ8A 5J09A 1UMHA 2XC4L 2ARAA 1R64A 3TB0A 1OB1C 4EN9B 1VBA1 3BPSE 3ZN6A 2V4AA 1UPIA 5B4XA 3CZJA 1IG3A 4D7TA 3ACFA 5SV5A 1I9RA 2Y0OA 3I59B 4NVPA 1EPHA 1MZ6A 4Q0VA 3DF0A 4QM9A 1E57A 1S2KA 4BLJA 3NJZA 2I74A 5CYYA 5C3PA 3AYCA 3V0AB 3TWIA 1UYPA 2RS11 3KGLA 4ZS2A 5FKBA 3PIJA 3ZXJA 5IKQA 3R05A 5FY9A 4WZCA 2P17A 1YI7A 3IKWA 5EYYA 1FJSL 1YNAA 4C0HA 4MADA 1EV13 1VMJA 4PDWC 4CEYB 1W9SA 4LTAA 4RR3A 4F8AA 3S5AA 4C91A 4O1ZA 1R091 1PO23 5JVYA 2TGFA 4AGRA 2CJIB 4D7YA 2X29A 1QY4A 3H7YA 5IAXA 5A32B 1BVP1 2IXCA 5KXBA 4WVVA 3NJYA 4UYBA 1Z6EL 4Y71B 3FL7A 4Y26A 2QQLA 3T1MA 5BNOA 1EAH2 2JEMA 2SLIA 4OUSA 3ZN5A 4Z8BA 1AUTL 4L8QA 1VRH1 3ZPOA 1AJOA 2A6ZA 1RUD1 1SHWB 3M7AA 5E16A 4FM5A 4X8PA 3GCWE 2VVVL 5EHDA 5BNNB 5CA6A 3C7OA 2IVJA 2V73A 1HXS3 1X9PA 1J84A 2J1AA 3ZFGA 4CU6A 1JYCA 2FQPA 2AYHA 1OHFA 2JG9A 2W08A 4TSVA 2B8MA 1WW5A 1XJAA 4NJ4A 1GP6A 1GBGA 3MW2A 2OUJA 1ZBA2 4CDXC 1D4M2 3NNFA 3WDUA 4ARYA 3NVCA 4XVHA 2XBYL 3A0KA 1DQBA 3AYDA 4FT8A 1UW8A 4OUEA 4YGBA 1YC61 5JVVA 2OYZA 1JYXA 4I2OA 3KQDL 3LZZA 3WHTA 1JU3A 4E4HA 3ATGA 2BV4A 3HT1A 3HNYM 4C8DA 2YFZA 3AK0A 1GYKA 3JBG2 2XOMA 5HCHA 3OTFA 3PUHA 4KH9A 5KXDA 1CZSA 5FCCA 3T0DA 3I7DA 5FY1A 1GNZA 1PGW2 2FMDA 3V0AA 3UT0A 1UO9A 3ZFFB 1VMHA 1NA1A 4RRWA 1IS5A 1COV2 1FOD3 1F31A 2BOJA 2C1FA 2X5IC 3O0WA 3BTAA 2XBVL 4Q4W1 4X8NA 1XU2A 4CTEA 3F95A 5FYVA 1HB3A 1Z7S3 4HK8A 3OD0A 4XFBA 3VDDA 4XCBA 3KGZA 4BXWA 2JD9A 3WUDA 4CDUC 4OHYA 3HQRA 2XL9A 5T5PA 1Y3TA 4E8DA 4CDUA 4Z6AL 1QJY1 2VZ1A 3OD4A 1F8VA 2P16L 4HKWA 3E5XA 4ISRA 2BNOA 5FLIA 4ISIL 1DHKB 3UJQA 5JR2A 3N7LA 1W2TA 1UOBA 1HKDA 4QX8A 4CSYA 1AR71 1RUE2 4AG4A 4LHSA 3AMMA 3BU7A 4KMQA 4YVWC 3FFGL 2BGPA 3D0JA 5APAA 3V0BB 1QNWA 2JWPA 3AZZA 4XILA 4YW5A 4XJWA 1H2NA 4DEVA 5A6QA 1AR72 2WR9A 2VMGA 2XJTA 1UOFA 2W2ME 3CJXA 2Y38A 3ST7A 4ZU7A 3BTXA 3P3NA 1LOGA 1UWWA 5FDQA 5FMCA 3AXDA 2X5IB 2AUYA 2NMNA 4MGKE 2Q8CA 2R7EB 1PFXL 4DO0A 1CZTA 4B4RA 2J1TA 4COWA 4OMDA 1Y43B 4Q2FA 3B3QE 2CGNA 3HO3A 4OHXA 1TE1B 2DFCA 3ON7A 4MGSA 4Q4V3 2WT2A 3UESA 5I8TA 2QTWB 1PMJX 2ZPXA 4BB3A 2JDPA 1HLCA 3KWVA 1I3HA 4F7ZA 2EI7B 5J37A 3CNAA 3LIGA 1N1SA 2XC5L 4CDQC 3VBFC 1R083 4AAPA 1U5YA 2DVDA 4BK5A 2ZX0A 1HW5A 3GZEA 4EZHA 2WYGB 4FAHA 4Y33A 3EBRA 2P3YA 3N8WA 1H8TC 2KR2A 2HWC1 5C8CB 1W2AX 2LROA 5LCWL 2MEV3 3N36A 3HNBM 4BH9A 4Q1RA 1RUF2 1UY3A 1OA2A 3ZYHA 2VUJA 5LY2A 1OXCA 5G04L 2ZX3A 3RQ0A 4Q26A 2JDAA 3BB6A 5JIUA 3OY8A 2KL7A 3HO5A 1U5XA 1VR3A 4XMIA 1W0OA 3FLTA 3PJQA 1SMVA 1VP6A 2DVBA 1G7YA 3FJSA 3TBDA 1Z7S2 3T2PA 4BYYA 1BJQA 1BBT1 4Y3OA 1UU4A 4GXLA 4FO9A 2R063 4YNIA 3LPGA 2J42A 3CLPA 2IZWA 2YG0A 3BUCA 2J34B 1DQ1A 2BOIA 2LTNA 1M1XB 1JH5A 2D97A 5AC92 4JAAA 4RS5A 2D5FA 1Y9QA 1C5MF 3NJVA 4AAXA 1DGWX 1W6PA 3C7GA 3OSDA 4LIVA 5ANNA 4CDWC 3POIA 2J2UB 1LU1A 4AL9A 1Q8SA 1JOPA 2WNEA 1RUNA 2R071 3FLPA 4D6RA 5LW9A 1O91A 3G7DA 3QH6A 1LKNA 4V2VA 2XC0L 2JB8A 4CRQA 2GH2A 4GKYA 4IV3B 3T09A 3FBMA 4OVEA 5A6YA 5FR3A 5KHIA 2XONA 2UWCA 3J4UH 5F5IA 5EGMB 4GH4A 3USSA 4LKDA 2X53S 3ZIXA 5BNPA 4LXLA 1RUI3 2CWSA 1HRV3 4LK6A 1P0SL 2KNIA 3VZKA 1GK5A 1H4GA 5CFCB 1G8WA 1JOJA 1IGOA 1S0EA 2CL2A 3QD6A 1S0FA 5ERLA 5D8AC 3U37A 4DUWA 3MPPG 5FUIA 2O8OA 3I3BA 4LBQA 4ARXA 2ZJCA 3M3QA 2AC1A 5BNOC 3M3OA 4HBNA 4Q0SA 2UWOB 1O3RA 1NXMA 3I4IA 1GP4A 3TGFA 1J3PA 4AZZA 1MS0A 2IXHA 1RYYA 3IAPA 4IV1C 5FYSA 2PR3B 2OKXA 4YFZA 1X50A 4H3WA 1A8MA 2DVGA 2A3WA 3AKPA 1KLIL 5CIRA 5FBZA 5FP9A 2ZGOA 3D6EA 4TLGA 4B7KA 3OPWA 2Z4FA 4NHXA 3U10A 4AHXA 1AXZA 1H6YA 2HWE2 2CTVA 2PTMA 4ITCA 2WDBA 4CDXA 1CESA 1A78A 3U1XA 2ZS6B 1F7EA 5GKAC 3PLQA 4AFMA 2XG3A 4BQ2A 2LW8A 1DDLA 1JUIA 2QQUA 2BSFA 2VCBA 4PI0A 1C8M3 1YCIA 3POBA 3RWNA 4BXFA 4D69A 3KQCL 2X10A 1JW6A 2XR4A 1VJ2A 2BFUL 1EYBA 1FYUA 3NNJA 4FFFA 5I0DA 1C3HA 1JYWA 3ZO0B 2V5DA 5IVBA 1E5IA 1EUUA 1AJKA 1RITA 3Q8EA 4R9AA 3T2TA 2DCZA 2F17A 2IVIB 4AW7A 5FO8B 4OQ9A 3ME2A 1LOAA 3M36L 4MGZE 1Q8VA 2BGOA 3KV4A 3VBSB 3ZYGA 4OUMA 4QQOA 2G9ZA 3LC5B 1ULFA 2WO1A 2PHUA 1OQDA 4XFFA 5KWRA 4B7EA 4NO4A 1CEJA 2ZHLA 2HWE1 2D93A 4NAMA 4MHRA 4PQ9A 5JIAA 1YQ5A 3H1WA 3BI3A 2Y6KA 4DINB 2W1SA 1QFKL 4MGQA 3VKFC 3CBNA 1WBLA 3KRKA 2C26A 2IXIA 2X09A 1OOPC 2KV4A 2A6XA 3QOPA 1Q8OA 4AEDB 4AQ2A 3PUQA 1LAJA 1XE7A 4MZUA 4Q4Y2 4K6BA 2VQ0A 1HJFA 1V6KA 2W91A 4K8RB 1QWRA 1YFYA 1AL21 1MZ5A 1YFXA 3KCCA 2HYXA 2VVUL 3A4UA 5C6CA 2JB4A 4OCTA 1H30A 4RUTA 2H6BA 5IK4A 1C1FA 2Y6JA 3EJKA 2V09A 4UF0B 2YGPA 1XB9A 4IE0A 4IGQA 4GZ9A 3HN3A 2RS32 4XAAA 5CADA 4HN0A 4FOQA 1U12A 1W8HA 1TZOA 2VMIA 3H7JA 2P3JA 1SBDA 1ZNPA 4R4ZA 5FK8A 5L9BA 4EWDA 2XL7A 5DZEA 5JBAE 1ENQA 4FPOB 4M01A 3DUIA 5A7QA 2RS12 1MS9A 5JXJA 4LLOA 1NAEA 1UCXA 4RD7A 4Y22B 5FUNA 2VVEA 3FUOA 4EN0A 4PJYA 5FZOB 2EICA 3JB4C 2PHDA 3MUZ1 4Z1VA 1FE2A 4JZFL 2FCUA 4AXOA 1QF3A 1QKQA 5A32A 5T52A 1S1AA 3FUQA 4CUDA 2D5HA 1TVGA 4RR3B 4XLWA 1XXNA 1GOHA 4XF4A 2DVAA 3KQRA 2HOXA 5FZ9A 4IESA 1UZJA 4XTMA 3ZKYA 4CUCA 4H7LA 4AEJA 4HK9A 5FP4A 2VNOA 5JI9A 1UU6A 1KS4A 2RS51 3AYAA 4YRDA 4D7SA 1YO8A 2E31A 2D1JB 4GAZA 4JGZC 2BWAA 2HWF1 3QMOA 3GXUA 4Q1PA 5LZ6A 2XHNA 2ZEZA 3WF3A 1H9PA 1QJU2 4EV0A 2W47A 1VE0A 2J94B 2Z69A 1CQEA 3GNEA 3RYPA 3OGRA 1KDMA 2W2IA 5FJKA 3I97A 1BEV1 1SCSA 2D3SA 2OVUA 4OI2A 4NHYA 3AM2A 5FYYA 2P6CA 4S2DA 1RUG3 1YWKA 2R041 1WCDJ 4XURA 2R072 3ZIWA 5ACA2 1WD4A 3PGHA 1QJX2 3IDBB 1LOEA 2PQSA 5FDBA 4OYUA 5JB8E 4A7IA 4LT5A 3V65B 2FCVA 2VTXJ 3C7HA 4BDVB 2W2QE 3CA7A 5HPOA 3QCWA 2ERFA 1SLLA 2RS52 1FV2A 4EROA 3OPZA 1ZZCA 5BUVA 3WNKA 3DGTA 4UFHA 5DUUA 1XQNA 2Q4SA 2RMU1 2VH0B 3IDCB 1CAXB 5FFOC 2HWB1 3ZKUA 2A6YA 4AWDA 4A7KA 2HWD3 3VBHC 2F6BA 3VZNA 5A1LA 2CDPA 1IGZA 5FY4A 4LULA 5HCBA 4CDWB 2Y64A 4FPFA 2CU5A 5FYCA 4FOWA 2Q0AA 3SH3A 1JZ2A 4C16A 1OLQA 2W95A 5CFCA 1S2BA 4O65A 4E1GA 3AVSA 4FFIA 4OMCA 1APOA 1LHUA 2N7GA 4KGGA 1MS4A 1HDKA 1UY2A 2P3KA 3Q8BA 1L5GB 3ITQA 2FMYA 2QQOA 2BW8A 2XGXA 1UOJA 1YQ8A 5AC93 4EQVA 4X8TL 2QE3A 3KHBA 3IDAA 4RA0A 3WCRA 2ZHNA 3BT1A 1O4YA 3HPNA 1OOPA 4FPYA 5FZ1A 3OOXA 4HPKA 3C8XA 3OJBA 4UI9L 4JYUL 4CUBA 4R9BA 3SLIA 3WV6A 2AEYA 2JIGA 3LWCA 4WVWA 2JXAA 2XWBB 3GBFA 4E9KA 4EJRA 4NIDA 4Q4X1 1XDTR 2WQ8A 2JDZA 4WM7C 4XUOA 1ZAQA 4Y5Z0 3ZMOA 1BBT3 2Y6FA 1LENA 3GM8A 2WNVA 2A5ZA 4NWWA 4AQSA 4LR4A 2Y5GL 3KVAA 4YGDA 2ZZJA 3SH4A 3GZUC 5F37A 4M0HA 1E5SA 2W52A 5LEKA 4FTSA 1N3PA 1RB8G 1ULOA 2FDJA 4MGYE 1KEXA 3MLKA 3SCHA 1XNDA 5EIYB 2H6CA 5JB9E 5JVZA 1QGLA 2Y8KA 4P9JA 2J7MA 5A33A 4MMYB 2Q8EA 3ZM8A 2OYEP 3VHOA 2IXJA 2PHWA 4IE5A 4LE4A 2ZGSA 3OUIA 4YZ5A 1COV1 2Q30A 2QQIA 1SZBA 3WCSA 5F3CA 4KU8A 5KR7A 2BBVA 2AEZA 4XFCA 3TNQA 1IZ3A 1POV0 1OF3A 2XUMA 3MF9A 4PBOA 5FMOL 3GCWA 3USUA 3KCGL 3VZLA 3WDXA 2XJVA 3AZVA 3ZSEA 1TLEA 2DYCA 1AYN3 1ND3A 2BVVA 1L7LA 4FFHA 2ADXA 5G05L 3TN93 4S2FA 2RS33 5F1AA 1R081 4YVSA 4PLMA 1CVWL 1BYHA 3ABZA 2VBBA 1W6NB 2PELA 2E63A 4K1YA 4PF1A 1A3KA 3PUSA 4QB1A 1MQ6L 4A44A 3N8WB 4QHOA 4ATEA 4LA2A 4CZSA 4NGAL 3LTFB 2WZR3 1H8TA 1MQTA 3TAYA 1ZYBA 4XW3A 1RVF1 4BIFA 1PRHA 1REEA 3HMYA 3DPRB 3LE0A 1J59A 5HCFA 2BT7A 4K20A 3ZXDA 2JDYA 3LEKA 3AVRA 2FD8A 5F9TA 4Y4RA 3SQOA 1PMIA 2KA3A 1VIWB 3IPVB 3UV9A 4N7UA 1CN1A 1AR62 5JZGA 3N35A 4XOGA 1VBD3 1W6MA 4NIGA 5LRSA 3N9MA 3WVJA 4K8FA 2R043 4YZUB 1BQPA 1N1IA 1WW6A 3ZFGB 1W8FA 3RI9A 5IVFA 4G9SB 1EPWA 2O1QA 1OVPA 4H14A 3U4XA 4ZAEB 1W9FA 3G6JB 3ZXLA 2D98A 2WNVB 1DQ4A 2UU8A 4M3CA 1ZA7A 2F4PA 3MI8A 3LDKA 2EXIA 3LSDA 1ULCA 2RR12 1N47A 3VKMA 5JOYA 2WL1A 3ELNA 2PLV3 3ACGA 4PLOA 5JXGA 4K9SA 5F5AA 1CJDA 1S2EA 4JKLA 2WZR1 1EP0A 2XHKA 1HRI2 2IC1A 5BNNA 1AYM2 3E6DA 5L73A 2XQXA 1H1MA 2PHTA 5HCAA 2OW4A 4LO6B 4RGKA 4XXPA 3A0NA 3PTYA 1VLNA 5FZGA 5HXVA 2FLGA 2DUOA 1DIWA 3LPFA 4BXSV 4B3NA 2W86A 3EHKA 1BHGA 4IERA 2E32A 1ZZ8A 2QCSB 1HJ7A 1HRI1 1OA4A 4XPVA 1IQHL 2KB9A 1OKQA 2IFRA 2JECA 3VD3A 3H8RA 1DG6A 2EA7A 2OS2A 2PN5A 3LFIA 3POWA 4KWUA 3OCPA 4FSJA 1V70A 4A3ZA 2ES3A 3FFQA 1K45A 4TZDA 4FTBA 3IZOA 3PVNA 2GH8A 1YIFA 4UW6A 3HEIA 2DUQA 1MQTB 3JUUA 3JZVA 1WD3A 4LORA 4RN5A 3PURA 3MYXA 4O9EA 5EZWA 1FT9A 3BTYA 1LHWA 3WY6A 4GB31 3WINE 1X7NA 5F6KA 1NA1B 1AZDA 4LO7A 2HBTA 5GZFA 4N53B 4UBGA 1U5ZA 2VZPA 1Z7S1 2ADEA 2WJSA 2WLPA 3MICA 5F8PA 5B4NA 1GICA 5K4LA 4OI0A 1W6QA 1REFA 2EVXA 3VKOA 1HN1A 1RUC1 3LQCA 2RNLA 4YLZA 2WPIE 3FZ3A 1PZ8A 4A2UA 3HS6A 1IS3A 1GU3A 3W59A 4PIZA 1QXJA 2QFEA 4I01A 1G1RA 2K46A 3AJYA 4LEJA 3ZFGC 4Q4V2 2YGLA 1O5DL 3I2KA 5DABA 4BTUA 2VCCA 5FZIA 4EN6B 5FPUA 1QQP3 3RPQA 2WYJB 3MIHA 1FXZA 1K5MC 3GHNA 2YB7A 3THTA 4KG0A 5D2AA 3U07A 5J3UA 1ZREA 1J3QA 3BOPA 1IKPA 4MV2A 4IEXA 3BOWA 3KV5A 5FRAA 1F5FA 2ZKLA 4CP2A 2JE9A 3FHAA 3QH7A 1RUE3 2TBVA 3IAQA 4IV3C 3KF5A 5J7MA 1STMA 1N1YA 4IDZA 4UFIA 2GSYA 4W8JA 1ND3C 1Z0HA 2CAUA 1QJX1 1TMF3 2UY9A 4MXWA 2X5IA 1N3QA 1EV12 3M2MA 5T55A 3ASIA 1PM7A 4L92A 3CMGA 3HBKA 5A6XA 1IPKA 2IFWA 5BNQA 1HRI3 5HXMA 3LKJA 3KHCA 2YU2A 3C2UA 2P6HA 4WM8A 1LGCA 2BZ6L 2WFTA 2RR13 3IDEA 5FPAA 3ZVXA 4IL7A 4D6SA 3UL2A 4JYVL 1GOFA 3HR9A 4YG3A 4DXSA 5A1FA 1HX6A 1W9WA 2RG4A 3MIBA 3VDAA 4A4AA 2I45A 3ZYBA 1Q56A 4IEYA 1B9WA 3INAA 2NM1A 5FXWA 1GQHA 3SKVA 4CU9A 3GGLA 4XYXA 1EMNA 1IQNL 3EB7A 2C9AA 3Q8CA 1VB4A 5HBAA 2VZVA 2ZHMA 1URKA 5FZ3A 3MDPA 3H1YA 4OHVA 4XBLA 2Y5HL 1XKBA 3CQOA 2VRSA 3B94A 3JBG1 3KT4A 4Y1VA 3JBG3 5LBEA 2XVLA 3ZFFC 1ENSA 1XSQA 1RFNB 1W2OA 1XYNA 2DTWA 2GNBA 2PAMA 4QU1A 3ZXFA 5M0TA 2VVDA 1W90A 5FQ0A 1O6UA 4BISA 1YQ6A 5CVRA 1MS8A 1SPPB 4NAOA 1AR92 1RUH1 3RWKX 4OI4A 3JD73 1LHVA 2Z2SB 2UY8A 1OD5A 4LHLA 1QQP2 4A7ZA 3SCFA 1PTHA 5DAXA 1SQ4A 2ZACA 2J4IB 2VJXA 1HX2A 3T0AA 3IITB 3VL9A 4MH0E 3UKNA 5C9AB 5A3MA 5CAZA 1W6OA 4XACA 3VBOA 4E2SA 5JXIA 4BPZA 3Q7DA 3H8UA 4NROA 5FYBA 4IEOA 5TSWA 3HO4A 1VPHA 2RDRA 1ASJ1 1JU4A 4CDUB 3SW2A 4J25A 2JG9B 5DPNA 5FYTA 2IXLA 2WS92 1WLDA 5CKNA 1QMJA 3IJEB 1EBVA 1SLTA 1VBB2 2ETEA 5A7OA 1LHNA 3VBRC 1AR73 4RQPA 1VAVA 3AMHA 1QJFA 1EMOA 1HV1A 1OD3A 2JKXA 3N3HA 4RQPC 2V72A 4JZRA 4ZONA 3WQBA 4X6QB 4BQYA 3SC7X 1DQ5A 2GNMA 2R49A 3Q8AA 1N1TA 1NCQC 1HAEA 1IOAA 3MLLA 1ODNA 4NPLA 2PLV2 4JDNA 4LHNA 3RS6A 4AF9A 5FYHA 4QXKA 1RHI3 1SLBA 1AVBA 5LWBA 1OC1A 4XJUA 4FI9A 1W3XA 3L2HA 3SKJE 3VZMA 4Q27A 4Z2WA 4YVWA 4I3PA 5A3PA 1SG3A 4QGNA 2P37A 5DZGA 4C1XA 2WPME 1F4AA 3KT1A 3Q8FA 4UAPA 3MQEA 2GN7A 5FWEA 4Y1XA 4CCJA 3J8F1 1IQEL 1YYNA 1XE8A 5F3IA 1FPN3 2WYSA 2BMGA 5A3OA 2DU1A 3PUAA 3W5NA 4NE9A 2WG3C 2VOXA 2WINB 5IWFA 3WW4A 1RGSA 3WZ1A 3NTGA 3WR0A 5JAXA 4JCKA 3T3YA 3I2HA 2Z79A 1JZ6A 3WQ0A 3VBHA 4IE4A 5J96B 2H9EC 5KC5A 2FHRA 4G3YC 2QQMA 5FZEA 4QMAA 3ZX7A 4R9DA 5JI7A 5F19A 2ZCWA 4LBJA 2Y80B 4HXCA 4QU2A 3VGIA 1FV3A 3WT3A 4CDWA 5C5TA 1JYIA 1LECA 2QBXA 1HJGA 1ODMA 1W6MB 3C3VA 1JS9A 5FY8A 4ORFA 4GD4A 4KWKA 2FDFA 5IKRA 2HWD2 2RJKA 5I46L 2W1QA 1UKRA 2ZX1A 4N9IA 4DS0A 4EE2A 1HCGB 1FI2A 1O8PA 4RRZA 4JKMA 4RR3C 4HPKB 1QJU1 2YUEA 1CWPA 3DCQA 4COZA 2GP5A 4Z0KB 1TQ5A 2D44A 1FMD2 3THCA 2VM9A 2C5DA 3GJAA 2HWC2 1PNGA 2OA2A 3AKRA 3GCXA 1F0SB 4LNVA 1RMU1 1UY4A 2BDRA 2W46A 3JB8A 4L9BA 4OI1A 1UX7A 1WLCA 2CWMA 2VQTA 5FZMA 4YZ2A 3O1TA 4X6RB 3SHRA 2VULA 5A7WA 4JGZA 4AI1A 2WPJE 5ACA1 3N9LA 4Y5TA 2EIBA 4ET7A 1NPEB 1ATAA 2P95L 1S0BA 2ZA9A 3IMMA 5F2WA 1UL9A 1I6XA 4A3XA 1ZZ6A 1F15A 4I30A 4AFDA 3AJZA 4NN0A 3OLUA 1POV1 2M74A 4KU7A 5DUVA 5IKVA 4YW4A 4NUBA 4XEZA 4GMP3 4Y20B 1XNKA 4JDOA 4OTYA 1VBE3 1DBNA 4O7XA 2GP3A 3BYWA 1IVOC 1WA6X 2ARCA 1EQHA 1SLIA 1OA3A 3JQWA 4QPIB 3I3QA 3UGFA 4LLFA 3NKGA 2QKDA 3M4FA 3WG4A 5KHGA 1KS5A 4MYEA 1V6NA 1IG0A 5FYUA 1JTZX 4YT6L 2JJ6A 3KQEL 1CAVB 3I2GA 2O0OA 2SBAA 4P9IA 1NZIA 3TEYA 4Z92B 4GWMA 2WKKA 1KQRA 4GIQA 3VBHB 5DN2A 1NOVA 3LA3A 2BOXA 1Q8PA 3RZLA 1JBUL 2GC0A 5C4WC 2CY6A 2WA3A 1C4RA 1KJLA 1MEC3 2XUEA 2R042 3P1IA 1W6NA 2CHHA 5ISLA 2RVAA 1TEIA 3TRSB 5CFCC 5CISA 1C5HA 2A71A 2PAKA 1Y4WA 2VU9A 4KQ7A 4XFGA 4AVBA 3N8YA 1UZWA 4XDPA 2WT0A 3MHZA 1J1LA 2E26A 2JKBA 4LOTA 3J7HA 5FIXA 1LPZA 3LAGA 5FK7A 3VD4A 1HZ8A 1JYNA 2RE9A 1U5IA 1LESA 2JE8A 3ENRA 1TME1 4M4PA 1YRZA 5GLZA 1SEFA 3LA7A 2VQAA 2R32A 3RR3A 5AVAA 2JD4A 1SBFA 4JZEL 1ND2A 2VZ3A 4FOVA 1D7PM 1MS3A 1RUJ2 1MZEA 4BMEA 1AR81 1TME2 2CGPA 4TYSA 4HT1T 2ZAAA 5GM0A 2CV6A 2P2KA 5IVVA 3ECQA 5FXZA 2FLBL 5K0UA 3LTGD 1GWLA 1K12A 5L7OC 2ZAHA 1YI9A 2QVSB 5K9YA 2ET7A 5ABJA 3I3MA 1AX1A 4GWNA 2P3TA 3PUIA 4BQ5A 4BLIA 1MEC2 1X8EA 2PHBB 3LEIA 2ZGPA 1PVC2 5HV0A 2WAOA 2Y5FL 1W05A 5KXEA 4AQTA 3CKHA 1OUXA 3SEPA 3OBAA 2WZEA 5FP7A 2HH9A 4YVWB 5T3NA 2BOHA 4DZGA 1CGPA 5L2ZL 2QQVA 3LCPA 3RJRA 1N3OA 1SPPA 1OUSA 1W0PA 1XNCA 1OVSA 2Z5WA 1NUKA 1SDDB 5C8WA 1IQFL 1CONA 2UWPB 2AENA 4OZOA 2GD4A 3I3EA 4XUTA 4N53A 5JMOA 2H0VA 1BK1A 1CCFA 5LK7B 4Y1UA 2YGQA 4TWTA 5CB7A 4LO4B 3WP5A 4YW7A 3OGSA 5J1XA 5A3LA 2XPJA 4YT7L 2Q1FA 1BCXA 1MEC1 3LEGA 5GLTA 4RFT0 4KI5M 3N4MA 2CDOA 3QACA 1LTEA 2NN8A 4MGTA 2FZZL 2QQNA 3B5LB 3ZYPA 1NXD1 1OPOA 2P3UA 4IEWA 1S0DA 3OF1A 4YFWA 5GZCA 3B93A 4J1WA 4E8CA 1IOEL 1FSBA 1JXNA 1W8ZA 2Z42A 5DDJ2 2BZDA 5AVPA 2A3YA 3H1MA 4CCEA 4YW3A 1LHOA 4KNCA 4WBBA 4P9YA 4SBVA 1O3SA 4CPBA 2YBSA 1BK0A 2HEVF 4Y76B 2QQJA 1GWMA 3CENL 3FHIB 4W50A 3C7EA 1H1AA 2B46X 5FZOA 1HRV2 1W0NA 1V6LA 2V5YA 3K75B 4Q4Y3 2ZGKA 1B35A 3BTZA 4AFCA 2E33A 3M70A 5FZDA 3OBRA 1APQA 4E27A 5I0TA 2A75A 2JG8C 2PMWB 4ISHL 4K21A 4KWLA 1UKGA 3EQEA 5LY1A 4CCMA 2G4IA 4UOJA 3H42B 4Z82A 4WM8C 4CPBD 3ZXGA 1M06G 1DVAL 4EWEA 3AMPA 1KFUL 3IBMA 2VUAA 1SDWA 1G1SA 4TLFA 5DZFA 4R9CA 5EPAA 4META 5F32A 2VZSA 3RYRA 2YBPA 4XJ8A 1RVF3 4MVTA 4Y24A 2W3JA 5BV6A 4CCNA 3HOBA 1F9KA 2VMCA 5E6HA 2PQQA 2TEPA 3HN1A 5KHHA 3DYPA 1VALA 1O5UA 3WD5A 1GWKA 2D6KA 1EPGA 1JMUB 3LDRA 5C3OA 5IVJA 3I54A 1CD3G 3H8XA 5EP9A 3ETPA 1H9WA 2A3XA 4FXGB 4UW4A 1QH6A 2EI6B 3WQ7A 3OGJA 3MZHA 1DYPA 3H3UA 4D3WA 1QH7A 4JGYB 4WM7A 1PK6A 1FMD1 1T6GC 2OIIA 3HJRA 4GA9A 4IV1B 4ATFA 3GZTB 2JG9C 2UYAA 3IB3A 2C24A 3IMNA 1FAXL 1PO12 2FZ1A 2XMLA 1S0CA 4OFGA 4Q8KA 2AYLA 3A7QA 1I1EA 3RNSA 4PH9A 3ZSMA 4FPJA 2DUPA 4YW2A 2UWAA 2E53A 4GWIA 5CFDA 1VBE2 5A6ZA 5JLVA 3WF1A 4OTJA 1UY1A 1VRH3 1XFEA 1F7MA 3DKWA 4ZU5A 2W2PE 2IUWA 2BERA 4GB32 4AI9A 2VBPA 5D8AB 1UQXA 3NJPC 2A6VA 1N7DA 1V9U1 1FMD3 3LAQA 3VBOB 3TEXA 1LPKA 1RXFA 2FCTA 5H9QA 3WNNA 2A73B 1AF9A 5JUVA 1LK9A 1W06A 2L9LA 2PHXA 2GN3A 4A6SA 3QLQA 5DXDA 2FDGA 3KM5A 4M3CB 1I5ZA 1Y7BA 2CAVA 4LK7A 1RUJ3 4IEUA 4INDA 3SNMA 4CU8A 1MPXA 3T0BA 3VBSA 4COYA 1RTVA 1GZTA 1YUDA 4LBLA 5IVEA 2YBKA 3ACIA 3M3EA 3QH0A 3DKQA 1D2SA 2VJ3A 1VMFA 5CEHA 5FZ4A 2WPHE 5I8SA 1ZBE3 4XJAA 4FPHA 1GSLA 3SOQA 5C3SA 5JSRA 3LD8A 3MW4A 4QX7A 1WCUA 3VD9A 3W9AA 4ZXYL 4KG8A 1QJY2 2BRTA 2WWSA 4N8MA 3MBWA 4QXHA 3IN9A 2I2SA 1EPJA 5A3UA 5JDBA 3V64C 2VMHA 5F3GA 4KBBA 2BP6A 1WMXA 4RS0A 4XBNA 1EV11 4XTPA 1PMHX 5K7PA 2Y6LA 2V4VA 4EN8B 1JHNA 5LASA 3N8YB 3MLJA 4GQ7A 4RGGA 3RJ2X 4DUXA 1F2NA 4CCKA 5KHKA 4LBQD 3O1MA 1S4CA 1PGW1 3T08A 2DCJA 1V6IA 4UW3A 2GAUA 1A3PA 2G9GA 2R30A 2WIIB 4YARA 2BQ6A 4KL1A 1OQEA 4YM0A 1W28A 5C8CC 2QZ2A 5I0RA 5EQUA 1OLRA 2XJQA 3BN6A 3MW3A 4SLIA 2QZ3A 1W8NA 2R062 2WNUC 1MS1A 1RUF3 5LBBA 4AVTA 4DB5A 2WSVA 5FOJB 2FLRL 1ZZ7A 2GZWA 1LMJA 5CFDC 1I5PA 4HONA 1YLLA 3GDBA 4MXWB 5F39A 5FOBB 5F3EA 3TOJA 1ST8A 3A23A 2A7AA 4WV8A 1O4TA 1UYXA 1YJLA 3BCWA 4COUA 2PAEA 5I8YA 3RZKA 1X7AL 2UURA 3ZFEA 1YUGA 5IHRA 3PDQA 4LJHA 3NWKA 1R082 5EV7A 2WS93 5JR7B 5FY5A 4CU7A 3WNOA 3AP6A 1BMV2 1OBNA 5FZAA 4COXA 2WFF1 4OHZA 3ZFEC 4Q29A 4TXWA 1O3QA 5FZHA 5B2GB 1UN1A 1COUA 1A8DA 1ZVFA 5FBJA 4PT6A 5GLVA 1MACA 4YGEA 1RMU2 4NPRA 1AHSA 4CUFA 2Y81B 5FKCA 1WHEA 1AL22 3SH5A 3WW2A 5IVCA 1RUOA 1RUI1 5ABJB 3UK9A 4XC9A 2K2TA 3WDTA 3KD4A 1HT5A 4JGZB 2Q1JB 1EGFA 2W39A 3LOBA 4BMBA 2GALA 1ZM1A 2XQRA 1J3RA 2OPWA 1WMDA 2YGMA 2HEWF 2ZEWA 3IT8A 3PVEA 3ZXKA 3ZSKA 4QGMA 1IKQA 1AYM1 1F35A 2IXKA 4ZS3A 5FZ8A 2J1RA 2YU1A 4DPNA 4RFRB 2NQYA 2D6LX 3ACHA 5FZBA 1LULA 1N1VA 4WZFA 5EJZB 3WDWA 3RZGA 1Q8QA 4CVUA 4OULA 1W8BL 4QD2A 3S30A 2BTVC 4QPYA 4XQWA 4YM2A 5FPBA 4B8EA 2MEV1 1OURA 4ONUA 4E4SA 4HFSA 1T2XA 2BYVE 1NA1C 4YM3A 5AC91 4Y6DB 2VQUA 3L9JT 3NV3A 5FYMA 3S6XA 4CUAA 3CIHA 1UZYA 2WNUA 4CSWA 2WWJA 3SISA 2LUWA 3I2JA 4GALA 3ALQA 4IGPA 4AHWA 3MEPA 2FDKA 1FPN2 2VXRA 1TNRA 4FPCA 1LRHA 2ZMNA 1US3A 3KLSA 5LBCA 3MPBA 1EQGA 5KN5C 2ZX2A 1J1TA 3P6BA 4RHV1 5FREA 1JBCA 4Y7AB 5A80A 4XF1A 3VBSC 4FP3A 3APBA 3UNPA 4M10A 2BWCA 2H0BA 3MV11 3AL5A 1RUD3 2BEOA 2XLGA 3NNLA 5BNPC 3KV6A 4ZXEA 1DIYA 4JTOA 3ZLIA 1RUD2 5D1IA 1QXRA 4QGLA 1SBEA 4D0QA 4BDXA 3RGBA 2G00L 4XMAA 3CJIA 3POEA 2ZHKA 1XRUA 1GUIA 2MEV2 3R4UA 4K40A 3CJIC 4QX2A 1ULPA 1IQDC 1LJ7A 4GKXA 2XJRA 4WVMA 2DVFA 1LOFA 3B02A 2K2SA 5FYZA 3S7EA 4XDOA 4A6OA 1A34A 4MMZB 2QUOA 2BOKL 2BQ7A 4G1MB 1DQ2A 4NA9L 1EAH1 1UZKA 2AREA 4BJ0A 5FLJA 3VHRA 4E2GA 4H2AA 5FPLA 1LB2A 2VCAA 1ULGA 4ASLA 1W6PB 3OG2A 3EXUA 4ASMB 5CU1A 5DAQA 1OQ1A 1US2A 4N7IA 2FDIA 2EAKA 1SLAA 4KGQA 4NIAA 3LF7A 2XKPA 1KITA 1KGYA 3H5CB 4QHBA 4QX3A 1SACA 2C0ZA 2OQ6A 1NLQA 5ABJC 3EGFA 2AGSA 1ZBE1 2YC4A 2OZJA 1PIV2 2PYTA 3GBWA 5CNAA 5A1AA 4QXBA 1NZCA 2J1SA 4NOTA 3WXPA 4Z07A 2WFXB 4PIXA 1WKYA 2VOVA 5GLUA 5SV8A 4AFBA 1EAH3 4Z2AA 2WAAA 1JZ3A 1AYN2 5LB6A 2P3FN 2NP0A 1MZFA 2AR6A 4WM8B 3U14A 4Q4W2 3P3PA 1RUJ1 4LUKA 4R8HA 4YWAA 3WW3A 3BPZA 4PIYA 4DRRA 4FFGA 3AP7A 3WX5A 1VRH2 4GWJA 1QNYA 1XC6A 3GALA 1AYN1 1WMEA 4FVVA 4JTNA 1RMU3 3VBFA 2TNFA 4W6YA 5IVYA 4AOCA 1H8TB 3AMQA 1W2NA 2OUHA 3R4SA 3AKSA 4A45A 3N8VA 2MPFA 4HSJA 2AZ5A 2EI8B 3OUJA 2K9ZA 4LA3A 3W5MA 4HN1A 4QB2A 1Z6CA 3SOVA 1LQDA 1PO13 3VUOA 2RJLA 2DFBA 3N9OA 5FMBA 3IIIA 1W8OA 4PF5A 4DXZA 2GC2A 2D3PA 2JE7A 3V0BA 1IPSA 4AVSA 1CPNA 3IIAA 1ZBA1 4PCRA 5IT6A 3LEMA 1NT0A 2R061 1G9BA 3ZR6A 5JOWA 2VTFA 1AYM3 3H50A 2J22A 2I9BA 3LC3B 3PMSA 4R52A 1W99A 3B9CA 4PBPA 4QQHA 3VDCA 2QQPA 3P5BL 4HVRA 4ZU4A 1S0JA 2D7FA 4AVAA 1UZPA 1RUE1 2ET1A 4A41A 3ZPYA 3B01A 2HYKA 3AL6A 2RDNA 4AI8A 1H4HA 1ASJ2 1CQ9A 1AR63 1XNTA 2LRPA 2Q1MA 2W68A 4HOOA 2F4LA 4XZPA 4LBMA 5FPVA 5IW0A 2VG9A 2I9AA 3ES4A 2XBXL 2QDRA 3HAGA 4DNYA 4CP9B 3S6PA 2D6MA 4QQPA 3RYKA 3U11A 1BZWA 3LDBA 1ATBA 5JOXA 2QDNA 3QBQA 1TOZA 2BOUA 1MQ5L 1R1A3 2CNAA 5IK8A 1AR83 4E4DX 2BT8A 1Q5OA 2XLAA 2YDEA 3T4VA 1RJ8A 4BQWA 3O1OA 1KFXL 1JZ4A 1W8WA 5FZFA 4GU4A 3V65A 2RJ2A 1UF2C 3FN9A 1ZBA3 1M4WA 1TG7A 5H9SA 2VPVA 1YHFA 1O5LA 4RYDA 2XBO3 1KRIA 2VVCK 3NAPC 4AEDA 2XKOA 1TNFA 5IUQA 4B1MA 1W3VA 3HS5A 2YXSA 2VNGA 4NHLA 2B7DL 4DRVA 4Y79B 1L3YA 1GQGA 2EALA 3LA2A 1DF0A 4P02B 5FP8A 1RUH3 3I3DA 3DV8A 1LODA 4JZDL 3WDYA 4DY5A 2WNUB 4S2HA 5DDJ1 5H9PA 5C3QA 4BWOA 1YXWA 3O14A 1W39A 4N43A 1W6QB 3H3LA 3B69A 3TN92 3ZFFA 4BU2A 3WF2A 3WG2A 4CCOA 2VXJA 4IEPA 4JGYA 1KDKA 1Z78A 3P5BA 5JWPA 2VWNL 1QOOA 4NR1A 1GNYA 3ZMNA 4A42A 3MIEA 3NW4A 2J95B 3N7JA 1PK6B 4HZFA 4IV1A 1X82A 2VY0A 1GKBA 3U75A 3JXSA 1C57A 1PO22 3ZSLA 5EJ3A 1VBC1 4W4ZA 2XXZA 4I02A 1CJPA 4DQAA 4I3GA 3VD5A 3JU9A 3AX4A 4FQZA 1LPGA 2KXLA 3JQXA 1XOYA 3K51A 1MOXC 5A3TA 4FQ4A 4ES8A 5CZKA 3H8OA 4XUPA 1OOPB 2XH6A 3KMHA 3POYA 1V3XB 3WG1A 1OSGA 3I2IA 1NFWB 1UIKA 3RRDA 3MIFA 1VRBA 1FFMA 5IKTA 1CIWA 1ZA4A 4JQTA 2Q5TA 4H55A 1V6JA 4QB6A 1UXXX 2VC9A 3O12A 2BNMA 2VUCA 1IGXA 1JYTA 2ARXA 2VNRA 4XFHA 5JXHA 5K0UB 1D4M1 2ATFA 4CUEA 2NYYA 4LITA 1PZ7A 1IHMA 2ZBJA 3OB8A 2D43A 1WW4A 2WA4A 2DU0A 3KK6A 2NZ9A 2ORZA 5LA1A 2HWF3 2ZXQA 1EY2A 1MQTC 1SCRA 2VTXA 3ZDVA 4IEZA 1W03A 1P8JA 2VNVA 1QJY3 1RUC2 3DECA 4XDQA 4YZ1A 5F5QA 2RR11 3ENSA 1PX3A 2P3IA 4MLOA 4AEKA 1ATDA 3DEMA 2B7YA 2G19A 4ZXKA 3KL6B 2W9XA 3ZYJB 4RHV2 2VW2A 2X8KA 1UMIA 3GBGA 4QPGB 1Y9MA 3O1SA 4QKFA 4XF9A 1K42A 3LN0A 1LCLA 1CAWA 3DPRA 2RMU2 1PNFA 4KWJA 4P5HA 3T30A 3Q9OA 1QJX3 3UETA 3T4HB 5A7NA 2RM21 3D3AA 4BZ4A 1ACCA 2KD7A 5IFTA 4XE9A 3GISX 2P28B 1WHFA 3BIWE 4FCAA 1EZQB 1RUC3 3ZYFA 5K8SA 1RHI1 5K0UC 4JX0A 5L7OA 2YC0A 4I0BA 4YW1A 1TPGA 5HI0A 2GMPA 3S57A 3TYJA 3RZMA 1CAVA 1CX4A 1PHMA 5DUXA 2E6VA 3H0OA 5GZDA 2BQWA 2QQWA 5COXA 4GULA 1W6OB 2WO7A 1J9CL 3O5SA 1JV2B 5C9AA 1IQLL 4BK4A 1B09A 3J26N 3BU0A 1DZQA 3WNLA 3AFKA 5JZGB 2WS91 1IQML 5F5CA 1IQKL 1FAKL 4GMP0 4CDXB 3OEAA 3ZSJA 1VBB1 4BHPA 3KF3A 2WFF2 2VMDA 4NWVA 2WUHA 1DCSA 2GC3A 3NNGA 2ZGQA 3NT1A 1PZ9A 3Q3KB 2XJUA 3AZYA 4FOYA 1D4VB 3WW1A 2WZPP 2DCTA 1PVC3 4XBMA 1NCQA 5T5JA 5I0UA 2W87A 3MDLA 4D90A 5C33A 4P00B 1NFYB 4NHKA 3MO4A 4BDWA 4BQXA 4C90A 3K4ZA 5C5UA 4QX5A 4QDRA 4W6XA 2DTYA 2DF7A 4AVCA 4JDMA 1RVF2 3ZDSA 5IATA 2LM3A 1OLME 5JPMB 3IM0A 4UFJA 2XB6C 3EO6A 4LO8A 5FZ0A 1ZZBA 1H1IA 1W9YA 4HANA 4Q4X2 4UF0A 4AGVA 2XBWL 1AR91 1RUH2 1I0UA 1K5MA 4CXXA 5JZGC 4URTA 1YQ2A 4CE8A 2BFUS 2RS13 4XQDA 1DZTA 3VBUC 5F2SA 2RMU3 4URAA 1MVEA 1PGSA 3AKTA 3AB0A 2AH2A 2E7AA 1GMMA 3CF6E 1UOGA 3U7UG 5FV3A 2D40A 2J1UA 1VBA3 2JENA 1KXGA 2VZRA 4D0EA 1HB4A 4OQ8A 2ORXA 3VHPA 4K3UA 1ENXA 4CCLA 4K7JA 3OGGA 1RC6A 1XE0A 4MSVA 5GLWA 4QX1A 1UYYA 1H0BA 3GCXE 2Y33A 3WNMA 1RINA 1V0AA 3PNAA 4PDWA 3OEBA 4RHV3 4GH4C 3S7IA 4AGGA 5CKMA 1NQDA 3AXEA 3POFA 5A3WA 3VZOA 5ACA3 3HD8B 1GV9A 5F1RA 1YUKB 4XF0A 4XL1A 2ID4A 3K2OA 5GJ6A 3TN91 2XVKA 4AK3A 3FFZA 1CX1A 4XJZA 3UGGA 4LMFA 1S0GA 3OBZA 3M1HA 3RG0A 1GZCA 1R1A1 5D8AA 2TUNA 5LA2A 3PHMA 2CGOA 3NAPA 3GYDA 2RA0L 4AEDC 4ZHAB 1EUTA 4NG9L 4FXKB 4X8SL 1QJU3 3PU3A 4EZ4A 1DGLA 1KJRA 1RIRA 4YPJA 2VBDA 2RHPA 1K37A 3TH3L 3K3NA 3RFRA 2ZX4A 3SOBB 1GZWB 3NRUA 5IJRA 3H3ZA 3KQBL 1PXXA 4Y7BB 1WWYA 5DAPA 3NV2A 4Y1ZA 4D8MA 3KZ4C 2JG8B 2VZOA 1TMF1 1LOCA 1G2MB 3URFA 3H9AA 1UZVA 2QQKA 1C8M2 4M0NA 2J1EA 4HVQA 1WCQA 2EIEA 1AX0A 2WT1A 4C1WA 5IYYA 4YG0A 5JSPA 1MS5A 3PU8A 3GF6A 4JQRA 5F6LB 5DUWA 1QOSA 1K5MB 1L7QA 1RL3A 4UT5A 4J6GA 3S5QA 5I0SA 2HWB2 3RI8A 4FBFA 1L3JA 1FPN1 3KQ4B 1H2MA 3OGVA 3SMHA 1O3TA 2OX0A 1V6MA 2VW1A 2Y60A 1HQLA 4XHBA 1SFPA 3K77A 4QPGA 3V56A 4DFSA 2KM2A 5FZ6A 3KV9A 3CS7L 4XFIA 1HRFA 2E7QA 4W65A 3AFGA 2NLRA 4UBHA 5FQ0B 2MGRA 1KD7A 2YHJA 1PIV3 1TME3 4AR2A 3I59A 4P9LA 1QOTA 5KHJA 5BY5A 3WLUA 1ULDA 4YSFA 5JBCE 4FPKA 2PHRA 3BT2A 3F1SB 1NX9A 4MO3M 4XAEA 4XUQA 4O02B 1ONAA 2FDHA 4CEWA 3FCSB 5FO9B 2D6PA 1IP0A 5JW1A 3E5QA 4HL0A 4Q4V1 4ZZ5A 4E4ZA 2DURA 1BEV2 4IEVA 1WCKA 1O8SA 3ILNA 1LEMA 1QIQA 2VAUA 4E2QA 1UZQA 3UYJA 1U0AA 1FF7A 2VCMA 2BUKA 3FHQA 5HV4A 4BXSA 1Q43A 4XIKA 4HKLA 3M3CA 4IE7A 2A6WA 4Q0UA 4F3JA 2DWRA 2LALA 1D0HA 3DL3A 3PVBB 1AR82 4DEQA 3HWJA 3NV1A 5LRRA 1C8NA 3FE5A 3M8LA 3WQ1A 2VL4A 3VDDB 4MOAA 1V9U2 3WEZA 3R0RA 4XQ4A 2YGOA 2VH6B 4LQRA 1JUHA 3CFWA 1OPMA 5FAXA 5L30L 3R6SA 1IJQA 5J48A 1NKGA 2WNVC 2EXKA 2PXJA 3KVBA 1DU3D 3F2ZA 2R0FA 4QKNA 2B4KA 4YZ3A 1VBE1 1V00A 3NV4A 1NQLB 1PVC1 2OXBA 4XETA 4NIIA 3U73A 1AXYA 1G86A 3CDZB 4BA6A 3UJOA 4NMIA 2DDUA 1RUG1 5A7SA 3MV01 4D94A 4LPLA 1RHI2 3N7KA 1X8MA 1JHJA 1MR5A 2JDUA 2NMOA 3O0XA 2UYBA 3POJA 1U8CB 3RZJA 1VBB3 1HN0A 1NCRC 2B5HA 3USUB 2RS31 2VOTA 4OZXA 1NFXB 3J7MA 4YVSC 3RVHA 4EWAA 4LO5B 3VBRA 2BQPA 3EYPA 5AFEA 1URXA 2VZUA 3SITA 1WCSA 2J1VA 2JICA 5CFDB 5KXCA 1KSNB 2WO2A 2VECA 3U0ZA 1CVUA 3ELAL 1ZRFA 4ZXXL 1AR61 3CL1A 1PIV1 1O7FA 2Y7ZB 3N8ZA 4Q4W3 5LBFA 4NPMA 5LK5A 2C4XA 1V1HA 1QQP1 3THPA 3LIHA 2E9QA 4N43C 4BIOA 4JKKA 2ZZQA 3I8TA 1A6CA 1AXKA 1HXS2 1J58A 1GANA 4WVMB 4YG6A 2YC2A 1WMFA 1CR7A 2ILMA 3OPTA 4V1PA 3VDBA 1AL23 4IE6A 1DFQA 2WQZC 3GZAA 4QAWA 1IQJL 1OFNA 5EJ1B 3K48A 1E5RA 5E89A 4M3CF 2JDMA 1XSRA 4ZY9A 3DXTA 1DYKA 2YMZA 1XYOA 6COXA 4IETA 3NTBA 1GP5A 1F5JA 1GLHA 2PHLA 5FO7B 5FLHA 4S2GA 3D5OA 1S0IA 3PMEA 1K3IA 4AI0A 2HJIA 4G4FA 4BCUA 2BPA2 2VMFA 3E6BA 3KT7A 4B4PA 1JZ7A 5A7WB 3RSJA 5FP3A 1UX6A 2WPLE 3FBYA 1T6BX 3TEWA 1NFUB 2GDFA 2P93L 1NQJA 1V1IA 3M37L 4TN7A 3WOGA 2BNNA 4CEWC 3ETQA 4UFKA 4NRMA 1HXS1 3C7FA 4MX3A 3NJXA 2D6OX 3T2QA 2QNKA 1PX4A 1RJ7A 3EMRA 5L9RA 3HS7A 3VBFB 4MG2A 5C3RA 2C6SA 1KLJL 2A70A 1YFWA 3A21A 4IEQA 1Y9GA 3ZN6B 1TMF2 3I2DA 4QQLA 3DYOA 4TTGA 4QKBA 5CG8A 1C8M1 3VBUB 3O1VA 4QPIA 1WU1B 5I93A 3CU7A 2R1BA 4BE3A 3JD71 2W2OE 3VD7A 3KS7A 3AP4A 4F83A 3PIGA 4NIHA 2E7TA 4LOSA 1EPZA 1W2UA 4GU3A 1VAKA 1HQNA 1SFYA 1W9TA 2YV8A 3NSTA 4P9XA 1R092 4WM7B 2P4EA 3WHUA 2Y82B 4CEYA 2XJSA 3MUY1 2JDNA 1W8TA 3AC0A 4IQPA 2R0HA 4LHKA 4FPGA 2Q8DA 3UGHA 3BIEA 1UMZA 2EXHA 4JGYC 4CDQB 1BEV3 5FUPA 1H8VA 4I0AA 1RUF1 4CEWB 4YVSB 3K9XA 2WZR2 1QEXA 2ZGTA 3AP5A 3M3IA 5LATA 4XUNA 1GOGA 3UKTA 5JPNB 2P1BA 4CP9A 5L19A 2WABA 2R1DA 2EXJA 1ND3B 2EF6A 4P5YA 1XKAL 4L2NA 4LBNA 1ND2B 4X8UL 4CA9A 1X9TA 3OYWB 3DXUA 1FX5A 5I91A 5FZLA 3IPVA 1AR93 1SFNA 4QT6A 1UD1A 5AFBA 5CBLA 3LSEA 1PGEA 4BOWA 3I49A 2B9VA 2P26A 2OT7A 3F6UL 2WRAA 3HQXA 1IQGL 3CJIB 3OY8B 5FJHA 2WSUA 3B00A 4DOUA 2ZGNA 4XJ9A 4QQ2A 5E1RA 2GU9A 3ACLA 2P94L 1JOBA 5A33B 5GZGA 1FOD1 1NLRA 1NY72 2JIJA 5FMOS 2W92A 2YPDA 4P14A 2ZGUA 2JJLA 1NYWA 3D8CA 1WUVA 1H2LA 4GJYA 4V2WA 2VGDA 2W1UA 1CX2A 3KSCA 1CZVA 1NE4A 4B1LA 4BM8A 3AZXA 4N53C 2Y26A 5IFPA 3W21A 1NCQB 2RDSA 5FY7A 5FWJA 4X8VL 1ZRRA 3I2FA 4MUVA 4DMIA 2XBO1 4CCCA 2PFWA 4QX0A 5IK5A 4ZPIA 5DAVA 3O7OA 2XJPA 1FNZA 3AZWA 3N9QA 4XZUG
chains in the Genus database with same CATH topology
5T50A 1CVNA 3V64A 4XHXA 5FTTC 1KIGL 4MGIE 1V9U3 1VAMA 2W26B 4RSUA 1G9DA 4M00A 1ALYA 3PJYA 3VBUA 1G9FA 4ZKTB 1COV3 1FOD2 1NY71 3B7MA 2FD6A 3MFAA 4Y20A 1ZZ9A 4RRYA 1FAYA 4L97A 5EWSA 4AEMA 4BMEA 4UXAA 3VN4A 1HAFA 4AE2A 5H9RA 1ULEA 4JRAA 5BNNC 1OI6A 1QU0A 1CAXA 5C8CA 1V6OA 1DX5I 1ZBE2 2RM23 1VBD2 2WFPA 2D3RA 3WNXA 5CKQA 1D4M3 2Q8OA 1IOXA 3VBRB 3HBZA 1DQ0A 1O4ZA 4A7YA 3BALA 5CG9A 2FBEA 2ZMLA 3KCXA 4OHWA 1JL9A 1NCRA 5BXXA 1GR3A 1C28A 1PO11 2W2NE 5L2YL 4COVA 1MVQA 4YZ4A 3ZFEB 4LBKA 3NAPB 4LBOA 4P9GA 5GZEA 4AYUA 1IS4A 1H2KA 4ES9A 1IQAA 2WQ4A 1LOFC 3E5UA 5LEJA 4BTIA 4Q4Y1 1ND2C 1GZ9A 3D4KA 1D2QA 5K0HB 1LR5A 2B39A 2GNTA 2GMEA 3L2YA 3S0MA 4XFAA 1DDXA 4CYDA 4I0WB 1LOBA 1DQ6A 4UW5A 2VOWA 2B42B 3ILFA 2ZOEB 2VH9A 2GMMA 2HWB3 4IXLA 5JCTA 1DGRN 1ZRCA 2PLV1 3BODA 3VV1A 3WG3A 5E88A 1GNHA 3JCIA 1IQIL 3RZZA 5C9AC 4HSLA 4YYOA 1BVVA 1B35C 1WGPA 4IV3A 2W3IB 1VBC3 4AI3A 1BF9A 1QJZA 1G1QA 2P34A 4RS5C 4AVVA 4C0BA 1R1ZA 3C9AC 1HRV1 4GH4B 3J8F2 3T1LA 3R4DB 3IWZA 2HKXA 4Y22A 5DG1A 1X36A 2ZMKA 1YUFA 2MNGA 5T5LA 3E6CC 3SXWA 2MGPA 4FPEA 3ROUA 1G1TA 4B4QA 2ENRA 3ZYIB 1BXHA 2P3FL 4N43B 3TNPB 4NHMA 4BQ1A 1Q3EA 5DG2A 4ISQA 3NL1A 3MF6A 5L7OB 1JN2P 1CAUA 4A94C 2WLQA 4D0FA 4RS5B 2GNDA 2MHFA 4P9WA 3AKQA 2F9BL 1HV0A 1VBA2 2QJVA 4AI2A 4Q8LA 4R4XA 3RMXA 1FNYA 4EN7B 4TGFA 3CEWA 4PLNA 2XLFA 3LN1A 1P9JA 1WA4A 4PDWB 5JOZA 1X33A 4QM8A 1LEDA 3WP4A 5EYXA 2IWGB 2R073 3O0VA 1S55A 4Q4X3 4WVZA 1FATA 3FX3A 1YGCL 4DY3A 2B45X 3ZYRA 5KBFA 1HT8A 4ZH8B 2OZ6A 2YROA 1UAIA 4AHZA 4LUMA 3FC0A 3VZJA 1AX2A 4GB33 1WBFA 2YZ4A 1B35B 4N9HA 4LBQB 5BNOB 3OLTA 5T5OA 1DGRA 3GHMA 3HPTA 4HMZA 3VKNA 1RUG2 3VLBB 1VB2A 1YJKA 4JVAA 1NE6A 4HETA 4QPGC 2BGCA 3ZXEA 4J1XA 1F0RB 3SCGA 2ZGLA 4FPLA 4YM1A 1OFSA 4M3CE 4N90A 1PGL2 1UU5A 1DZRA 2ZTNA 2VWMK 3TZIA 1UPSA 1BBT2 2PUQL 2E51A 4CDQA 4RL7A 2D6NA 1G9CA 3NKTA 4M11A 1APNA 5FPZA 1PGL1 4XIOA 4YGCA 2EAAA 3W58A 2B9UA 2DCKA 2HWE3 4LE3A 2VWLL 1LU2A 2WFF3 2XWJB 1UZZA 1AL0G 2R16A 3KCYA 1GZWA 1QDOA 4JV4A 1OMIA 5FPXA 1NG0A 4FP2A 3FWEA 2PA7A 2Y0IA 2WC2A 1K36A 4GMP1 2VVFA 1D0GA 5BPXA 1POV3 3RMYA 3FLRA 3LGRA 4HVOA 2Q1ZB 2UWLB 1WLWA 3TK6B 1NCRB 2JX9A 3KB5A 1LMMA 1VBD1 5IK7A 3UKVA 1G2LB 1HQWA 1XU1A 3LOIA 1KLOA 1U67A 1NLSA 2HEYF 2YYOA 4H7MA 2EIGA 2OPKA 3WP6A 2YPJA 1CCVA 3ILRA 2W3KB 1IS6A 4OLLA 4HLTA 1QHDA 2RS53 1G9AA 2O8QA 3DN7A 2Y7XB 5C4WB 3OBTA 2R6QA 2XVGA 4MMXB 3AP9A 1CAWB 4Y1YA 1Q4GA 1W7XL 5JBBE 3AYEA 2BVBA 4U36A 1G6NA 2JG8A 3POSA 5DDJ3 3VDDC 1ENRA 2K2SB 2FZ2A 1EAIC 2W0XA 4AHYA 2OYUP 2VWOL 3B9IA 5BNPB 4RGAA 2VOKA 3X29B 2MHPA 1WLTA 1HREA 4QPIC 2WG4B 1XNBA 4FAGA 1WW7A 2DV9A 2NPIA 1EPIA 4XXAA 3ZN4A 2YY1A 2ARBA 3DPRC 3NO8A 3N7MA 1PVXA 5JMCA 2WPKE 1LGBA 2ZGMA 4K1ZA 3RDIA 4CEYC 3MIDA 3J8F3 2ZABA 4AFAA 2G9FA 4RRXA 3CO2A 4HKOA 1VBC2 2JKHL 4MXVA 1PK6C 4Y4YA 3J9SA 3VL8A 3ES1A 2J38B 2NPRA 2DCYA 2ZKNA 1IPJA 1C1LA 1C5IA 1DLLA 3VKLA 4BTTA 3VHNA 2PHFA 3MGUA 1QDCA 2UWBA 5EXOA 4CP1A 2HWC3 5KIRA 2CYFA 3OYWA 1GFF2 3D82A 5J36A 1ZRDA 2I07B 1DGWA 1BKZA 1LGNA 1YIPA 1RUI2 3N8XA 3D0SA 5E8DA 3TK5B 2VW0A 3WDVA 5L36A 4XBQA 5C4WA 1CPMA 3HIFA 1QXPA 1YFUA 4U2AA 1UIJA 3JD72 1BMV1 5GALA 5E8AA 4RQPB 4L99A 3LIWB 2HWD1 4I09A 2ZGRA 4B29A 5BYNA 1R1A2 4Z0LA 3E97A 4JRLA 2XBO2 4L11A 3HT2A 4JC1A 4O9GA 5T54A 5EFUA 4Q0PA 2H9EL 2BO2A 1SLCA 1ATEA 1XYPA 1PO21 1R093 3MIGA 4AQ6A 1ASJ3 5JSOA 3MFCA 3WUCA 2HWF2 3PVOA 1REDA 4FTEA 1ADXA 2K0GA 3FMGA 3LB9A 4Q0QA 4W6WA 2RM22 1HIXA 2GC1A 3AMNA 1ZX5A 1CAUB 4CP0A 3ZXAC 5J98B 5KC6A 1AUYA 5J09A 2XC4L 3TB0A 4EN9B 1OB1C 1VBA1 3BPSE 3ZN6A 1UPIA 4D7TA 5SV5A 1I9RA 2Y0OA 3I59B 4NVPA 1EPHA 1MZ6A 4Q0VA 3DF0A 4QM9A 1E57A 1S2KA 4BLJA 3NJZA 2I74A 3V0AB 3AYCA 3TWIA 3KGLA 2RS11 3ZXJA 5IKQA 3R05A 4WZCA 2P17A 1YI7A 3IKWA 5EYYA 1FJSL 1YNAA 4C0HA 1EV13 4PDWC 4CEYB 4LTAA 4RR3A 4F8AA 4C91A 4O1ZA 1PO23 1R091 5JVYA 2TGFA 4AGRA 2CJIB 4D7YA 2X29A 1QY4A 3H7YA 5A32B 1BVP1 2IXCA 5KXBA 4WVVA 1Z6EL 4Y71B 4Y26A 5BNOA 3T1MA 1EAH2 2JEMA 2SLIA 4OUSA 3ZN5A 4Z8BA 1AUTL 4L8QA 1VRH1 1AJOA 2A6ZA 1RUD1 3M7AA 5E16A 4FM5A 4X8PA 3GCWE 2VVVL 5BNNB 5CA6A 2V73A 1HXS3 3ZFGA 1JYCA 2FQPA 2AYHA 1OHFA 2JG9A 2W08A 4TSVA 2B8MA 1WW5A 1GBGA 3MW2A 2OUJA 1ZBA2 4CDXC 1D4M2 3WDUA 3NVCA 2XBYL 3A0KA 1DQBA 3AYDA 4FT8A 1UW8A 4YGBA 5JVVA 2OYZA 4I2OA 3KQDL 3LZZA 3WHTA 3ATGA 3HT1A 3AK0A 1GYKA 3JBG2 3OTFA 4KH9A 5KXDA 5FCCA 3I7DA 1GNZA 1PGW2 2FMDA 3V0AA 3ZFFB 4RRWA 1NA1A 1IS5A 1COV2 1FOD3 1F31A 2X5IC 2C1FA 3O0WA 4LO4B 3BTAA 2XBVL 4Q4W1 4X8NA 1XU2A 4CTEA 1Z7S3 4HK8A 3OD0A 4XFBA 3VDDA 3WUDA 3KGZA 4BXWA 4OHYA 4CDUC 2XL9A 5T5PA 1Y3TA 4CDUA 4Z6AL 1QJY1 1F8VA 3OD4A 2P16L 4HKWA 3E5XA 4ISRA 2BNOA 5FLIA 4ISIL 1DHKB 3UJQA 3N7LA 1HKDA 4CSYA 1AR71 1RUE2 4AG4A 3AMMA 3BU7A 4YVWC 3FFGL 3D0JA 3V0BB 1QNWA 3AZZA 4XILA 4YW5A 4XJWA 1H2NA 1AR72 2VMGA 2XJTA 3CJXA 2W2ME 4ZU7A 2Y38A 3ST7A 3P3NA 1LOGA 5FDQA 3AXDA 2X5IB 2AUYA 2NMNA 4MGKE 1PFXL 4B4RA 4COWA 1Y43B 4Q2FA 3B3QE 2CGNA 3HO3A 4OHXA 1TE1B 2DFCA 4Q4V3 2WT2A 5I8TA 2ZPXA 1HLCA 1I3HA 4F7ZA 2EI7B 5J37A 3CNAA 1N1SA 2XC5L 4CDQC 3VBFC 1R083 1U5YA 2DVDA 2ZX0A 1HW5A 2WYGB 4FAHA 3EBRA 3N8WA 1H8TC 2HWC1 5C8CB 2MEV3 3N36A 4BH9A 4Q1RA 1RUF2 1OA2A 2VUJA 2ZX3A 3RQ0A 4Q26A 3BB6A 5JIUA 3OY8A 2KL7A 3HO5A 1U5XA 1VR3A 4XMIA 1W0OA 3FLTA 3PJQA 1SMVA 1VP6A 2DVBA 1G7YA 3FJSA 3TBDA 1Z7S2 4BYYA 1BJQA 1BBT1 1UU4A 4GXLA 4FO9A 2R063 4YNIA 3CLPA 2IZWA 2J34B 1DQ1A 2LTNA 1M1XB 1JH5A 2D97A 5AC92 4JAAA 4RS5A 2D5FA 1Y9QA 1C5MF 1DGWX 1W6PA 4CDWC 2J2UB 1LU1A 1Q8SA 2WNEA 1RUNA 2R071 3FLPA 1O91A 3G7DA 3QH6A 1LKNA 4CRQA 2XC0L 2GH2A 4GKYA 4IV3B 3FBMA 4OVEA 5KHIA 2UWCA 3J4UH 5EGMB 4GH4A 3USSA 2X53S 3ZIXA 5BNPA 1RUI3 2CWSA 1HRV3 1P0SL 2KNIA 3VZKA 1GK5A 1H4GA 5CFCB 1G8WA 1JOJA 1IGOA 1S0EA 2CL2A 3QD6A 1S0FA 5D8AC 3MPPG 2O8OA 4LBQA 2ZJCA 3M3QA 5BNOC 3M3OA 4HBNA 4Q0SA 2UWOB 1O3RA 1NXMA 3I4IA 3TGFA 1J3PA 1MS0A 2IXHA 4IV1C 2PR3B 4YFZA 1X50A 4H3WA 1A8MA 2DVGA 2A3WA 3AKPA 1KLIL 5CIRA 5FBZA 2ZGOA 3D6EA 4B7KA 4AHXA 3U10A 1AXZA 2HWE2 2PTMA 2CTVA 4ITCA 4CDXA 1CESA 1A78A 2ZS6B 1F7EA 5GKAC 3PLQA 4AFMA 2XG3A 1DDLA 1JUIA 1C8M3 1YCIA 3RWNA 4D69A 3KQCL 1JW6A 1VJ2A 2BFUL 1EYBA 1FYUA 1C3HA 3ZO0B 1AJKA 1RITA 4AW7A 4R9AA 3T2TA 2DCZA 5FO8B 3ME2A 1LOAA 3M36L 4MGZE 1Q8VA 3VBSB 3ZYGA 4OUMA 4QQOA 3LC5B 1ULFA 5KWRA 2PHUA 1OQDA 4XFFA 4B7EA 4NO4A 1CEJA 2ZHLA 2HWE1 2D93A 4PQ9A 5JIAA 3H1WA 4DINB 3VKFC 1QFKL 1WBLA 3KRKA 2IXIA 1OOPC 2KV4A 2A6XA 3QOPA 1Q8OA 4AEDB 4AQ2A 1XE7A 4MZUA 4Q4Y2 4K6BA 2VQ0A 1V6KA 1QWRA 1YFYA 1AL21 1MZ5A 1YFXA 3KCCA 2VVUL 3A4UA 5C6CA 5IK4A 1H30A 4RUTA 2H6BA 1C1FA 3EJKA 2V09A 2YGPA 2RS32 5CADA 4HN0A 4FOQA 1U12A 2VMIA 3WP3A 3H7JA 2P3JA 1SBDA 1ZNPA 4R4ZA 4EWDA 2XL7A 5DZEA 5JBAE 1ENQA 4FPOB 4M01A 3DUIA 2RS12 1MS9A 4LLOA 4RD7A 1UCXA 4Y22B 2VVEA 3FUOA 4EN0A 4PJYA 3JB4C 2PHDA 4Z1VA 1FE2A 4JZFL 4AXOA 1QF3A 1QKQA 5A32A 5T52A 1S1AA 3FUQA 4CUDA 2D5HA 4RR3B 4XLWA 1XXNA 4XF4A 2DVAA 3KQRA 4IESA 1UZJA 4XTMA 4H7LA 4AEJA 4HK9A 2VNOA 5JI9A 1UU6A 1KS4A 2RS51 3AYAA 4YRDA 4D7SA 1YO8A 2D1JB 4JGZC 2BWAA 2HWF1 3QMOA 4Q1PA 4EV0A 1H9PA 1QJU2 2J94B 2Z69A 1CQEA 3GNEA 3RYPA 1KDMA 1BEV1 1SCSA 2D3SA 2OVUA 4OI2A 3AM2A 4S2DA 1RUG3 1YWKA 2R041 1WCDJ 2R072 3ZIWA 5ACA2 1WD4A 3PGHA 1QJX2 3IDBB 1LOEA 5FDBA 5JB8E 4A7IA 4LT5A 3V65B 2W2QE 3CA7A 3QCWA 2ERFA 1SLLA 2RS52 1FV2A 4EROA 3OPZA 1ZZCA 5BUVA 3DGTA 5DUUA 1XQNA 2Q4SA 2RMU1 2VH0B 3IDCB 1CAXB 5FFOC 2HWB1 4AWDA 2A6YA 4A7KA 2HWD3 3VBHC 2F6BA 3VZNA 1IGZA 5HCBA 4LULA 4CDWB 4FPFA 4FOWA 2Q0AA 3SH3A 4C16A 1OLQA 5CFCA 1S2BA 4E1GA 1APOA 1LHUA 2N7GA 4KGGA 1MS4A 1HDKA 2P3KA 1L5GB 2FMYA 2BW8A 2XGXA 5AC93 4X8TL 2QE3A 4RA0A 3WCRA 2ZHNA 3BT1A 1O4YA 1OOPA 4FPYA 4HPKA 3OJBA 4JYUL 4R9BA 3SLIA 3WV6A 3LWCA 4WVWA 2JXAA 2XWBB 3GBFA 4E9KA 4EJRA 4Q4X1 1XDTR 4WM7C 2JDZA 3ZMOA 1ZAQA 4Y5Z0 1BBT3 1LENA 2WNVA 2A5ZA 4NWWA 4AQSA 4LR4A 2Y5GL 4YGDA 2ZZJA 3SH4A 3GZUC 4M0HA 2W52A 5LEKA 4FTSA 1N3PA 1RB8G 4MGYE 3MLKA 3SCHA 1XNDA 2H6CA 5JB9E 5JVZA 1QGLA 4P9JA 5A33A