3SOQA

The structure of the first ywtd beta propeller domain of lrp6 in complex with a dkk1 peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
305
structure length
305
Chain Sequence
APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/antagonist
molecule keywords Low-density lipoprotein receptor-related protein 6
total genus 80
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3soqA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3soqA01
1EPGA 4MMXB 3LC3B 3F6UL 1UZKA 2WPHE 2BOUA 1U8CB 2Y82B 1IQEL 3QH0A 1Z6CA 3SOQA 1ATDA 1F0SB 2FLRL 4RRZA 2BOKL 1OB1C 4RRXA 2I9AA 3LN0A 3KQDL 2IAQA 3HO3A 5CKMA 1FF7A 4YT6L 1IQIL 5KIRA 3KRKA 2WPLE 4D90A 1HT5A 1EPIA 2BOHA 2FLGA 2P26A 4R40A 2PUQL 1A3PA 5GX3A 4Y7AB 4ZH8B 2P16L 2DG1A 3KCGL 3DEMA 1EMNA 2XC0L 3NTBA 1P9JA 5IKTA 5GTQA 3ENSA 4XLWA 1I0UA 4Y79B 1HAFA 3Q6KA 1IGXA 2VWMK 2P94L 2VH6B 3GISX 3IITB 1Z6EL 5L2YL 2GVWA 2HQSA 3IJEB 3TGFA 2WYJB 1IQGL 1FJSL 3N8YB 1EQHA 2AYLA 1NZIA 5L30L 3S2KA 2RNLA 5GX1A 1LMJA 2KB9A 1EPJA 2F9BL 1B9WA 4M10A 2BMGA 2Y38A 3SW2A 2VVVL 4NA9L 2FPBA 3AMSA 2PHBB 5L2ZL 1N7DA 1LQDA 2CJIB 1ATEA 1EAIC 1DQBA 3I1CA 4X8SL 4A0PA 4Y76B 3A9HA 5IKRA 2BOXA 2W3KB 4JZEL 5CKNA 2VWOL 1ADXA 1RWIA 4GNAA 5JBCE 3ASIA 3G4HA 1SZBA 4ZXYL 2GHSA 3WW9A 1UZQA 5F1AA 3HS7A 1CVUA 2XBYL 3TC9A 1FFMA 5D9BA 3BT2A 1PFXL 3CA7A 3BPSE 2FPCA 4HHOA 6COXA 1COUA 2K2SB 4X8TL 2MHPA 1HX2A 4C16A 1IOEL 3KQEL 4LMFA 1JL9A 1G1TA 1IQNL 1N1IA 1YUGA 3Q3KB 1XKBA 4Z6AL 1EQGA 1G1SA 2IATA 1IQFL 1CX2A 1NFXB 4ZXXL 5JBAE 3O4PA 1YGCL 3NTGA 3EGFA 2VVUL 3HRPA 1CQEA 1DVAL 1Q4GA 2P3TA 1PRHA 2VJ3A 1FAXL 2BZ6L 2WYGB 5D9DA 2Y5HL 2W2OE 3GCXE 4YZUB 3G4EA 1NFYB 2Q1JB 4ISIL 4RS0A 2IASA 3MDLA 4BXWA 2J95B 1CRZA 2P4OA 1IVOC 1DDXA 1NQLB 1TOZA 4ZAEB 2WPKE 1CRUA 2YGPA 2BQ7A 3LIWB 1F7EA 3FW0A 4GNBA 5K0HB 4RRYA 2P3UA 2Y5FL 2FZZL 1UZPA 2OJHA 2OYUP 3OLUA 1KLJL 3NT1A 3DR2A 1HREA 1G1QA 3QMOA 4CUFA 4GN7A 3HS5A 4O5SA 2K2TA 4JMLA 1U67A 1IQLL 1F7MA 2W2QE 2ADXA 3KQCL 5JVZA 2D1JB 2JKHL 1YUFA 1WU1B 1XDTR 1E1AA 2QE8A 1APQA 2RHPA 1JBUL 1XFEA 1W8BL 3OLTA 3S8VA 2XBXL 1V04A 1P0SL 3TK6B 2GVUA 3V64C 2W3IB 4HW6A 3U7UG 3Q6TA 2WPIE 2EI6B 3TZIA 2VVCK 3KL6B 1CCVA 3E5ZA 1DX5I 2WFXB 1C5MF 1APOA 3FBYA 2VAQA 1HT8A 4JYVL 4LORA 2BQ6A 1G1RA 2XBWL 4BTTA 3V1SA 3FFGL 2J34B 4GN9A 2J2UB 1TLEA 2Y81B 2WPME 1G2MB 4PH9A 1NFWB 2Y5GL 3H5CB 4XBMA 3GCWE 5F19A 1L3YA 2XC5L 2W26B 1V3XB 1QFKL 3WWAA 1C9UA 2NPRA 1IQKL 4Y71B 5GX2A 1IQJL 1RFNB 1KSNB 3CFWA 1CVWL 4DG6A 1LPKA 1PGEA 5CISA 3LAQA 3K9XA 2UWLB 1CEJA 4Y6DB 2IAPA 1JV2B 4CUEA 3SOBB 1HAEA 4YT7L 4BDXA 4NG9L 3KQBL 4D0EA 4CUDA 1WHEA 3S94A 2EI8B 2WG3C 2IAOA 2VWLL 4IMBA 2W2NE 1W7XL 2FP8A 2GVXA 3ZYGA 2VWNL 2DDUA 3N8YA 1LPZA 2P93L 1XKAL 1GK5A 2B7DL 3LN1A 1O5DL 3LC5B 2W86A 1IQML 3U0SA 2W2ME 1Q7FA 2J4IB 4BTIA 2POOA 4CSYA 1PXXA 4E1GA 3R05A 3LI3A 2Y7ZB 3SOVA 3KYAA 1MQ6L 3CS7L 3TBDA 4BXSA 2FP9A 2OYEP 1FE2A 4Z0KB 3FCSB 4BDWA 3LI4A 4Q1UA 4OTJA 1HRFA 2UWPB 3ZYIB 3KGGA 3HO4A 1KIGL 1EPHA 2P95L 3V65B 1EZQB 2IAVA 2RA0L 5COXA 1EMOA 2W8BB 2ISMA 2XBVL 3CENL 5CKQA 2IAXA 2MGPA 4NGAL 2YGOA 4X8VL 4FM5A 4ZLRA 2DG0A 3Q6PA 5FWWA 2Y7XB 2J94B 2TGFA 2FLBL 5KN5C 4G1MB 5EX7A 2I9BA 1RWLA 3RR3A 2WFTA 1YO8A 1FSBA 2EI7B 2KV4A 3BT1A 3BYCA 3POYA 2WG4B 1LPGA 2WPJE 1AUTL 3DASA 4JYUL 4RUTA 1J9CL 3ELAL 3N8WB 3Q7DA 2P3FN 5JVYA 3N8XA 1CQ1A 2G00L 1MQ5L 3HLHA 2IAWA 1K36A 4A7IA 2XC4L 3M36L 2UWOB 3PGHA 2MGRA 2P3FL 1POOA 3U73A 1KLIL 2GVVA 1IJQA 4PWZA 1MOXC 5JB8E 1QLGA 2G8SA 1KLOA 5E8DA 1CCFA 1EGFA 3N8ZA 1L5GB 1G2LB 2M74A 2IAUA 4O1ZA 1UZJA 3NJPC 1HZ8A 1K37A 1HCGB 1NFUB 2FD6A 3AMRA 3HPTA 1ATAA 1BF9A 5EGMB 1PJXA 1YUKB 5IKQA 1NT0A 1WHFA 1IOXA 4ZHAB 1EBVA 1URKA 3A9GA 1DIYA 4HHQA 4XL1A 4O02B 4Z0LA 3F1SB 2GD4A 1IQHL 1ATBA 2J38B 4M11A 4AQTA 5I46L 3TH3L 1QBIA 4RRWA 3LTFB 2W8BA 4COXA 1H6LA 3LI5A 4TGFA 1F0RB 3N8VA 3HO5A 3KK6A 1CVMA 1HJ7A 3M37L 3HS6A 4O5TA 4JZDL 2V91A 3FVZA 2W2PE 3C9AC 3IAXA 1NPEB 5JW1A 2BQWA 3QCWA 3LTGD 2IVZA 4GNCA 4JZFL 1PTHA 4Y7BB 4MMZB 5JBBE 4BTUA 1TPGA 4MMYB 1FAKL 3ZYJB 1C5KA 3S8ZA 5D9CA 1NPEA 3MQEA 1IP0A 4GN8A 5GX4A 3SREA 2PR3B 4OTYA 4D0FA 5IKVA 2Y80B 4IYGA 2IARA 2VH0B 5JB9E 1M1XB 2DSOA 1ZAQA 3TK5B 2H9EL 3HLIA 2BO2A 1IGZA 3SRGA 3N8WA 3P5BL 5FDQA 2KL7A 1X7AL 5GX5A 4X8UL 4ISHL 2P28B
chains in the Genus database with same CATH superfamily
1EPGA 4AHAA 3B7EA 4MMXB 3LC3B 3F6UL 1UZKA 2WPHE 2AEPA 2BOUA 1XOEA 4GZQA 1U8CB 2Y82B 1IQEL 3QH0A 1Z6CA 4H52A 3SOQA 1ATDA 1F0SB 2FLRL 4RRZA 3NN9A 2VSMA 3S6XA 2BOKL 1OB1C 4RRXA 4YY8A 2I9AA 3LN0A 2YDPA 3KQDL 2IAQA 3HO3A 5CKMA 4KS5A 1FF7A 4YT6L 1IQIL 5KIRA 2F24A 1QIUA 1IUBA 4YW5A 4YW1A 4IQKA 3KRKA 2WPLE 4D90A 4AH4A 2W5NA 2F25A 1HT5A 1EPIA 2BOHA 4K1IA 2HU4A 4FOQA 2FLGA 2P26A 2W5OA 4R40A 1S1DA 4XHBA 2PUQL 1A3PA 3K39A 7NN9A 5GX3A 4Y7AB 4ZH8B 2P16L 2F29A 2DG1A 3KCGL 1F8DA 2XN4A 3DEMA 3BEQA 1EMNA 2XC0L 3NTBA 1VCJA 4C1YA 1P9JA 5IKTA 3II7A 2W38A 4IN4A 5GTQA 1NMBN 3ENSA 4XLWA 1I0UA 4Y79B 1HAFA 2VK6A 1W8OA 3Q6KA 4KS1A 2ZB5A 2H2NA 2QWEA 2VK5A 1IGXA 1NSCA 2VWMK 2P94L 2RKCA 4L7CA 4B7RA 2VH6B 1Z4XA 4YZ4A 2H2UA 3GISX 1NCDN 3IITB 1OFZA 1Z6EL 5L2YL 2GVWA 4KS4A 4FPHA 3TICA 2HQSA 3IJEB 3D11A 1E8VA 3TGFA 2WOZA 1V2IA 2WYJB 1X2JA 1IQGL 1FJSL 3N8YB 2F0ZA 1EQHA 2AYLA 4WA4A 1NZIA 4GZXA 3INBA 5L30L 3S2KA 3TIBA 2RNLA 2WZPP 1WP5A 4MJUA 4YW3A 5GX1A 1LMJA 1NCBN 4MWWA 2BT8A 2KB9A 1EPJA 2F9BL 1B9WA 2BMGA 2H9EC 2Y38A 4M10A 4XMAA 3WDZA 3SW2A 2VVVL 4NA9L 2YA6A 2VW2A 2FPBA 3AMSA 2PHBB 5L2ZL 2A75A 4CSDA 1N7DA 1LQDA 2CJIB 1E8TA 1ATEA 1EAIC 4MWUA 1DQBA 1SUUA 4MWYA 3I1CA 4X8SL 1USRA 4A0PA 1LK9A 4Y76B 1N1TA 3A9HA 5EO8A 1X2RA 2AGSA 2BSFA 1ZGKA 4FVKA 5IKRA 1N6EA 4XHXA 1N1SA 2XCYA 2BOXA 3GVJA 2W3KB 3NSSA 4JZEL 3TI8A 1MS0A 1V0FA 5CKNA 1V1HA 2VWOL 2QWJA 1ADXA 1MS8A 1RWIA 4GDJA 4XJZA 2QWFA 5JBCE 3ASIA 3G4HA 1SZBA 4ZXYL 4GNAA 2GHSA 4L7BA 1UZQA 3WW9A 5F1AA 4K1KA 3HS7A 3H71A 5M1ZA 1CVUA 1ZI0A 4GEZA 5HUNA 2XBYL 1Z4VA 3TC9A 1FFMA 2HT7A 5D9BA 2VK7A 3BT2A 1PFXL 3CA7A 3BPSE 1MS5A 2BERA 4XILA 1INVA 3A71A 2FPCA 4HHOA 1IVCA 6COXA 3GVLA 1COUA 4CHBA 2K2SB 4QNPA 4X8TL 4WA3A 5CGJA 2MHPA 4MZEA 1HX2A 4XJ8A 5FNQA 4D4UA 4X49A 4C16A 1IOEL 4XJUA 3KQEL 4LMFA 1JL9A 1G1TA 4CPZA 1IQNL 1N1IA 1YUGA 2F10A 3Q3KB 1MS3A 1XKBA 4Z6AL 1EQGA 1G1SA 4DGRA 3T1EA 2IATA 4B7JA 1IQFL 1CX2A 1NFXB 4GU3A 4ZXXL 5JBAE 1EUUA 1MZ6A 3O4PA 5FNUA 1YGCL 4B7MA 3NTGA 1F8CA 3EGFA 4HZXA 2VVUL 3HRPA 1L7GA 1CQEA 2CMLA 4NN9A 1DVAL 1SLIA 4XMIA 1Q4GA 5FNSA 5B2CA 4SLIA 2P3TA 1INWA 1PRHA 2VJ3A 1FAXL 2BZ6L 2WYGB 2IAXA 2VSKA 2Y5HL 4HZZA 5D9DA 2W2OE 3OPZA 3GCXE 4YZUB 3G4EA 1NFYB 1MS9A 2Q1JB 4ISIL 4RS0A 2IASA 2HTYA 5NN9A 3TIAA 2HORA 3MDLA 4BXWA 1N6DA 2J95B 1CRZA 1SNTA 2BZDA 2HU0A 2P4OA 4QN5A 1IVOC 1DDXA 2HTUA 4H53A 1NQLB 1TOZA 2YGQA 4ZAEB 4YZ3A 2WPKE 1CRUA 2YGPA 2BQ7A 3LIWB 1F7EA 3FW0A 4GNBA 4XIKA 5K0HB 4RRYA 2P3UA 2Y5FL 4HZVA 2FZZL 1UZPA 2OJHA 2OYUP 3OLUA 1KLJL 1V3BA 5F9TA 2B8HA 4FPGA 3NT1A 3DR2A 4MWLA 4X4AA 1HREA 3O9JA 1G1QA 1W21A 3QMOA 4CUFA 4GN7A 4XJAA 3HS5A 4O5SA 2K2TA 4JMLA 3NO0A 1U67A 1IQLL 1F7MA 2W2QE 2ADXA 3KQCL 5JVZA 2D1JB 4AGIA 2JKHL 2F11A 1YUFA 1V1IA 1WU1B 4YZ1A 1XDTR 1E1AA 2QE8A 1APQA 4MX0A 2RHPA 4FZHA 4FP2A 4YZ5A 1IVFA 1SO7A 1JBUL 4FOYA 1XFEA 5B2DA 1W8BL 3OLTA 3S8VA 2XBXL 1V04A 4I00A 1P0SL 3TK6B 2GVUA 3SILA 3V64C 2W3IB 3ALXA 4HW6A 2QWCA 3U7UG 1INHA 1IUCA 2WPIE 2F27A 2EI6B 3Q6TA 3TZIA 2VVCK 2VVZA 3KL6B 4XIOA 4UF7A 1CCVA 3E5ZA 2ZWAA 4KS3A 1V0ZA 1DX5I 4CPOA 2WFXB 1C5MF 1APOA 4UOUA 4AGTA 1S0JA 3FBYA 1NN2A 2VAQA 1HT8A 2KNIA 4JYVL 4MWXA 1U6DX 4LORA 2BQ6A 1G1RA 2XBWL 4BTTA 2X9MA 1EUSA 3FFGL 2ZW9A 2J34B 3V1SA 4GN9A 2J2UB 1TLEA 2Y81B 2WPME 1G2MB 4PH9A 1NFWB 5JYYA 2YDTA 2Y5GL 3H5CB 2BT7A 4GDIA 2F13A 4XBMA 1W8NA 3GCWE 5F19A 1L3YA 3O9KA 2XC5L 2W26B 1V3XB 3UC1A 3H72A 1QFKL 4XOGA 3WWAA 1INXA 1C9UA 2NPRA 1IQKL 4Y71B 1N1YA 1NMCA 1Z4WA 1IQJL 5GX2A 3VNHA 2AEQA 4CPLA 4GZWA 1RFNB 1KSNB 3CFWA 1A14N 1CVWL 2ZB6A 4DG6A 2SLIA 4NCSA 4MC7A 2XZJA 4JF7A 1LPKA 1PGEA 3VNGA 1LMMA 5CISA 3LAQA 1EURA 1NNBA 3K9XA 2UWLB 1F8EA 3ALWA 4M4NA 1CEJA 4Y6DB 4FPJA 5FZJA 2IAPA 1JV2B 4CUEA 3SOBB 1HAEA 4YT7L 1W0OA 4BDXA 4G3NA 4NG9L 3KQBL 4D0EA 4CUDA 3W09A 1WHEA 2BATA 2ZZKA 1NCCN 3S94A 2QWBA 3B69A 4A94C 1DILA 2EI8B 1B9VA 2WG3C 3L6VA 2W20A 1B9SA 2IAOA 5FZNA 2VWLL 4IMBA 2W2NE 1W7XL 2FP8A 2GVXA 1INFA 3ZYGA 4MWJA 2VWNL 3K36A 3A72A 2DDUA 4Q6KA 3N8YA 1LPZA 2VRSA 2HTRA 2AH2A 2P93L 1XKAL 1GK5A 2B7DL 3LN1A 1O5DL 4GZPA 2HT5A 4MZAA 2VPJA 2VW1A 3LC5B 4QN7A 2W86A 1IQML 4MJVA 3U0SA 2QWHA 2QWIA 2W2ME 4QN6A 1Q7FA 1IVDA 3ADEA 2J4IB 4FPLA 4BTIA 2POOA 4CSYA 1PXXA 1Z4YA 1USXA 4E1GA 3R05A 4GZTA 4HZYA 1W0PA 2VWDA 4XMBA 3LI3A 2Y7ZB 3SOVA 1SLLA 1MQ6L 3KYAA 3CS7L 4YZ2A 4IFLX 3PJQA 3TBDA 1S0IA 5HUMA 2SILA 4BXSA 2FP9A 2OYEP 1FE2A 1Z50A 3JU4A 4Z0KB 3FCSB 4BDWA 5HX0A 3LI4A 2SIMA 4D52B 1IVEA 4QN3A 1KKEA 1KITA 4Q1UA 4OTJA 4WEFA 5HUGA 1HRFA 2UWPB 3ZYIB 1MR5A 3KGGA 5H47A 3HO4A 1KIGL 1EPHA 2P95L 3V65B 1L7FA 1EZQB 4XJQA 4ZY3A 2IAVA 2HTQA 2RA0L 5COXA 1EMOA 2W8BB 4FPKA 4IFJA 2ISMA 2XBVL 3CENL 5CKQA 1BJIA 2MGPA 1WCQA 4NGAL 2YGOA 4X8VL 4FM5A 2HTVA 4ZLRA 2DG0A 3Q6PA 5FWWA 2Y7XB 4GJTA 2J94B 1NNCA 4K1HA 2TGFA 1Z4ZA 2FLBL 1IVGA 5KN5C 4G1MB 5EX7A 2I9BA 1RWLA 3RR3A 4XJRA 2WFTA 1YO8A 4J9TA 1V3DA 1FSBA 2EI7B 2KV4A 3BT1A 2F28A 3BYCA 1IVBA 3POYA 4CPNA 2WG4B 1MWEA 1LPGA 4D8SA 2WPJE 2QWDA 3CL0A 1AUTL 3TI3A 3DASA 4JYUL 4RUTA 1J9CL 3ELAL 3N8WB 3Q7DA 5F72C 2P3FN 5JVYA 4FPCA 3N8XA 1CQ1A 2XZIA 3H73A 3CL2A 4D52C 2G00L 1MQ5L 3HLHA 2IAWA 1K36A 4A7IA 1INGA 1K32A 2XC4L 3M36L 2UWOB 3PGHA 2MGRA 2P3FL 1POOA 2Z32A 3U73A 4B7QA 4MWVA 2FLUX 2HOXA 1KLIL 2YA4A 3H6JA 4M3MA 2GVVA 5FNTA 1IJQA 4FOWA 4XJWA 4PWZA 1MOXC 2QWGA 2VW0A 5JB8E 1QLGA 2G8SA 1NSBA 1KLOA 2JKBA 5E8DA 4X47A 1CCFA 1EGFA 3N8ZA 1L5GB 1G2LB 2M74A 1N6FA 2F26A 4K1JA 2IAUA 4K3YA 4O1ZA 3CYEA 4M4VA 4FPEA 1UZJA 3D12A 3NJPC 1HZ8A 1K37A 3ZGCA 1WCSA 1HCGB 1NFUB 2FD6A 1A4GA 3HPTA 1MZ5A 3AMRA 1ATAA 1BF9A 2F12A 1V3EA 5EGMB 1PJXA 4GZSA 1B9TA 4D52A 1YUKB 5IKQA 1NT0A 1WHFA 4XE9A 1IOXA 1S18A 4ZHAB 2FHRA 1EBVA 1F8BA 1URKA 2DYHA 2HTWA 3A9GA 1DIYA 4XJ9A 3TI4A 4B7NA 4HHQA 4XL1A 1XOGA 6NN9A 4MWRA 2YA7A 3TI6A 4O02B 1W20A 2XZKA 4GZOA 4Z0LA 4YW4A 3SLIA 4GU4A 3F1SB 3K37A 4GB1A 4QN4A 5EO7A 2GD4A 1V3CA 1IQHL 1ATBA 2J38B 4M11A 4AQTA 4FOVA 5I46L 3TH3L 4ASCA 1NSDA 1A4QA 1QBIA 5HUKA 4RRWA 2JJLA 3LTFB 1EUTA 2W8BA 4CPYA 2YA5A 4COXA 1H6LA 3LI5A 4TGFA 4FP3A 1F0RB 3N8VA 4FQ4A 3SANA 2C4AA 3HO5A 4MWQA 3KK6A 4KS2A 1CVMA 4NC5A 3GVKA 4X6KA 1HJ7A 3M37L 3HS6A 4O5TA 4C1YB 4JZDL 2V91A 3FVZA 4WEGA 2W2PE 3C9AC 3IAXA 1NPEB 1VCUA 5JW1A 2BQWA 1N1VA 3QCWA 2BF6A 3LTGD 2C4LA 2IVZA 4GNCA 1INYA 4HIZA 4JZFL 1PTHA 4Y7BB 4MMZB 2QWAA 3TI5A 5JBBE 4BTUA 3WN7A 1TPGA 5FNRA 4FPFA 4MMYB 4ZGCA 3K38A 2QWKA 1FAKL 3ZYJB 4XYXA 1C5KA 4CPMA 3K3AA 4N1BA 3S8ZA 5D9CA 4BBWA 1NPEA 3MQEA 1IP0A 4GN8A 5GX4A 1NCAN 3SREA 2PR3B 4OTYA 4D0FA 5IKVA 2Y80B 1E8UA 3ZGDA 1V0EA 4M4UA 1MS1A 2YA8A 3CKZA 4IYGA 4L7DA 4YW2A 4CH9A 1DIMA 2IARA 4FPOB 2VH0B 4HZWA 5JB9E 3SALA 1M1XB 2DSOA 1L7HA 1ZAQA 2HT8A 3TK5B 1NNAA 2H9EL 3HLIA 2BO2A 4FJ6A 4FPYA 4IFNX 1IGZA 1NMAN 3SRGA 3N8WA 3P5BL 5FDQA 2KL7A 1X7AL 5GX5A 4X8UL 1MS4A 1W1XA 4ISHL 2P28B 4WA5A
chains in the Genus database with same CATH topology
1EPGA 4MMXB 3LC3B 3F6UL 1UZKA 2WPHE 2BOUA 1U8CB 2Y82B 1IQEL 3QH0A 1Z6CA 3SOQA 1ATDA 1F0SB 2FLRL 4RRZA 3S6XA 2BOKL 1OB1C 4RRXA 2I9AA 3LN0A 3KQDL 2IAQA 3HO3A 5CKMA 1FF7A 4YT6L 1IQIL 5KIRA 3KRKA 2WPLE 4D90A 1HT5A 1EPIA 2BOHA 2FLGA 2P26A 4R40A 2PUQL 1A3PA 5GX3A 4Y7AB 4ZH8B 2P16L 2DG1A 3KCGL 3DEMA 1EMNA 2XC0L 3NTBA 1P9JA 5IKTA 5GTQA 3ENSA 4XLWA 1I0UA 4Y79B 1HAFA 3Q6KA 1IGXA 2VWMK 2P94L 2VH6B 3GISX 3IITB 1Z6EL 5L2YL 2GVWA 2HQSA 3IJEB 3TGFA 2WYJB 1IQGL 1FJSL 3N8YB 1EQHA 2AYLA 1NZIA 5L30L 3S2KA 2RNLA 2WZPP 5GX1A 1LMJA 2KB9A 1EPJA 2F9BL 1B9WA 4M10A 2BMGA 2H9EC 2Y38A 3SW2A 2VVVL 4NA9L 2FPBA 3AMSA 2PHBB 5L2ZL 1N7DA 1LQDA 2CJIB 1ATEA 1EAIC 1DQBA 3I1CA 4X8SL 4A0PA 4Y76B 3A9HA 5IKRA 2BOXA 2W3KB 4JZEL 5CKNA 2VWOL 1ADXA 1RWIA 4GNAA 5JBCE 3ASIA 3G4HA 1SZBA 4ZXYL 2GHSA 3WW9A 1UZQA 5F1AA 3HS7A 1CVUA 2XBYL 3TC9A 1FFMA 5D9BA 3BT2A 1PFXL 3CA7A 3BPSE 2FPCA 4HHOA 6COXA 1COUA 2K2SB 4X8TL 2MHPA 1HX2A 4C16A 1IOEL 3KQEL 4LMFA 1JL9A 1G1TA 1IQNL 1N1IA 1YUGA 3Q3KB 1XKBA 4Z6AL 1EQGA 1G1SA 2IATA 1IQFL 1CX2A 1NFXB 4ZXXL 5JBAE 3O4PA 1YGCL 3NTGA 3EGFA 2VVUL 3HRPA 1CQEA 1DVAL 1Q4GA 2P3TA 1PRHA 2VJ3A 1FAXL 2BZ6L 2WYGB 5D9DA 2Y5HL 2W2OE 3GCXE 4YZUB 3G4EA 1NFYB 2Q1JB 4ISIL 4RS0A 2IASA 3MDLA 4BXWA 2J95B 1CRZA 2P4OA 1IVOC 1DDXA 1NQLB 1TOZA 2YGQA 4ZAEB 2WPKE 1CRUA 2YGPA 2BQ7A 3LIWB 1F7EA 3FW0A 4GNBA 5K0HB 4RRYA 2P3UA 2Y5FL 2FZZL 1UZPA 2OJHA 2OYUP 3OLUA 1KLJL 3NT1A 3DR2A 1HREA 1G1QA 3QMOA 4CUFA 4GN7A 3HS5A 4O5SA 2K2TA 4JMLA 1U67A 1IQLL 1F7MA 2W2QE 2ADXA 3KQCL 5JVZA 2D1JB 2JKHL 1YUFA 1WU1B 1XDTR 1E1AA 2QE8A 1APQA 2RHPA 1JBUL 1XFEA 1W8BL 3OLTA 3S8VA 2XBXL 1V04A 1P0SL 3TK6B 2GVUA 3V64C 2W3IB 4HW6A 3U7UG 3Q6TA 2WPIE 2EI6B 3TZIA 2VVCK 3KL6B 1CCVA 3E5ZA 1DX5I 2WFXB 1C5MF 1APOA 3FBYA 2VAQA 1HT8A 2KNIA 4JYVL 4LORA 2BQ6A 1G1RA 2XBWL 4BTTA 3V1SA 3FFGL 2J34B 4GN9A 2J2UB 1TLEA 2Y81B 2WPME 1G2MB 4PH9A 1NFWB 2Y5GL 3H5CB 4XBMA 3GCWE 5F19A 1L3YA 2XC5L 2W26B 1V3XB 1QFKL 3WWAA 1C9UA 2NPRA 1IQKL 4Y71B 5GX2A 1IQJL 1RFNB 1KSNB 3CFWA 1CVWL 4DG6A 1LPKA 1PGEA 1LMMA 5CISA 3LAQA 3K9XA 2UWLB 1CEJA 4Y6DB 2IAPA 1JV2B 4CUEA 3SOBB 1HAEA 4YT7L 4BDXA 4NG9L 3KQBL 4D0EA 4CUDA 1WHEA 3S94A 4A94C 2EI8B 2WG3C 2IAOA 2VWLL 4IMBA 2W2NE 1W7XL 2FP8A 2GVXA 3ZYGA 2VWNL 2DDUA 3N8YA 1LPZA 2P93L 1XKAL 1GK5A 2B7DL 3LN1A 1O5DL 3LC5B 2W86A 1IQML 3U0SA 2W2ME 1Q7FA 2J4IB 4BTIA 2POOA 4CSYA 1PXXA 4E1GA 3R05A 3LI3A 2Y7ZB 3SOVA 3KYAA 1MQ6L 3CS7L 3TBDA 4BXSA 2FP9A 2OYEP 1FE2A 4Z0KB 3FCSB 4BDWA 3LI4A 4Q1UA 4OTJA 1HRFA 2UWPB 3ZYIB 3KGGA 3HO4A 1KIGL 1EPHA 2P95L 3V65B 1EZQB 2IAVA 2RA0L 5COXA 1EMOA 2W8BB 2ISMA 2XBVL 3CENL 5CKQA 2IAXA 2MGPA 4NGAL 2YGOA 4X8VL 4FM5A 4ZLRA 2DG0A 3Q6PA 5FWWA 2Y7XB 2J94B 2TGFA 2FLBL 5KN5C 4G1MB 5EX7A 2I9BA 1RWLA 3RR3A 2WFTA 1YO8A 1FSBA 2EI7B 2KV4A 3BT1A 3BYCA 3POYA 2WG4B 1LPGA 2WPJE 1AUTL 3DASA 4JYUL 4RUTA 1J9CL 3ELAL 3N8WB 3Q7DA 2P3FN 5JVYA 3N8XA 1CQ1A 2G00L 1MQ5L 3HLHA 2IAWA 1K36A 4A7IA 2XC4L 3M36L 2UWOB 3PGHA 2MGRA 2P3FL 1POOA 3U73A 1KLIL 2GVVA 1IJQA 4PWZA 1MOXC 5JB8E 1QLGA 2G8SA 1KLOA 5E8DA 1CCFA 1EGFA 3N8ZA 1L5GB 1G2LB 2M74A 2IAUA 4O1ZA 1UZJA 3NJPC 1HZ8A 1K37A 1HCGB 1NFUB 2FD6A 3AMRA 3HPTA 1ATAA 1BF9A 5EGMB 1PJXA 1YUKB 5IKQA 1NT0A 1WHFA 1IOXA 4ZHAB 1EBVA 1URKA 3A9GA 1DIYA 4HHQA 4XL1A 4O02B 4Z0LA 3F1SB 2GD4A 1IQHL 1ATBA 2J38B 4M11A 4AQTA 5I46L 3TH3L 1QBIA 4RRWA 3LTFB 2W8BA 4COXA 1H6LA 3LI5A 4TGFA 1F0RB 3N8VA 3HO5A 3KK6A 1CVMA 1HJ7A 3M37L 3HS6A 4O5TA 4JZDL 2V91A 3FVZA 2W2PE 3C9AC 3IAXA 1NPEB 5JW1A 2BQWA 3QCWA 3LTGD 2IVZA 4GNCA 4JZFL 1PTHA 4Y7BB 4MMZB 5JBBE 4BTUA 1TPGA 4MMYB 1FAKL 3ZYJB 1C5KA 3S8ZA 5D9CA 1NPEA 3MQEA 1IP0A 4GN8A 5GX4A 3SREA 2PR3B 4OTYA 4D0FA 5IKVA 2Y80B 4IYGA 2IARA 2VH0B 5JB9E 1M1XB 2DSOA 1ZAQA 3TK5B 2H9EL 3HLIA 2BO2A 1IGZA 3SRGA 3N8WA 3P5BL 5FDQA 2KL7A 1X7AL 5GX5A 4X8UL 4ISHL 2P28B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EPG A;  4MMX B;  3LC3 B;  3F6U L;  1UZK A;  2WPH E;  2BOU A;  1U8C B;  2Y82 B;  1IQE L;  3QH0 A;  1Z6C A;  3SOQ A;  1ATD A;  1F0S B;  2FLR L;  4RRZ A;  2BOK L;  1OB1 C;  4RRX A;  2I9A A;  3LN0 A;  3KQD L;  2IAQ A;  3HO3 A;  5CKM A;  1FF7 A;  4YT6 L;  1IQI L;  5KIR A;  3KRK A;  2WPL E;  4D90 A;  1HT5 A;  1EPI A;  2BOH A;  2FLG A;  2P26 A;  4R40 A;  2PUQ L;  1A3P A;  5GX3 A;  4Y7A B;  4ZH8 B;  2P16 L;  2DG1 A;  3KCG L;  3DEM A;  1EMN A;  2XC0 L;  3NTB A;  1P9J A;  5IKT A;  5GTQ A;  3ENS A;  4XLW A;  1I0U A;  4Y79 B;  1HAF A;  3Q6K A;  1IGX A;  2VWM K;  2P94 L;  2VH6 B;  3GIS X;  3IIT B;  1Z6E L;  5L2Y L;  2GVW A;  2HQS A;  3IJE B;  3TGF A;  2WYJ B;  1IQG L;  1FJS L;  3N8Y B;  1EQH A;  2AYL A;  1NZI A;  5L30 L;  3S2K A;  2RNL A;  5GX1 A;  1LMJ A;  2KB9 A;  1EPJ A;  2F9B L;  1B9W A;  4M10 A;  2BMG A;  2Y38 A;  3SW2 A;  2VVV L;  4NA9 L;  2FPB A;  3AMS A;  2PHB B;  5L2Z L;  1N7D A;  1LQD A;  2CJI B;  1ATE A;  1EAI C;  1DQB A;  3I1C A;  4X8S L;  4A0P A;  4Y76 B;  3A9H A;  5IKR A;  2BOX A;  2W3K B;  4JZE L;  5CKN A;  2VWO L;  1ADX A;  1RWI A;  4GNA A;  5JBC E;  3ASI A;  3G4H A;  1SZB A;  4ZXY L;  2GHS A;  3WW9 A;  1UZQ A;  5F1A A;  3HS7 A;  1CVU A;  2XBY L;  3TC9 A;  1FFM A;  5D9B A;  3BT2 A;  1PFX L;  3CA7 A;  3BPS E;  2FPC A;  4HHO A;  6COX A;  1COU A;  2K2S B;  4X8T L;  2MHP A;  1HX2 A;  4C16 A;  1IOE L;  3KQE L;  4LMF A;  1JL9 A;  1G1T A;  1IQN L;  1N1I A;  1YUG A;  3Q3K B;  1XKB A;  4Z6A L;  1EQG A;  1G1S A;  2IAT A;  1IQF L;  1CX2 A;  1NFX B;  4ZXX L;  5JBA E;  3O4P A;  1YGC L;  3NTG A;  3EGF A;  2VVU L;  3HRP A;  1CQE A;  1DVA L;  1Q4G A;  2P3T A;  1PRH A;  2VJ3 A;  1FAX L;  2BZ6 L;  2WYG B;  5D9D A;  2Y5H L;  2W2O E;  3GCX E;  4YZU B;  3G4E A;  1NFY B;  2Q1J B;  4ISI L;  4RS0 A;  2IAS A;  3MDL A;  4BXW A;  2J95 B;  1CRZ A;  2P4O A;  1IVO C;  1DDX A;  1NQL B;  1TOZ A;  4ZAE B;  2WPK E;  1CRU A;  2YGP A;  2BQ7 A;  3LIW B;  1F7E A;  3FW0 A;  4GNB A;  5K0H B;  4RRY A;  2P3U A;  2Y5F L;  2FZZ L;  1UZP A;  2OJH A;  2OYU P;  3OLU A;  1KLJ L;  3NT1 A;  3DR2 A;  1HRE A;  1G1Q A;  3QMO A;  4CUF A;  4GN7 A;  3HS5 A;  4O5S A;  2K2T A;  4JML A;  1U67 A;  1IQL L;  1F7M A;  2W2Q E;  2ADX A;  3KQC L;  5JVZ A;  2D1J B;  2JKH L;  1YUF A;  1WU1 B;  1XDT R;  1E1A A;  2QE8 A;  1APQ A;  2RHP A;  1JBU L;  1XFE A;  1W8B L;  3OLT A;  3S8V A;  2XBX L;  1V04 A;  1P0S L;  3TK6 B;  2GVU A;  3V64 C;  2W3I B;  4HW6 A;  3U7U G;  3Q6T A;  2WPI E;  2EI6 B;  3TZI A;  2VVC K;  3KL6 B;  1CCV A;  3E5Z A;  1DX5 I;  2WFX B;  1C5M F;  1APO A;  3FBY A;  2VAQ A;  1HT8 A;  4JYV L;  4LOR A;  2BQ6 A;  1G1R A;  2XBW L;  4BTT A;  3V1S A;  3FFG L;  2J34 B;  4GN9 A;  2J2U B;  1TLE A;  2Y81 B;  2WPM E;  1G2M B;  4PH9 A;  1NFW B;  2Y5G L;  3H5C B;  4XBM A;  3GCW E;  5F19 A;  1L3Y A;  2XC5 L;  2W26 B;  1V3X B;  1QFK L;  3WWA A;  1C9U A;  2NPR A;  1IQK L;  4Y71 B;  5GX2 A;  1IQJ L;  1RFN B;  1KSN B;  3CFW A;  1CVW L;  4DG6 A;  1LPK A;  1PGE A;  5CIS A;  3LAQ A;  3K9X A;  2UWL B;  1CEJ A;  4Y6D B;  2IAP A;  1JV2 B;  4CUE A;  3SOB B;  1HAE A;  4YT7 L;  4BDX A;  4NG9 L;  3KQB L;  4D0E A;  4CUD A;  1WHE A;  3S94 A;  2EI8 B;  2WG3 C;  2IAO A;  2VWL L;  4IMB A;  2W2N E;  1W7X L;  2FP8 A;  2GVX A;  3ZYG A;  2VWN L;  2DDU A;  3N8Y A;  1LPZ A;  2P93 L;  1XKA L;  1GK5 A;  2B7D L;  3LN1 A;  1O5D L;  3LC5 B;  2W86 A;  1IQM L;  3U0S A;  2W2M E;  1Q7F A;  2J4I B;  4BTI A;  2POO A;  4CSY A;  1PXX A;  4E1G A;  3R05 A;  3LI3 A;  2Y7Z B;  3SOV A;  3KYA A;  1MQ6 L;  3CS7 L;  3TBD A;  4BXS A;  2FP9 A;  2OYE P;  1FE2 A;  4Z0K B;  3FCS B;  4BDW A;  3LI4 A;  4Q1U A;  4OTJ A;  1HRF A;  2UWP B;  3ZYI B;  3KGG A;  3HO4 A;  1KIG L;  1EPH A;  2P95 L;  3V65 B;  1EZQ B;  2IAV A;  2RA0 L;  5COX A;  1EMO A;  2W8B B;  2ISM A;  2XBV L;  3CEN L;  5CKQ A;  2IAX A;  2MGP A;  4NGA L;  2YGO A;  4X8V L;  4FM5 A;  4ZLR A;  2DG0 A;  3Q6P A;  5FWW A;  2Y7X B;  2J94 B;  2TGF A;  2FLB L;  5KN5 C;  4G1M B;  5EX7 A;  2I9B A;  1RWL A;  3RR3 A;  2WFT A;  1YO8 A;  1FSB A;  2EI7 B;  2KV4 A;  3BT1 A;  3BYC A;  3POY A;  2WG4 B;  1LPG A;  2WPJ E;  1AUT L;  3DAS A;  4JYU L;  4RUT A;  1J9C L;  3ELA L;  3N8W B;  3Q7D A;  2P3F N;  5JVY A;  3N8X A;  1CQ1 A;  2G00 L;  1MQ5 L;  3HLH A;  2IAW A;  1K36 A;  4A7I A;  2XC4 L;  3M36 L;  2UWO B;  3PGH A;  2MGR A;  2P3F L;  1POO A;  3U73 A;  1KLI L;  2GVV A;  1IJQ A;  4PWZ A;  1MOX C;  5JB8 E;  1QLG A;  2G8S A;  1KLO A;  5E8D A;  1CCF A;  1EGF A;  3N8Z A;  1L5G B;  1G2L B;  2M74 A;  2IAU A;  4O1Z A;  1UZJ A;  3NJP C;  1HZ8 A;  1K37 A;  1HCG B;  1NFU B;  2FD6 A;  3AMR A;  3HPT A;  1ATA A;  1BF9 A;  5EGM B;  1PJX A;  1YUK B;  5IKQ A;  1NT0 A;  1WHF A;  1IOX A;  4ZHA B;  1EBV A;  1URK A;  3A9G A;  1DIY A;  4HHQ A;  4XL1 A;  4O02 B;  4Z0L A;  3F1S B;  2GD4 A;  1IQH L;  1ATB A;  2J38 B;  4M11 A;  4AQT A;  5I46 L;  3TH3 L;  1QBI A;  4RRW A;  3LTF B;  2W8B A;  4COX A;  1H6L A;  3LI5 A;  4TGF A;  1F0R B;  3N8V A;  3HO5 A;  3KK6 A;  1CVM A;  1HJ7 A;  3M37 L;  3HS6 A;  4O5T A;  4JZD L;  2V91 A;  3FVZ A;  2W2P E;  3C9A C;  3IAX A;  1NPE B;  5JW1 A;  2BQW A;  3QCW A;  3LTG D;  2IVZ A;  4GNC A;  4JZF L;  1PTH A;  4Y7B B;  4MMZ B;  5JBB E;  4BTU A;  1TPG A;  4MMY B;  1FAK L;  3ZYJ B;  1C5K A;  3S8Z A;  5D9C A;  1NPE A;  3MQE A;  1IP0 A;  4GN8 A;  5GX4 A;  3SRE A;  2PR3 B;  4OTY A;  4D0F A;  5IKV A;  2Y80 B;  4IYG A;  2IAR A;  2VH0 B;  5JB9 E;  1M1X B;  2DSO A;  1ZAQ A;  3TK5 B;  2H9E L;  3HLI A;  2BO2 A;  1IGZ A;  3SRG A;  3N8W A;  3P5B L;  5FDQ A;  2KL7 A;  1X7A L;  5GX5 A;  4X8U L;  4ISH L;  2P28 B; 
#chains in the Genus database with same CATH topology
 1EPG A;  4AHA A;  3B7E A;  4MMX B;  3LC3 B;  3F6U L;  1UZK A;  2WPH E;  2AEP A;  2BOU A;  1XOE A;  4GZQ A;  1U8C B;  2Y82 B;  1IQE L;  3QH0 A;  1Z6C A;  4H52 A;  3SOQ A;  1ATD A;  1F0S B;  2FLR L;  4RRZ A;  3NN9 A;  2VSM A;  3S6X A;  2BOK L;  1OB1 C;  4RRX A;  4YY8 A;  2I9A A;  3LN0 A;  2YDP A;  3KQD L;  2IAQ A;  3HO3 A;  5CKM A;  4KS5 A;  1FF7 A;  4YT6 L;  1IQI L;  5KIR A;  2F24 A;  1QIU A;  1IUB A;  4YW5 A;  4YW1 A;  4IQK A;  3KRK A;  2WPL E;  4D90 A;  4AH4 A;  2W5N A;  2F25 A;  1HT5 A;  1EPI A;  2BOH A;  4K1I A;  2HU4 A;  4FOQ A;  2FLG A;  2P26 A;  2W5O A;  4R40 A;  1S1D A;  4XHB A;  2PUQ L;  1A3P A;  3K39 A;  7NN9 A;  5GX3 A;  4Y7A B;  4ZH8 B;  2P16 L;  2F29 A;  2DG1 A;  3KCG L;  1F8D A;  2XN4 A;  3DEM A;  3BEQ A;  1EMN A;  2XC0 L;  3NTB A;  1VCJ A;  4C1Y A;  1P9J A;  5IKT A;  3II7 A;  2W38 A;  4IN4 A;  5GTQ A;  1NMB N;  3ENS A;  4XLW A;  1I0U A;  4Y79 B;  1HAF A;  2VK6 A;  1W8O A;  3Q6K A;  4KS1 A;  2ZB5 A;  2H2N A;  2QWE A;  2VK5 A;  1IGX A;  1NSC A;  2VWM K;  2P94 L;  2RKC A;  4L7C A;  4B7R A;  2VH6 B;  1Z4X A;  4YZ4 A;  2H2U A;  3GIS X;  1NCD N;  3IIT B;  1OFZ A;  1Z6E L;  5L2Y L;  2GVW A;  4KS4 A;  4FPH A;  3TIC A;  2HQS A;  3IJE B;  3D11 A;  1E8V A;  3TGF A;  2WOZ A;  1V2I A;  2WYJ B;  1X2J A;  1IQG L;  1FJS L;  3N8Y B;  2F0Z A;  1EQH A;  2AYL A;  4WA4 A;  1NZI A;  4GZX A;  3INB A;  5L30 L;  3S2K A;  3TIB A;  2RNL A;  2WZP P;  1WP5 A;  4MJU A;  4YW3 A;  5GX1 A;  1LMJ A;  1NCB N;  4MWW A;  2BT8 A;  2KB9 A;  1EPJ A;  2F9B L;  1B9W A;  2BMG A;  2H9E C;  2Y38 A;  4M10 A;  4XMA A;  3WDZ A;  3SW2 A;  2VVV L;  4NA9 L;  2YA6 A;  2VW2 A;  2FPB A;  3AMS A;  2PHB B;  5L2Z L;  2A75 A;  4CSD A;  1N7D A;  1LQD A;  2CJI B;  1E8T A;  1ATE A;  1EAI C;  4MWU A;  1DQB A;  1SUU A;  4MWY A;  3I1C A;  4X8S L;  1USR A;  4A0P A;  1LK9 A;  4Y76 B;  1N1T A;  3A9H A;  5EO8 A;  1X2R A;  2AGS A;  2BSF A;  1ZGK A;  4FVK A;  5IKR A;  1N6E A;  4XHX A;  1N1S A;  2XCY A;  2BOX A;  3GVJ A;  2W3K B;  3NSS A;  4JZE L;  3TI8 A;  1MS0 A;  1V0F A;  5CKN A;  1V1H A;  2VWO L;  2QWJ A;  1ADX A;  1MS8 A;  1RWI A;  4GDJ A;  4XJZ A;  2QWF A;  5JBC E;  3ASI A;  3G4H A;  1SZB A;  4ZXY L;  4GNA A;  2GHS A;  4L7B A;  1UZQ A;  3WW9 A;  5F1A A;  4K1K A;  3HS7 A;  3H71 A;  5M1Z A;  1CVU A;  1ZI0 A;  4GEZ A;  5HUN A;  2XBY L;  1Z4V A;  3TC9 A;  1FFM A;  2HT7 A;  5D9B A;  2VK7 A;  3BT2 A;  1PFX L;  3CA7 A;  3BPS E;  1MS5 A;  2BER A;  4XIL A;  1INV A;  3A71 A;  2FPC A;  4HHO A;  1IVC A;  6COX A;  3GVL A;  1COU A;  4CHB A;  2K2S B;  4QNP A;  4X8T L;  4WA3 A;  5CGJ A;  2MHP A;  4MZE A;  1HX2 A;  4XJ8 A;  5FNQ A;  4D4U A;  4X49 A;  4C16 A;  1IOE L;  4XJU A;  3KQE L;  4LMF A;  1JL9 A;  1G1T A;  4CPZ A;  1IQN L;  1N1I A;  1YUG A;  2F10 A;  3Q3K B;  1MS3 A;  1XKB A;  4Z6A L;  1EQG A;  1G1S A;  4DGR A;  3T1E A;  2IAT A;  4B7J A;  1IQF L;  1CX2 A;  1NFX B;  4GU3 A;  4ZXX L;  5JBA E;  1EUU A;  1MZ6 A;  3O4P A;  5FNU A;  1YGC L;  4B7M A;  3NTG A;  1F8C A;  3EGF A;  4HZX A;  2VVU L;  3HRP A;  1L7G A;  1CQE A;  2CML A;  4NN9 A;  1DVA L;  1SLI A;  4XMI A;  1Q4G A;  5FNS A;  5B2C A;  4SLI A;  2P3T A;  1INW A;  1PRH A;  2VJ3 A;  1FAX L;  2BZ6 L;  2WYG B;  2IAX A;  2VSK A;  2Y5H L;  4HZZ A;  5D9D A;  2W2O E;  3OPZ A;  3GCX E;  4YZU B;  3G4E A;  1NFY B;  1MS9 A;  2Q1J B;  4ISI L;  4RS0 A;  2IAS A;  2HTY A;  5NN9 A;  3TIA A;  2HOR A;  3MDL A;  4BXW A;  1N6D A;  2J95 B;  1CRZ A;  1SNT A;  2BZD A;  2HU0 A;  2P4O A;  4QN5 A;  1IVO C;  1DDX A;  2HTU A;  4H53 A;  1NQL B;  1TOZ A;  2YGQ A;  4ZAE B;  4YZ3 A;  2WPK E;  1CRU A;  2YGP A;  2BQ7 A;  3LIW B;  1F7E A;  3FW0 A;  4GNB A;  4XIK A;  5K0H B;  4RRY A;  2P3U A;  2Y5F L;  4HZV A;  2FZZ L;  1UZP A;  2OJH A;  2OYU P;  3OLU A;  1KLJ L;  1V3B A;  5F9T A;  2B8H A;  4FPG A;  3NT1 A;  3DR2 A;  4MWL A;  4X4A A;  1HRE A;  3O9J A;  1G1Q A;  1W21 A;  3QMO A;  4CUF A;  4GN7 A;  4XJA A;  3HS5 A;  4O5S A;  2K2T A;  4JML A;  3NO0 A;  1U67 A;  1IQL L;  1F7M A;  2W2Q E;  2ADX A;  3KQC L;  5JVZ A;  2D1J B;  4AGI A;  2JKH L;  2F11 A;  1YUF A;  1V1I A;  1WU1 B;  4YZ1 A;  1XDT R;  1E1A A;  2QE8 A;  1APQ A;  4MX0 A;  2RHP A;  4FZH A;  4FP2 A;  4YZ5 A;  1IVF A;  1SO7 A;  1JBU L;  4FOY A;  1XFE A;  5B2D A;  1W8B L;  3OLT A;  3S8V A;  2XBX L;  1V04 A;  4I00 A;  1P0S L;  3TK6 B;  2GVU A;  3SIL A;  3V64 C;  2W3I B;  3ALX A;  4HW6 A;  2QWC A;  3U7U G;  1INH A;  1IUC A;  2WPI E;  2F27 A;  2EI6 B;  3Q6T A;  3TZI A;  2VVC K;  2VVZ A;  3KL6 B;  4XIO A;  4UF7 A;  1CCV A;  3E5Z A;  2ZWA A;  4KS3 A;  1V0Z A;  1DX5 I;  4CPO A;  2WFX B;  1C5M F;  1APO A;  4UOU A;  4AGT A;  1S0J A;  3FBY A;  1NN2 A;  2VAQ A;  1HT8 A;  2KNI A;  4JYV L;  4MWX A;  1U6D X;  4LOR A;  2BQ6 A;  1G1R A;  2XBW L;  4BTT A;  2X9M A;  1EUS A;  3FFG L;  2ZW9 A;  2J34 B;  3V1S A;  4GN9 A;  2J2U B;  1TLE A;  2Y81 B;  2WPM E;  1G2M B;  4PH9 A;  1NFW B;  5JYY A;  2YDT A;  2Y5G L;  3H5C B;  2BT7 A;  4GDI A;  2F13 A;  4XBM A;  1W8N A;  3GCW E;  5F19 A;  1L3Y A;  3O9K A;  2XC5 L;  2W26 B;  1V3X B;  3UC1 A;  3H72 A;  1QFK L;  4XOG A;  3WWA A;  1INX A;  1C9U A;  2NPR A;  1IQK L;  4Y71 B;  1N1Y A;  1NMC A;  1Z4W A;  1IQJ L;  5GX2 A;  3VNH A;  2AEQ A;  4CPL A;  4GZW A;  1RFN B;  1KSN B;  3CFW A;  1A14 N;  1CVW L;  2ZB6 A;  4DG6 A;  2SLI A;  4NCS A;  4MC7 A;  2XZJ A;  4JF7 A;  1LPK A;  1PGE A;  3VNG A;  1LMM A;  5CIS A;  3LAQ A;  1EUR A;  1NNB A;  3K9X A;  2UWL B;  1F8E A;  3ALW A;  4M4N A;  1CEJ A;  4Y6D B;  4FPJ A;  5FZJ A;  2IAP A;  1JV2 B;  4CUE A;  3SOB B;  1HAE A;  4YT7 L;  1W0O A;  4BDX A;  4G3N A;  4NG9 L;  3KQB L;  4D0E A;  4CUD A;  3W09 A;  1WHE A;  2BAT A;  2ZZK A;  1NCC N;  3S94 A;  2QWB A;  3B69 A;  4A94 C;  1DIL A;  2EI8 B;  1B9V A;  2WG3 C;  3L6V A;  2W20 A;  1B9S A;  2IAO A;  5FZN A;  2VWL L;  4IMB A;  2W2N E;  1W7X L;  2FP8 A;  2GVX A;  1INF A;  3ZYG A;  4MWJ A;  2VWN L;  3K36 A;  3A72 A;  2DDU A;  4Q6K A;  3N8Y A;  1LPZ A;  2VRS A;  2HTR A;  2AH2 A;  2P93 L;  1XKA L;  1GK5 A;  2B7D L;  3LN1 A;  1O5D L;  4GZP A;  2HT5 A;  4MZA A;  2VPJ A;  2VW1 A;  3LC5 B;  4QN7 A;  2W86 A;  1IQM L;  4MJV A;  3U0S A;  2QWH A;  2QWI A;  2W2M E;  4QN6 A;  1Q7F A;  1IVD A;  3ADE A;  2J4I B;  4FPL A;  4BTI A;  2POO A;  4CSY A;  1PXX A;  1Z4Y A;  1USX A;  4E1G A;  3R05 A;  4GZT A;  4HZY A;  1W0P A;  2VWD A;  4XMB A;  3LI3 A;  2Y7Z B;  3SOV A;  1SLL A;  1MQ6 L;  3KYA A;  3CS7 L;  4YZ2 A;  4IFL X;  3PJQ A;  3TBD A;  1S0I A;  5HUM A;  2SIL A;  4BXS A;  2FP9 A;  2OYE P;  1FE2 A;  1Z50 A;  3JU4 A;  4Z0K B;  3FCS B;  4BDW A;  5HX0 A;  3LI4 A;  2SIM A;  4D52 B;  1IVE A;  4QN3 A;  1KKE A;  1KIT A;  4Q1U A;  4OTJ A;  4WEF A;  5HUG A;  1HRF A;  2UWP B;  3ZYI B;  1MR5 A;  3KGG A;  5H47 A;  3HO4 A;  1KIG L;  1EPH A;  2P95 L;  3V65 B;  1L7F A;  1EZQ B;  4XJQ A;  4ZY3 A;  2IAV A;  2HTQ A;  2RA0 L;  5COX A;  1EMO A;  2W8B B;  4FPK A;  4IFJ A;  2ISM A;  2XBV L;  3CEN L;  5CKQ A;  1BJI A;  2MGP A;  1WCQ A;  4NGA L;  2YGO A;  4X8V L;  4FM5 A;  2HTV A;  4ZLR A;  2DG0 A;  3Q6P A;  5FWW A;  2Y7X B;  4GJT A;  2J94 B;  1NNC A;  4K1H A;  2TGF A;  1Z4Z A;  2FLB L;  1IVG A;  5KN5 C;  4G1M B;  5EX7 A;  2I9B A;  1RWL A;  3RR3 A;  4XJR A;  2WFT A;  1YO8 A;  4J9T A;  1V3D A;  1FSB A;  2EI7 B;  2KV4 A;  3BT1 A;  2F28 A;  3BYC A;  1IVB A;  3POY A;  4CPN A;  2WG4 B;  1MWE A;  1LPG A;  4D8S A;  2WPJ E;  2QWD A;  3CL0 A;  1AUT L;  3TI3 A;  3DAS A;  4JYU L;  4RUT A;  1J9C L;  3ELA L;  3N8W B;  3Q7D A;  5F72 C;  2P3F N;  5JVY A;  4FPC A;  3N8X A;  1CQ1 A;  2XZI A;  3H73 A;  3CL2 A;  4D52 C;  2G00 L;  1MQ5 L;  3HLH A;  2IAW A;  1K36 A;  4A7I A;  1ING A;  1K32 A;  2XC4 L;  3M36 L;  2UWO B;  3PGH A;  2MGR A;  2P3F L;  1POO A;  2Z32 A;  3U73 A;  4B7Q A;  4MWV A;  2FLU X;  2HOX A;  1KLI L;  2YA4 A;  3H6J A;  4M3M A;  2GVV A;  5FNT A;  1IJQ A;  4FOW A;  4XJW A;  4PWZ A;  1MOX C;  2QWG A;  2VW0 A;  5JB8 E;  1QLG A;  2G8S A;  1NSB A;  1KLO A;  2JKB A;  5E8D A;  4X47 A;  1CCF A;  1EGF A;  3N8Z A;  1L5G B;  1G2L B;  2M74 A;  1N6F A;  2F26 A;  4K1J A;  2IAU A;  4K3Y A;  4O1Z A;  3CYE A;  4M4V A;  4FPE A;  1UZJ A;  3D12 A;  3NJP C;  1HZ8 A;  1K37 A;  3ZGC A;  1WCS A;  1HCG B;  1NFU B;  2FD6 A;  1A4G A;  3HPT A;  1MZ5 A;  3AMR A;  1ATA A;  1BF9 A;  2F12 A;  1V3E A;  5EGM B;  1PJX A;  4GZS A;  1B9T A;  4D52 A;  1YUK B;  5IKQ A;  1NT0 A;  1WHF A;  4XE9 A;  1IOX A;  1S18 A;  4ZHA B;  2FHR A;  1EBV A;  1F8B A;  1URK A;  2DYH A;  2HTW A;  3A9G A;  1DIY A;  4XJ9 A;  3TI4 A;  4B7N A;  4HHQ A;  4XL1 A;  1XOG A;  6NN9 A;  4MWR A;  2YA7 A;  3TI6 A;  4O02 B;  1W20 A;  2XZK A;  4GZO A;  4Z0L A;  4YW4 A;  3SLI A;  4GU4 A;  3F1S B;  3K37 A;  4GB1 A;  4QN4 A;  5EO7 A;  2GD4 A;  1V3C A;  1IQH L;  1ATB A;  2J38 B;  4M11 A;  4AQT A;  4FOV A;  5I46 L;  3TH3 L;  4ASC A;  1NSD A;  1A4Q A;  1QBI A;  5HUK A;  4RRW A;  2JJL A;  3LTF B;  1EUT A;  2W8B A;  4CPY A;  2YA5 A;  4COX A;  1H6L A;  3LI5 A;  4TGF A;  4FP3 A;  1F0R B;  3N8V A;  4FQ4 A;  3SAN A;  2C4A A;  3HO5 A;  4MWQ A;  3KK6 A;  4KS2 A;  1CVM A;  4NC5 A;  3GVK A;  4X6K A;  1HJ7 A;  3M37 L;  3HS6 A;  4O5T A;  4C1Y B;  4JZD L;  2V91 A;  3FVZ A;  4WEG A;  2W2P E;  3C9A C;  3IAX A;  1NPE B;  1VCU A;  5JW1 A;  2BQW A;  1N1V A;  3QCW A;  2BF6 A;  3LTG D;  2C4L A;  2IVZ A;  4GNC A;  1INY A;  4HIZ A;  4JZF L;  1PTH A;  4Y7B B;  4MMZ B;  2QWA A;  3TI5 A;  5JBB E;  4BTU A;  3WN7 A;  1TPG A;  5FNR A;  4FPF A;  4MMY B;  4ZGC A;  3K38 A;  2QWK A;  1FAK L;  3ZYJ B;  4XYX A;  1C5K A;  4CPM A;  3K3A A;  4N1B A;  3S8Z A;  5D9C A;  4BBW A;  1NPE A;  3MQE A;  1IP0 A;  4GN8 A;  5GX4 A;  1NCA N;  3SRE A;  2PR3 B;  4OTY A;  4D0F A;  5IKV A;  2Y80 B;  1E8U A;  3ZGD A;  1V0E A;  4M4U A;  1MS1 A;  2YA8 A;  3CKZ A;  4IYG A;  4L7D A;  4YW2 A;  4CH9 A;  1DIM A;  2IAR A;  4FPO B;  2VH0 B;  4HZW A;  5JB9 E;  3SAL A;  1M1X B;  2DSO A;  1L7H A;  1ZAQ A;  2HT8 A;  3TK5 B;  1NNA A;  2H9E L;  3HLI A;  2BO2 A;  4FJ6 A;  4FPY A;  4IFN X;  1IGZ A;  1NMA N;  3SRG A;  3N8W A;  3P5B L;  5FDQ A;  2KL7 A;  1X7A L;  5GX5 A;  4X8U L;  1MS4 A;  1W1X A;  4ISH L;  2P28 B;  4WA5 A; 
#chains in the Genus database with same CATH homology
 1EPG A;  4MMX B;  3LC3 B;  3F6U L;  1UZK A;  2WPH E;  2BOU A;  1U8C B;  2Y82 B;  1IQE L;  3QH0 A;  1Z6C A;  3SOQ A;  1ATD A;  1F0S B;  2FLR L;  4RRZ A;  3S6X A;  2BOK L;  1OB1 C;  4RRX A;  2I9A A;  3LN0 A;  3KQD L;  2IAQ A;  3HO3 A;  5CKM A;  1FF7 A;  4YT6 L;  1IQI L;  5KIR A;  3KRK A;  2WPL E;  4D90 A;  1HT5 A;  1EPI A;  2BOH A;  2FLG A;  2P26 A;  4R40 A;  2PUQ L;  1A3P A;  5GX3 A;  4Y7A B;  4ZH8 B;  2P16 L;  2DG1 A;  3KCG L;  3DEM A;  1EMN A;  2XC0 L;  3NTB A;  1P9J A;  5IKT A;  5GTQ A;  3ENS A;  4XLW A;  1I0U A;  4Y79 B;  1HAF A;  3Q6K A;  1IGX A;  2VWM K;  2P94 L;  2VH6 B;  3GIS X;  3IIT B;  1Z6E L;  5L2Y L;  2GVW A;  2HQS A;  3IJE B;  3TGF A;  2WYJ B;  1IQG L;  1FJS L;  3N8Y B;  1EQH A;  2AYL A;  1NZI A;  5L30 L;  3S2K A;  2RNL A;  2WZP P;  5GX1 A;  1LMJ A;  2KB9 A;  1EPJ A;  2F9B L;  1B9W A;  4M10 A;  2BMG A;  2H9E C;  2Y38 A;  3SW2 A;  2VVV L;  4NA9 L;  2FPB A;  3AMS A;  2PHB B;  5L2Z L;  1N7D A;  1LQD A;  2CJI B;  1ATE A;  1EAI C;  1DQB A;  3I1C A;  4X8S L;  4A0P A;  4Y76 B;  3A9H A;  5IKR A;  2BOX A;  2W3K B;  4JZE L;  5CKN A;  2VWO L;  1ADX A;  1RWI A;  4GNA A;  5JBC E;  3ASI A;  3G4H A;  1SZB A;  4ZXY L;  2GHS A;  3WW9 A;  1UZQ A;  5F1A A;  3HS7 A;  1CVU A;  2XBY L;  3TC9 A;  1FFM A;  5D9B A;  3BT2 A;  1PFX L;  3CA7 A;  3BPS E;  2FPC A;  4HHO A;  6COX A;  1COU A;  2K2S B;  4X8T L;  2MHP A;  1HX2 A;  4C16 A;  1IOE L;  3KQE L;  4LMF A;  1JL9 A;  1G1T A;  1IQN L;  1N1I A;  1YUG A;  3Q3K B;  1XKB A;  4Z6A L;  1EQG A;  1G1S A;  2IAT A;  1IQF L;  1CX2 A;  1NFX B;  4ZXX L;  5JBA E;  3O4P A;  1YGC L;  3NTG A;  3EGF A;  2VVU L;  3HRP A;  1CQE A;  1DVA L;  1Q4G A;  2P3T A;  1PRH A;  2VJ3 A;  1FAX L;  2BZ6 L;  2WYG B;  5D9D A;  2Y5H L;  2W2O E;  3GCX E;  4YZU B;  3G4E A;  1NFY B;  2Q1J B;  4ISI L;  4RS0 A;  2IAS A;  3MDL A;  4BXW A;  2J95 B;  1CRZ A;  2P4O A;  1IVO C;  1DDX A;  1NQL B;  1TOZ A;  2YGQ A;  4ZAE B;  2WPK E;  1CRU A;  2YGP A;  2BQ7 A;  3LIW B;  1F7E A;  3FW0 A;  4GNB A;  5K0H B;  4RRY A;  2P3U A;  2Y5F L;  2FZZ L;  1UZP A;  2OJH A;  2OYU P;  3OLU A;  1KLJ L;  3NT1 A;  3DR2 A;  1HRE A;  1G1Q A;  3QMO A;  4CUF A;  4GN7 A;  3HS5 A;  4O5S A;  2K2T A;  4JML A;  1U67 A;  1IQL L;  1F7M A;  2W2Q E;  2ADX A;  3KQC L;  5JVZ A;  2D1J B;  2JKH L;  1YUF A;  1WU1 B;  1XDT R;  1E1A A;  2QE8 A;  1APQ A;  2RHP A;  1JBU L;  1XFE A;  1W8B L;  3OLT A;  3S8V A;  2XBX L;  1V04 A;  1P0S L;  3TK6 B;  2GVU A;  3V64 C;  2W3I B;  4HW6 A;  3U7U G;  3Q6T A;  2WPI E;  2EI6 B;  3TZI A;  2VVC K;  3KL6 B;  1CCV A;  3E5Z A;  1DX5 I;  2WFX B;  1C5M F;  1APO A;  3FBY A;  2VAQ A;  1HT8 A;  2KNI A;  4JYV L;  4LOR A;  2BQ6 A;  1G1R A;  2XBW L;  4BTT A;  3V1S A;  3FFG L;  2J34 B;  4GN9 A;  2J2U B;  1TLE A;  2Y81 B;  2WPM E;  1G2M B;  4PH9 A;  1NFW B;  2Y5G L;  3H5C B;  4XBM A;  3GCW E;  5F19 A;  1L3Y A;  2XC5 L;  2W26 B;  1V3X B;  1QFK L;  3WWA A;  1C9U A;  2NPR A;  1IQK L;  4Y71 B;  5GX2 A;  1IQJ L;  1RFN B;  1KSN B;  3CFW A;  1CVW L;  4DG6 A;  1LPK A;  1PGE A;  1LMM A;  5CIS A;  3LAQ A;  3K9X A;  2UWL B;  1CEJ A;  4Y6D B;  2IAP A;  1JV2 B;  4CUE A;  3SOB B;  1HAE A;  4YT7 L;  4BDX A;  4NG9 L;  3KQB L;  4D0E A;  4CUD A;  1WHE A;  3S94 A;  4A94 C;  2EI8 B;  2WG3 C;  2IAO A;  2VWL L;  4IMB A;  2W2N E;  1W7X L;  2FP8 A;  2GVX A;  3ZYG A;  2VWN L;  2DDU A;  3N8Y A;  1LPZ A;  2P93 L;  1XKA L;  1GK5 A;  2B7D L;  3LN1 A;  1O5D L;  3LC5 B;  2W86 A;  1IQM L;  3U0S A;  2W2M E;  1Q7F A;  2J4I B;  4BTI A;  2POO A;  4CSY A;  1PXX A;  4E1G A;  3R05 A;  3LI3 A;  2Y7Z B;  3SOV A;  3KYA A;  1MQ6 L;  3CS7 L;  3TBD A;  4BXS A;  2FP9 A;  2OYE P;  1FE2 A;  4Z0K B;  3FCS B;  4BDW A;  3LI4 A;  4Q1U A;  4OTJ A;  1HRF A;  2UWP B;  3ZYI B;  3KGG A;  3HO4 A;  1KIG L;  1EPH A;  2P95 L;  3V65 B;  1EZQ B;  2IAV A;  2RA0 L;  5COX A;  1EMO A;  2W8B B;  2ISM A;  2XBV L;  3CEN L;  5CKQ A;  2IAX A;  2MGP A;  4NGA L;  2YGO A;  4X8V L;  4FM5 A;  4ZLR A;  2DG0 A;  3Q6P A;  5FWW A;  2Y7X B;  2J94 B;  2TGF A;  2FLB L;  5KN5 C;  4G1M B;  5EX7 A;  2I9B A;  1RWL A;  3RR3 A;  2WFT A;  1YO8 A;  1FSB A;  2EI7 B;  2KV4 A;  3BT1 A;  3BYC A;  3POY A;  2WG4 B;  1LPG A;  2WPJ E;  1AUT L;  3DAS A;  4JYU L;  4RUT A;  1J9C L;  3ELA L;  3N8W B;  3Q7D A;  2P3F N;  5JVY A;  3N8X A;  1CQ1 A;  2G00 L;  1MQ5 L;  3HLH A;  2IAW A;  1K36 A;  4A7I A;  2XC4 L;  3M36 L;  2UWO B;  3PGH A;  2MGR A;  2P3F L;  1POO A;  3U73 A;  1KLI L;  2GVV A;  1IJQ A;  4PWZ A;  1MOX C;  5JB8 E;  1QLG A;  2G8S A;  1KLO A;  5E8D A;  1CCF A;  1EGF A;  3N8Z A;  1L5G B;  1G2L B;  2M74 A;  2IAU A;  4O1Z A;  1UZJ A;  3NJP C;  1HZ8 A;  1K37 A;  1HCG B;  1NFU B;  2FD6 A;  3AMR A;  3HPT A;  1ATA A;  1BF9 A;  5EGM B;  1PJX A;  1YUK B;  5IKQ A;  1NT0 A;  1WHF A;  1IOX A;  4ZHA B;  1EBV A;  1URK A;  3A9G A;  1DIY A;  4HHQ A;  4XL1 A;  4O02 B;  4Z0L A;  3F1S B;  2GD4 A;  1IQH L;  1ATB A;  2J38 B;  4M11 A;  4AQT A;  5I46 L;  3TH3 L;  1QBI A;  4RRW A;  3LTF B;  2W8B A;  4COX A;  1H6L A;  3LI5 A;  4TGF A;  1F0R B;  3N8V A;  3HO5 A;  3KK6 A;  1CVM A;  1HJ7 A;  3M37 L;  3HS6 A;  4O5T A;  4JZD L;  2V91 A;  3FVZ A;  2W2P E;  3C9A C;  3IAX A;  1NPE B;  5JW1 A;  2BQW A;  3QCW A;  3LTG D;  2IVZ A;  4GNC A;  4JZF L;  1PTH A;  4Y7B B;  4MMZ B;  5JBB E;  4BTU A;  1TPG A;  4MMY B;  1FAK L;  3ZYJ B;  1C5K A;  3S8Z A;  5D9C A;  1NPE A;  3MQE A;  1IP0 A;  4GN8 A;  5GX4 A;  3SRE A;  2PR3 B;  4OTY A;  4D0F A;  5IKV A;  2Y80 B;  4IYG A;  2IAR A;  2VH0 B;  5JB9 E;  1M1X B;  2DSO A;  1ZAQ A;  3TK5 B;  2H9E L;  3HLI A;  2BO2 A;  1IGZ A;  3SRG A;  3N8W A;  3P5B L;  5FDQ A;  2KL7 A;  1X7A L;  5GX5 A;  4X8U L;  4ISH L;  2P28 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...