3SOQA

The structure of the first ywtd beta propeller domain of lrp6 in complex with a dkk1 peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
305
structure length
305
Chain Sequence
b'APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low-density lipoprotein receptor-related protein 6
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/antagonist
total genus 80
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3soqA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3soqA01
4IMBA 2GVXA 4M11A 4NA9L 4IYGA 2M74A 2MGPA 1G1SA 4GNAA 1YUGA 4RRWA 4ZHAB 2UWPB 1HJ7A 2IAWA 4GN9A 1URKA 1APOA 1DVAL 4XBMA 3AMRA 4Y7BB 2Q1JB 1CQ1A 3FBYA 2G8SA 2J94B 1NFWB 3BPSE 2IAUA 4AQTA 5JBCE 1MQ5L 4OTJA 5GX5A 1IGZA 2VAQA 3S94A 4X8SL 1G1TA 5E8DA 1FFMA 1L5GB 1A3PA 3DR2A 1E1AA 2BOUA 5D9DA 4XLWA 4PH9A 4C16A 1FJSL 2MHPA 1XKAL 3ENSA 3HO5A 4YZUB 4BTTA 2WG4B 2KV4A 2XBVL 2DG1A 2EI6B 3KCGL 5CISA 1JBUL 1EPIA 3N8WA 5IKRA 1L3YA 1XFEA 1PGEA 1C5KA 3LTGD 5JVZA 2IAPA 5KN5C 4JYUL 1G2LB 3HS5A 2DSOA 4JYVL 5KIRA 4HW6A 1O5DL 3NT1A 2VWOL 3FW0A 2W2NE 2WFXB 3G4HA 1SZBA 1QFKL 2UWOB 2W3KB 3CFWA 3LN1A 3QH0A 3H5CB 2RA0L 1EMOA 1EQGA 4RRZA 3N8YB 3ZYGA 1F7EA 3S8VA 2GVWA 3OLUA 3GCWE 2I9AA 4CSYA 1QLGA 1EPGA 3OLTA 1XKBA 3HPTA 5CKQA 3LC5B 2Y5FL 3Q6KA 4MMZB 2WPHE 3M36L 3RR3A 3O4PA 4CUFA 4MMYB 2Y7ZB 4MMXB 3DASA 1HT8A 3KYAA 3SW2A 4A0PA 1QBIA 2QE8A 1EZQB 1IQEL 3TK5B 1ATBA 1LPGA 6COXA 1FE2A 2VVVL 2P3FN 2BQWA 1KLOA 5F19A 3KQEL 1FAXL 2FP9A 4CUEA 2BMGA 2UWLB 2G00L 2TGFA 2FP8A 3Q3KB 3ZYIB 2PR3B 1K36A 3AMSA 2P94L 5L2YL 2RNLA 1EGFA 1DDXA 1JL9A 2KB9A 1CRZA 1EQHA 5GX1A 2W2QE 4RRXA 3TGFA 1FAKL 2P93L 3V65B 1LQDA 2Y5GL 2YGPA 3WWAA 2W2ME 2VH6B 5IKVA 3Q6PA 3KQBL 1IJQA 2P3UA 2EI8B 5I46L 1HRFA 3S2KA 4NG9L 1ADXA 2K2TA 3N8WB 4ISIL 2ADXA 3IJEB 3TK6B 1NFYB 1CQEA 1EPJA 3KRKA 1JV2B 2BO2A 4Z0LA 1PJXA 3BYCA 3HLHA 1AUTL 1POOA 2FPBA 2XC0L 2W3IB 3ELAL 3TH3L 2OYEP 4JMLA 2P28B 4NGAL 1B9WA 3DEMA 2BOHA 1NPEA 1ATEA 4OTYA 3Q7DA 3N8VA 1IGXA 1PFXL 2FPCA 1OB1C 3V1SA 1WHFA 1HREA 1YUKB 2XBYL 5K0HB 4BXWA 1HT5A 4RS0A 4BXSA 5COXA 3ZYJB 3G4EA 2GVVA 2VH0B 4ISHL 3GISX 1BF9A 1IQFL 2RHPA 2IAOA 3LI5A 1CVUA 1IOEL 1G1QA 2XC5L 2HQSA 1V3XB 1CCFA 1EPHA 2Y38A 4D90A 2FLRL 3MDLA 4E1GA 4GN8A 2P16L 4Y7AB 4GNCA 3LAQA 2VWMK 4RRYA 3HO3A 3N8ZA 4COXA 4HHQA 5L30L 2BOXA 2GD4A 4ZXYL 3HLIA 1C5MF 3IITB 1TOZA 2Y7XB 2P95L 2WG3C 2NPRA 2PUQL 2DG0A 3KQCL 1V04A 3TC9A 5L2ZL 3FVZA 2W8BB 1IVOC 1U8CB 1RWLA 3K9XA 1PTHA 2GVUA 4ZXXL 4M10A 3CENL 1FSBA 1IQML 2J95B 1TLEA 2VVCK 2IASA 1W7XL 1Z6EL 1YUFA 2BQ6A 2OYUP 3GCXE 3LI4A 5FWWA 2IATA 5D9BA 1KLIL 5IKQA 5FDQA 2FZZL 1N1IA 3SOVA 3CA7A 1HX2A 3QCWA 2Y5HL 3ASIA 4JZFL 5JB8E 5GX2A 3TZIA 1PXXA 2W86A 1P9JA 2W2OE 4X8TL 2WPIE 1CCVA 1NFUB 5JVYA 1IP0A 2MGRA 4GNBA 3N8YA 2KL7A 2POOA 3A9GA 2WYGB 2ISMA 3S8ZA 3NTBA 2FLBL 2AYLA 5D9CA 1IQNL 2WPME 1KIGL 2WPLE 3U0SA 1DIYA 3LIWB 4D0FA 4D0EA 1Z6CA 4O5TA 5JBAE 1UZJA 2K2SB 3FCSB 1DQBA 1H6LA 1NPEB 2CJIB 2YGOA 4JZEL 3F6UL 3V64C 2W26B 2WFTA 1WHEA 1CEJA 1COUA 5GX3A 4FM5A 2H9EL 1C9UA 2IVZA 4ZLRA 1IQKL 1XDTR 4Z6AL 1TPGA 3M37L 1HZ8A 3A9HA 1K37A 2I9BA 1EAIC 3NTGA 2FD6A 5JBBE 2IAVA 1IOXA 2XC4L 4PWZA 4G1MB 1UZKA 1DX5I 3WW9A 2WYJB 3Q6TA 3KK6A 1APQA 1F0RB 1UZPA 4XL1A 2J38B 3BT1A 2WPKE 2BOKL 2Y80B 3C9AC 3SOQA 2FLGA 1Q4GA 1MOXC 1NT0A 3KQDL 4A7IA 2EI7B 2PHBB 1G2MB 4BTUA 4Z0KB 3U7UG 3TBDA 2GHSA 1U67A 1IQLL 2IAXA 1KLJL 2D1JB 4BTIA 3I1CA 4DG6A 3SOBB 2VVUL 3F1SB 3P5BL 4Y79B 1IQGL 3HS6A 2IARA 5F1AA 4BDWA 3LC3B 1KSNB 1M1XB 2XBWL 2Y81B 1NFXB 1I0UA 1IQJL 1YGCL 4RUTA 4HHOA 4ZH8B 1Q7FA 2IAQA 2P4OA 4BDXA 1NQLB 2VJ3A 4TGFA 3BT2A 2VWLL 3PGHA 1J9CL 4LORA 4R40A 4O5SA 2B7DL 4GN7A 2P3TA 1IQIL 4Y76B 3U73A 3EGFA 1ZAQA 5CKNA 4YT7L 1ATDA 1HAFA 3SRGA 1EMNA 2J4IB 4Y6DB 3FFGL 3KL6B 4O02B 3MQEA 4LMFA 1HCGB 1LPZA 1YO8A 1P0SL 1MQ6L 1G1RA 1GK5A 1HAEA 3KGGA 2P26A 2Y82B 1X7AL 5EX7A 3N8XA 2V91A 3LN0A 4X8UL 2OJHA 1LMJA 4YT6L 3R05A 5GTQA 5GX4A 2J2UB 3HO4A 1ATAA 3SREA 1N7DA 3IAXA 2W2PE 4Y71B 1EBVA 5EGMB 3QMOA 1IQHL 1PRHA 1CVMA 4Q1UA 2WPJE 2DDUA 2J34B 1RFNB 2W8BA 2F9BL 1UZQA 2BZ6L 5JW1A 3LTFB 2VWNL 3HS7A 1WU1B 3CS7L 1LPKA 5CKMA 1CRUA 1CX2A 4ZAEB 1CVWL 5IKTA 4O1ZA 3E5ZA 1FF7A 1NZIA 1F0SB 1RWIA 1F7MA 3POYA 2P3FL 2BQ7A 3NJPC 5JB9E 1W8BL 4JZDL 2XBXL 2JKHL 4CUDA 3HRPA 3LI3A 4X8VL
chains in the Genus database with same CATH superfamily
2ZWAA 4IMBA 2FHRA 2GVXA 4M11A 4NA9L 4XMIA 1NN2A 2F12A 2HU4A 3NSSA 4IYGA 4D52B 3TIAA 2M74A 2MGPA 1G1SA 1NSCA 1YUGA 4FOQA 4GNAA 5FNSA 4RRWA 4ZHAB 2UWPB 1NCBN 1HJ7A 4CHBA 2IAWA 1NCCN 1URKA 3H73A 4GN9A 4IFLX 1VCJA 4C1YA 1APOA 1DVAL 3WDZA 4XBMA 2YA4A 3AMRA 4Y7BB 2Q1JB 1CQ1A 2F28A 4FP2A 2HTQA 4M4NA 3FBYA 1NCDN 2G8SA 2J94B 4HZZA 1NFWB 3BPSE 2AH2A 2X9MA 2IAUA 5EO8A 5B2DA 4AQTA 5JBCE 4B7QA 1MQ5L 4OTJA 1NMBN 1IGZA 2VAQA 4FPJA 5GX5A 4WEFA 4X8SL 3S94A 4YZ1A 1G1TA 2XN4A 5E8DA 1FFMA 3L6VA 1L5GB 1A3PA 3DR2A 1E1AA 4HZXA 2BOUA 5D9DA 1NNCA 4XLWA 4PH9A 1Z4XA 4NCSA 5FZJA 4C16A 1FJSL 2XZIA 2MHPA 4FOVA 1XKAL 3ENSA 2ZB6A 1WP5A 3HO5A 4YZUB 4BTTA 4MWVA 2WG4B 2KV4A 2XBVL 2DG1A 3D11A 2EI6B 3KCGL 4MWRA 4ASCA 5CISA 1IVCA 4HZVA 1JBUL 2H2NA 1EPIA 3N8WA 4CPYA 5IKRA 1L3YA 1XFEA 1PGEA 1C5KA 2VPJA 2VW1A 1SUUA 1N1SA 3LTGD 5JVZA 3TIBA 2IAPA 5KN5C 4JYUL 2F25A 1G2LB 4CPZA 1SNTA 4GDIA 4YW5A 2SLIA 3HS5A 1V3CA 2DSOA 4JYVL 3UC1A 5KIRA 4HW6A 1O5DL 1SO7A 3NT1A 4IQKA 2VWOL 1Z4ZA 2W5NA 3FW0A 2W2NE 2WFXB 3G4HA 4GZOA 1SZBA 1QFKL 4M4VA 2UWOB 1S18A 3TI8A 2W3KB 1KITA 3GVJA 3CFWA 1LK9A 1N6EA 4NC5A 3LN1A 3QH0A 3H5CB 2RA0L 1EMOA 2BT8A 1EQGA 4RRZA 3N8YB 3ZYGA 1F7EA 4N1BA 3S8VA 2GVWA 4MX0A 3OLUA 3GCWE 2I9AA 4CSYA 1QLGA 1EPGA 2JJLA 1NMAN 3OLTA 1XKBA 2RKCA 3HPTA 4FPFA 5CKQA 3LC5B 2Y5FL 3Q6KA 4MMZB 2YA8A 2WPHE 3M36L 1U6DX 3RR3A 3O4PA 5FNUA 4CUFA 4GZSA 4MMYB 4WEGA 2Y7ZB 3SILA 4MMXB 3S6XA 1DIMA 2QWBA 4KS3A 3DASA 1HT8A 3KYAA 4MC7A 4XHXA 1IVEA 3SW2A 3B7EA 5F9TA 3O9KA 4FOWA 3ALXA 1F8CA 1QBIA 2QE8A 4A0PA 1EZQB 2VSKA 1W0PA 1IQEL 1KKEA 2QWAA 2HORA 3TK5B 1SLIA 1ATBA 4MJUA 1LPGA 6COXA 1FE2A 2VVVL 2P3FN 2BQWA 2SIMA 4FPLA 1KLOA 5F19A 1W0OA 3KQEL 4GEZA 4G3NA 1FAXL 2FP9A 4CUEA 2BMGA 2UWLB 2QWIA 2VK5A 3A71A 2G00L 1N6FA 2TGFA 4ZGCA 3NN9A 4XJ9A 1ZI0A 2FP8A 3Q3KB 4MWWA 4H52A 3ZYIB 3II7A 2JKBA 1K32A 4GDJA 2PR3B 1K36A 3AMSA 2P94L 5L2YL 2RNLA 4X4AA 1EGFA 4B7MA 1DDXA 1JL9A 2HT5A 2KB9A 3PJQA 4GU3A 4K1HA 1CRZA 1EQHA 5GX1A 5JYYA 2F0ZA 3H72A 2W2QE 4MWXA 4YW4A 4RRXA 3TGFA 1FAKL 2P93L 2F27A 3ALWA 4Q6KA 4CPNA 2HTWA 3V65B 3TI4A 1LQDA 2Y5GL 4A94C 2YGPA 1L7HA 3CL0A 3WWAA 2W2ME 2VH6B 5IKVA 5M1ZA 3Q6PA 3KQBL 1IJQA 4FQ4A 2P3UA 3WN7A 2EI8B 1MS0A 5I46L 1NCAN 1HRFA 3S2KA 4NG9L 2YGQA 1ADXA 2K2TA 3A72A 2YA6A 3N8WB 4ISIL 2ADXA 3IJEB 3TK6B 1NFYB 1CQEA 4XIKA 1EPJA 3KRKA 3D12A 4MWJA 4CSDA 1JV2B 2BO2A 4Z0LA 1PJXA 3BYCA 3HLHA 4MZAA 4KS1A 2H2UA 1AUTL 1POOA 4GZTA 2SILA 2CMLA 2FPBA 2XC0L 2W3IB 3ELAL 3TH3L 2OYEP 2AEQA 4JMLA 4QN6A 1L7FA 2BT7A 2P28B 4NGAL 1B9WA 3DEMA 1IVGA 1N6DA 2BOHA 2VK6A 2QWDA 1NPEA 4XOGA 1ATEA 4OTYA 3T1EA 2FLUX 3Q7DA 4XJAA 3N8VA 3H71A 3INBA 1INXA 1IGXA 5HUNA 4HZYA 2XZJA 1PFXL 2FPCA 1OB1C 3V1SA 1WHFA 4FPCA 1HREA 1EURA 4FOYA 1YUKB 2XBYL 5K0HB 5B2CA 4BXWA 2C4AA 1HT5A 4RS0A 1S1DA 2VW0A 2W5OA 4BXSA 3K36A 5COXA 3ZYJB 4QN7A 4K1JA 3G4EA 2F10A 2GVVA 2VSMA 2VH0B 2VRSA 4XJZA 4ISHL 3GISX 1BF9A 1IQFL 1V1IA 4D52A 1BJIA 2RHPA 1A4QA 3GVLA 2IAOA 1SLLA 3LI5A 1CVUA 1IOEL 1G1QA 2XC5L 2HU0A 2ZZKA 4ZY3A 2HQSA 4CPMA 1V3XB 4X6KA 1CCFA 1EPHA 4JF7A 2Y38A 4FPYA 4D90A 1INHA 2WZPP 2FLRL 3MDLA 4E1GA 4XYXA 1W20A 4GN8A 2P16L 4Y7AB 4GNCA 3LAQA 2VWMK 4RRYA 3HO3A 3N8ZA 4COXA 2BZDA 4M4UA 4DGRA 2BF6A 4HHQA 5L30L 2BOXA 2GD4A 1A14N 4ZXYL 1X2JA 3TI3A 4YZ5A 2YA7A 3HLIA 1C5MF 3CKZA 3TI6A 3IITB 1TOZA 2Y7XB 2P95L 2WG3C 2NPRA 2PUQL 2DG0A 4K1KA 1USRA 2QWKA 3KQCL 1V04A 4M3MA 3TC9A 5L2ZL 3H6JA 1XOGA 2W8BB 3FVZA 4YZ2A 3OPZA 1IVOC 1U8CB 1RWLA 3K9XA 1IVDA 5EO7A 2A75A 4D52C 1PTHA 2GVUA 4ZXXL 4M10A 4WA5A 3CENL 1FSBA 1IQML 2J95B 1TLEA 3BEQA 1MS4A 2VVCK 3O9JA 2IASA 1W7XL 1B9TA 5FZNA 1Z6EL 1YUFA 1MS3A 1MZ5A 3ADEA 4YY8A 2BQ6A 3CYEA 2OYUP 3GCXE 1W21A 3LI4A 5FWWA 2IATA 1MZ6A 5D9BA 1KLIL 5IKQA 2BATA 4FJ6A 4H53A 5FNTA 3TICA 4UOUA 4AH4A 4AHAA 4AGIA 5FDQA 4SLIA 2FZZL 1N1IA 3SOVA 3CA7A 1HX2A 1S0JA 4UF7A 3QCWA 1L7GA 2Y5HL 3ASIA 4JZFL 5JB8E 2YA5A 5GX2A 3TZIA 1PXXA 2W86A 1P9JA 2W2OE 4X8TL 2WPIE 1CCVA 4FP3A 1NFUB 5JVYA 1IP0A 2HOXA 2MGRA 4GNBA 4IFJA 3N8YA 2KL7A 2H9EC 4C1YB 4GB1A 2POOA 3A9GA 2WYGB 2ISMA 3S8ZA 3NTBA 2FLBL 2F13A 2AYLA 3TI5A 5D9CA 1IQNL 2AEPA 2WPME 1KIGL 2WPLE 3U0SA 1DIYA 3LIWB 4D0FA 4D0EA 2HTYA 2VVZA 1Z6CA 2QWJA 2F11A 4O5TA 1NMCA 5JBAE 1UZJA 2K2SB 3FCSB 1DQBA 1H6LA 1NPEB 2CJIB 2YGOA 4JZEL 2F24A 3F6UL 4MWQA 4AGTA 4BBWA 1MS1A 3V64C 4YW3A 2W26B 2WFTA 1WHEA 4WA3A 1CEJA 1COUA 1F8BA 2HT8A 5GX3A 4FM5A 2QWCA 1NSDA 2HTVA 2H9EL 1C9UA 1V0ZA 2HTUA 2IVZA 4ZLRA 1NNBA 1INFA 1IQKL 1XDTR 4Z6AL 1TPGA 3M37L 1HZ8A 1E8VA 1K37A 3A9HA 2I9BA 1EAIC 3NTGA 1IVBA 2HT7A 2Z32A 2XCYA 1N1YA 4FZHA 2FD6A 5JBBE 2IAVA 1IOXA 2W38A 2ZW9A 4D8SA 2XC4L 4PWZA 7NN9A 4YZ4A 4G1MB 1UZKA 1DX5I 3WW9A 2WYJB 4GZPA 4MJVA 3Q6TA 4XILA 4J9TA 4FPGA 3KK6A 1APQA 1F0RB 1UZPA 4XL1A 2VK7A 4D4UA 2J38B 2VWDA 3BT1A 1NSBA 2WPKE 2BOKL 3SANA 5HUKA 2Y80B 3C9AC 3SOQA 4CPLA 4YW2A 2FLGA 3B69A 4KS2A 1Q4GA 2QWEA 1MOXC 1NT0A 3KQDL 4A7IA 1ZGKA 1QIUA 2EI7B 2PHBB 1V3DA 1G2MB 4BTUA 1MS9A 1IUBA 4Z0KB 2KNIA 4GJTA 4XJRA 4QN5A 3U7UG 4GZWA 1LMMA 3TBDA 2GHSA 4IN4A 1U67A 1IQLL 4KS5A 1NNAA 5H47A 4L7BA 1IUCA 1KLJL 2IAXA 2D1JB 3SLIA 4BTIA 1W8NA 3I1CA 4FPEA 4NN9A 4DG6A 3SOBB 2VVUL 6NN9A 3JU4A 4X49A 3F1SB 3VNGA 4XJUA 3P5BL 2QWFA 4K3YA 4Y79B 1IQGL 4FPOB 2VW2A 4FPHA 3HS6A 2IARA 5F1AA 4L7CA 5HUMA 1B9VA 2B8HA 4BDWA 1V0FA 1WCQA 1F8DA 1V3BA 3LC3B 1W1XA 2ZB5A 1KSNB 1IVFA 1M1XB 2XBWL 2Y81B 1NFXB 1V2IA 2BERA 1I0UA 1IQJL 1YGCL 4RUTA 1INYA 4HHOA 1A4GA 4B7RA 4QN3A 3GVKA 4ZH8B 1Q7FA 2IAQA 2P4OA 4BDXA 1NQLB 2VJ3A 4TGFA 1INWA 4FPKA 3BT2A 1DILA 2VWLL 3PGHA 4B7NA 1J9CL 4LORA 4R40A 1V0EA 4O5SA 2B7DL 1Z4YA 4GN7A 4XJQA 2P3TA 1IQIL 4Y76B 2DYHA 3U73A 3VNHA 1MS5A 3EGFA 4HZWA 1ZAQA 5CKNA 1MWEA 4YT7L 1S0IA 1USXA 1ATDA 1HAFA 2F29A 3SRGA 1EMNA 2J4IB 4Y6DB 3FFGL 1INGA 3KL6B 2AGSA 4O02B 4KS4A 3MQEA 2BSFA 3K3AA 3ZGCA 1XOEA 4LMFA 1HCGB 4GZXA 4XJ8A 1LPZA 4CH9A 1YO8A 1Z4WA 4HIZA 1VCUA 1P0SL 1MQ6L 2YDPA 1EUTA 1W8OA 2QWHA 2HTRA 1G1RA 1V1HA 3CL2A 3K37A 1GK5A 1HAEA 3KGGA 2P26A 4MWLA 2Y82B 2XZKA 1X2RA 1X7AL 4L7DA 1EUSA 5EX7A 3N8XA 1Z4VA 2V91A 3LN0A 4X8UL 2OJHA 1LMJA 1EUUA 4YT6L 2W20A 3R05A 4I00A 5GTQA 5GX4A 3K38A 2J2UB 4GU4A 2WOZA 3HO4A 1ATAA 2QWGA 5HUGA 3SREA 1N7DA 1MS8A 3IAXA 1E8UA 2W2PE 4K1IA 4CPOA 1WCSA 3K39A 4XJWA 3ZGDA 4YZ3A 4Y71B 1EBVA 5EGMB 3QMOA 1IQHL 1PRHA 1CVMA 1N1VA 2WPJE 4Q1UA 4X47A 2DDUA 1V3EA 2J34B 4FVKA 1RFNB 4XIOA 1N1TA 2W8BA 1MR5A 1INVA 1B9SA 2F9BL 4XMAA 1E8TA 4XE9A 3W09A 4B7JA 1UZQA 5F72C 4MZEA 5NN9A 2BZ6L 5JW1A 5FNQA 3LTFB 3NO0A 2VWNL 1Z50A 3HS7A 4QN4A 1WU1B 3CS7L 1LPKA 5CKMA 1CRUA 4MWUA 1CX2A 4ZAEB 1CVWL 5IKTA 5FNRA 1F8EA 4O1ZA 3E5ZA 4YW1A 1FF7A 1NZIA 1F0SB 1RWIA 1F7MA 4WA4A 3POYA 2P3FL 4GZQA 2BQ7A 2C4LA 3NJPC 4QNPA 2YDTA 4XHBA 5JB9E 3SALA 1W8BL 4JZDL 5HX0A 4MWYA 2F26A 2XBXL 2JKHL 1OFZA 4CUDA 3HRPA 5CGJA 4IFNX 3LI3A 4XMBA 4X8VL
chains in the Genus database with same CATH topology
4IMBA 2GVXA 4M11A 4NA9L 4IYGA 2M74A 2MGPA 1G1SA 4GNAA 1YUGA 4RRWA 4ZHAB 2UWPB 1HJ7A 2IAWA 4GN9A 1URKA 1APOA 1DVAL 4XBMA 3AMRA 4Y7BB 2Q1JB 1CQ1A 3FBYA 2G8SA 2J94B 1NFWB 3BPSE 2IAUA 4AQTA 5JBCE 1MQ5L 4OTJA 5GX5A 1IGZA 2VAQA 3S94A 4X8SL 1G1TA 5E8DA 1FFMA 1L5GB 1A3PA 3DR2A 1E1AA 2BOUA 5D9DA 4XLWA 4PH9A 4C16A 1FJSL 2MHPA 1XKAL 3ENSA 3HO5A 4YZUB 4BTTA 2WG4B 2KV4A 2XBVL 2DG1A 2EI6B 3KCGL 5CISA 1JBUL 1EPIA 3N8WA 5IKRA 1L3YA 1XFEA 1PGEA 1C5KA 3LTGD 5JVZA 2IAPA 5KN5C 4JYUL 1G2LB 3HS5A 2DSOA 4JYVL 5KIRA 4HW6A 1O5DL 3NT1A 2VWOL 3FW0A 2W2NE 2WFXB 3G4HA 1SZBA 1QFKL 2UWOB 2W3KB 3CFWA 3LN1A 3QH0A 3H5CB 2RA0L 1EMOA 1EQGA 4RRZA 3N8YB 3ZYGA 1F7EA 3S8VA 2GVWA 3OLUA 3GCWE 2I9AA 4CSYA 1QLGA 1EPGA 3OLTA 1XKBA 3HPTA 5CKQA 3LC5B 2Y5FL 3Q6KA 4MMZB 2WPHE 3M36L 3RR3A 3O4PA 4CUFA 4MMYB 2Y7ZB 4MMXB 3S6XA 3DASA 1HT8A 3KYAA 3SW2A 4A0PA 1QBIA 2QE8A 1EZQB 1IQEL 3TK5B 1ATBA 1LPGA 6COXA 1FE2A 2VVVL 2P3FN 2BQWA 1KLOA 5F19A 3KQEL 1FAXL 2FP9A 4CUEA 2BMGA 2UWLB 2G00L 2TGFA 2FP8A 3Q3KB 3ZYIB 2PR3B 1K36A 3AMSA 2P94L 5L2YL 2RNLA 1EGFA 1DDXA 1JL9A 2KB9A 1CRZA 1EQHA 5GX1A 2W2QE 4RRXA 3TGFA 1FAKL 2P93L 3V65B 1LQDA 2Y5GL 4A94C 2YGPA 3WWAA 2W2ME 2VH6B 5IKVA 3Q6PA 3KQBL 1IJQA 2P3UA 2EI8B 5I46L 1HRFA 3S2KA 4NG9L 2YGQA 1ADXA 2K2TA 3N8WB 4ISIL 2ADXA 3IJEB 3TK6B 1NFYB 1CQEA 1EPJA 3KRKA 1JV2B 2BO2A 4Z0LA 1PJXA 3BYCA 3HLHA 1AUTL 1POOA 2FPBA 2XC0L 2W3IB 3ELAL 3TH3L 2OYEP 4JMLA 2P28B 4NGAL 1B9WA 3DEMA 2BOHA 1NPEA 1ATEA 4OTYA 3Q7DA 3N8VA 1IGXA 1PFXL 2FPCA 1OB1C 3V1SA 1WHFA 1HREA 1YUKB 2XBYL 5K0HB 4BXWA 1HT5A 4RS0A 4BXSA 5COXA 3ZYJB 3G4EA 2GVVA 2VH0B 4ISHL 3GISX 1BF9A 1IQFL 2RHPA 2IAOA 3LI5A 1CVUA 1IOEL 1G1QA 2XC5L 2HQSA 1V3XB 1CCFA 1EPHA 2Y38A 4D90A 2WZPP 2FLRL 3MDLA 4E1GA 4GN8A 2P16L 4Y7AB 4GNCA 3LAQA 2VWMK 4RRYA 3HO3A 3N8ZA 4COXA 4HHQA 5L30L 2BOXA 2GD4A 4ZXYL 3HLIA 1C5MF 3IITB 1TOZA 2Y7XB 2P95L 2WG3C 2NPRA 2PUQL 2DG0A 3KQCL 1V04A 3TC9A 5L2ZL 3FVZA 2W8BB 1IVOC 1U8CB 1RWLA 3K9XA 1PTHA 2GVUA 4ZXXL 4M10A 3CENL 1FSBA 1IQML 2J95B 1TLEA 2VVCK 2IASA 1W7XL 1Z6EL 1YUFA 2BQ6A 2OYUP 3GCXE 3LI4A 5FWWA 2IATA 5D9BA 1KLIL 5IKQA 5FDQA 2FZZL 1N1IA 3SOVA 3CA7A 1HX2A 3QCWA 2Y5HL 3ASIA 4JZFL 5JB8E 5GX2A 3TZIA 1PXXA 2W86A 1P9JA 2W2OE 4X8TL 2WPIE 1CCVA 1NFUB 5JVYA 1IP0A 2MGRA 4GNBA 3N8YA 2KL7A 2H9EC 2POOA 3A9GA 2WYGB 2ISMA 3S8ZA 3NTBA 2FLBL 2AYLA 5D9CA 1IQNL 2WPME 1KIGL 2WPLE 3U0SA 1DIYA 3LIWB 4D0FA 4D0EA 1Z6CA 4O5TA 5JBAE 1UZJA 2K2SB 3FCSB 1DQBA 1H6LA 1NPEB 2CJIB 2YGOA 4JZEL 3F6UL 3V64C 2W26B 2WFTA 1WHEA 1CEJA 1COUA 5GX3A 4FM5A 2H9EL 1C9UA 2IVZA 4ZLRA 1IQKL 1XDTR 4Z6AL 1TPGA 3M37L 1HZ8A 3A9HA 1K37A 2I9BA 1EAIC 3NTGA 2FD6A 5JBBE 2IAVA 1IOXA 2XC4L 4PWZA 4G1MB 1UZKA 1DX5I 3WW9A 2WYJB 3Q6TA 3KK6A 1APQA 1F0RB 1UZPA 4XL1A 2J38B 3BT1A 2WPKE 2BOKL 2Y80B 3C9AC 3SOQA 2FLGA 1Q4GA 1MOXC 1NT0A 3KQDL 4A7IA 2EI7B 2PHBB 1G2MB 4BTUA 4Z0KB 2KNIA 3U7UG 1LMMA 3TBDA 2GHSA 1U67A 1IQLL 2IAXA 1KLJL 2D1JB 4BTIA 3I1CA 4DG6A 3SOBB 2VVUL 3F1SB 3P5BL 4Y79B 1IQGL 3HS6A 2IARA 5F1AA 4BDWA 3LC3B 1KSNB 1M1XB 2XBWL 2Y81B 1NFXB 1I0UA 1IQJL 1YGCL 4RUTA 4HHOA 4ZH8B 1Q7FA 2IAQA 2P4OA 4BDXA 1NQLB 2VJ3A 4TGFA 3BT2A 2VWLL 3PGHA 1J9CL 4LORA 4R40A 4O5SA 2B7DL 4GN7A 2P3TA 1IQIL 4Y76B 3U73A 3EGFA 1ZAQA 5CKNA 4YT7L 1ATDA 1HAFA 3SRGA 1EMNA 2J4IB 4Y6DB 3FFGL 3KL6B 4O02B 3MQEA 4LMFA 1HCGB 1LPZA 1YO8A 1P0SL 1MQ6L 1G1RA 1GK5A 1HAEA 3KGGA 2P26A 2Y82B 1X7AL 5EX7A 3N8XA 2V91A 3LN0A 4X8UL 2OJHA 1LMJA 4YT6L 3R05A 5GTQA 5GX4A 2J2UB 3HO4A 1ATAA 3SREA 1N7DA 3IAXA 2W2PE 4Y71B 1EBVA 5EGMB 3QMOA 1IQHL 1PRHA 1CVMA 4Q1UA 2WPJE 2DDUA 2J34B 1RFNB 2W8BA 2F9BL 1UZQA 2BZ6L 5JW1A 3LTFB 2VWNL 3HS7A 1WU1B 3CS7L 1LPKA 5CKMA 1CRUA 1CX2A 4ZAEB 1CVWL 5IKTA 4O1ZA 3E5ZA 1FF7A 1NZIA 1F0SB 1RWIA 1F7MA 3POYA 2P3FL 2BQ7A 3NJPC 5JB9E 1W8BL 4JZDL 2XBXL 2JKHL 4CUDA 3HRPA 3LI3A 4X8VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IMB A;  2GVX A;  4M11 A;  4NA9 L;  4IYG A;  2M74 A;  2MGP A;  1G1S A;  4GNA A;  1YUG A;  4RRW A;  4ZHA B;  2UWP B;  1HJ7 A;  2IAW A;  4GN9 A;  1URK A;  1APO A;  1DVA L;  4XBM A;  3AMR A;  4Y7B B;  2Q1J B;  1CQ1 A;  3FBY A;  2G8S A;  2J94 B;  1NFW B;  3BPS E;  2IAU A;  4AQT A;  5JBC E;  1MQ5 L;  4OTJ A;  5GX5 A;  1IGZ A;  2VAQ A;  3S94 A;  4X8S L;  1G1T A;  5E8D A;  1FFM A;  1L5G B;  1A3P A;  3DR2 A;  1E1A A;  2BOU A;  5D9D A;  4XLW A;  4PH9 A;  4C16 A;  1FJS L;  2MHP A;  1XKA L;  3ENS A;  3HO5 A;  4YZU B;  4BTT A;  2WG4 B;  2KV4 A;  2XBV L;  2DG1 A;  2EI6 B;  3KCG L;  5CIS A;  1JBU L;  1EPI A;  3N8W A;  5IKR A;  1L3Y A;  1XFE A;  1PGE A;  1C5K A;  3LTG D;  5JVZ A;  2IAP A;  5KN5 C;  4JYU L;  1G2L B;  3HS5 A;  2DSO A;  4JYV L;  5KIR A;  4HW6 A;  1O5D L;  3NT1 A;  2VWO L;  3FW0 A;  2W2N E;  2WFX B;  3G4H A;  1SZB A;  1QFK L;  2UWO B;  2W3K B;  3CFW A;  3LN1 A;  3QH0 A;  3H5C B;  2RA0 L;  1EMO A;  1EQG A;  4RRZ A;  3N8Y B;  3ZYG A;  1F7E A;  3S8V A;  2GVW A;  3OLU A;  3GCW E;  2I9A A;  4CSY A;  1QLG A;  1EPG A;  3OLT A;  1XKB A;  3HPT A;  5CKQ A;  3LC5 B;  2Y5F L;  3Q6K A;  4MMZ B;  2WPH E;  3M36 L;  3RR3 A;  3O4P A;  4CUF A;  4MMY B;  2Y7Z B;  4MMX B;  3DAS A;  1HT8 A;  3KYA A;  3SW2 A;  4A0P A;  1QBI A;  2QE8 A;  1EZQ B;  1IQE L;  3TK5 B;  1ATB A;  1LPG A;  6COX A;  1FE2 A;  2VVV L;  2P3F N;  2BQW A;  1KLO A;  5F19 A;  3KQE L;  1FAX L;  2FP9 A;  4CUE A;  2BMG A;  2UWL B;  2G00 L;  2TGF A;  2FP8 A;  3Q3K B;  3ZYI B;  2PR3 B;  1K36 A;  3AMS A;  2P94 L;  5L2Y L;  2RNL A;  1EGF A;  1DDX A;  1JL9 A;  2KB9 A;  1CRZ A;  1EQH A;  5GX1 A;  2W2Q E;  4RRX A;  3TGF A;  1FAK L;  2P93 L;  3V65 B;  1LQD A;  2Y5G L;  2YGP A;  3WWA A;  2W2M E;  2VH6 B;  5IKV A;  3Q6P A;  3KQB L;  1IJQ A;  2P3U A;  2EI8 B;  5I46 L;  1HRF A;  3S2K A;  4NG9 L;  1ADX A;  2K2T A;  3N8W B;  4ISI L;  2ADX A;  3IJE B;  3TK6 B;  1NFY B;  1CQE A;  1EPJ A;  3KRK A;  1JV2 B;  2BO2 A;  4Z0L A;  1PJX A;  3BYC A;  3HLH A;  1AUT L;  1POO A;  2FPB A;  2XC0 L;  2W3I B;  3ELA L;  3TH3 L;  2OYE P;  4JML A;  2P28 B;  4NGA L;  1B9W A;  3DEM A;  2BOH A;  1NPE A;  1ATE A;  4OTY A;  3Q7D A;  3N8V A;  1IGX A;  1PFX L;  2FPC A;  1OB1 C;  3V1S A;  1WHF A;  1HRE A;  1YUK B;  2XBY L;  5K0H B;  4BXW A;  1HT5 A;  4RS0 A;  4BXS A;  5COX A;  3ZYJ B;  3G4E A;  2GVV A;  2VH0 B;  4ISH L;  3GIS X;  1BF9 A;  1IQF L;  2RHP A;  2IAO A;  3LI5 A;  1CVU A;  1IOE L;  1G1Q A;  2XC5 L;  2HQS A;  1V3X B;  1CCF A;  1EPH A;  2Y38 A;  4D90 A;  2FLR L;  3MDL A;  4E1G A;  4GN8 A;  2P16 L;  4Y7A B;  4GNC A;  3LAQ A;  2VWM K;  4RRY A;  3HO3 A;  3N8Z A;  4COX A;  4HHQ A;  5L30 L;  2BOX A;  2GD4 A;  4ZXY L;  3HLI A;  1C5M F;  3IIT B;  1TOZ A;  2Y7X B;  2P95 L;  2WG3 C;  2NPR A;  2PUQ L;  2DG0 A;  3KQC L;  1V04 A;  3TC9 A;  5L2Z L;  3FVZ A;  2W8B B;  1IVO C;  1U8C B;  1RWL A;  3K9X A;  1PTH A;  2GVU A;  4ZXX L;  4M10 A;  3CEN L;  1FSB A;  1IQM L;  2J95 B;  1TLE A;  2VVC K;  2IAS A;  1W7X L;  1Z6E L;  1YUF A;  2BQ6 A;  2OYU P;  3GCX E;  3LI4 A;  5FWW A;  2IAT A;  5D9B A;  1KLI L;  5IKQ A;  5FDQ A;  2FZZ L;  1N1I A;  3SOV A;  3CA7 A;  1HX2 A;  3QCW A;  2Y5H L;  3ASI A;  4JZF L;  5JB8 E;  5GX2 A;  3TZI A;  1PXX A;  2W86 A;  1P9J A;  2W2O E;  4X8T L;  2WPI E;  1CCV A;  1NFU B;  5JVY A;  1IP0 A;  2MGR A;  4GNB A;  3N8Y A;  2KL7 A;  2POO A;  3A9G A;  2WYG B;  2ISM A;  3S8Z A;  3NTB A;  2FLB L;  2AYL A;  5D9C A;  1IQN L;  2WPM E;  1KIG L;  2WPL E;  3U0S A;  1DIY A;  3LIW B;  4D0F A;  4D0E A;  1Z6C A;  4O5T A;  5JBA E;  1UZJ A;  2K2S B;  3FCS B;  1DQB A;  1H6L A;  1NPE B;  2CJI B;  2YGO A;  4JZE L;  3F6U L;  3V64 C;  2W26 B;  2WFT A;  1WHE A;  1CEJ A;  1COU A;  5GX3 A;  4FM5 A;  2H9E L;  1C9U A;  2IVZ A;  4ZLR A;  1IQK L;  1XDT R;  4Z6A L;  1TPG A;  3M37 L;  1HZ8 A;  3A9H A;  1K37 A;  2I9B A;  1EAI C;  3NTG A;  2FD6 A;  5JBB E;  2IAV A;  1IOX A;  2XC4 L;  4PWZ A;  4G1M B;  1UZK A;  1DX5 I;  3WW9 A;  2WYJ B;  3Q6T A;  3KK6 A;  1APQ A;  1F0R B;  1UZP A;  4XL1 A;  2J38 B;  3BT1 A;  2WPK E;  2BOK L;  2Y80 B;  3C9A C;  3SOQ A;  2FLG A;  1Q4G A;  1MOX C;  1NT0 A;  3KQD L;  4A7I A;  2EI7 B;  2PHB B;  1G2M B;  4BTU A;  4Z0K B;  3U7U G;  3TBD A;  2GHS A;  1U67 A;  1IQL L;  2IAX A;  1KLJ L;  2D1J B;  4BTI A;  3I1C A;  4DG6 A;  3SOB B;  2VVU L;  3F1S B;  3P5B L;  4Y79 B;  1IQG L;  3HS6 A;  2IAR A;  5F1A A;  4BDW A;  3LC3 B;  1KSN B;  1M1X B;  2XBW L;  2Y81 B;  1NFX B;  1I0U A;  1IQJ L;  1YGC L;  4RUT A;  4HHO A;  4ZH8 B;  1Q7F A;  2IAQ A;  2P4O A;  4BDX A;  1NQL B;  2VJ3 A;  4TGF A;  3BT2 A;  2VWL L;  3PGH A;  1J9C L;  4LOR A;  4R40 A;  4O5S A;  2B7D L;  4GN7 A;  2P3T A;  1IQI L;  4Y76 B;  3U73 A;  3EGF A;  1ZAQ A;  5CKN A;  4YT7 L;  1ATD A;  1HAF A;  3SRG A;  1EMN A;  2J4I B;  4Y6D B;  3FFG L;  3KL6 B;  4O02 B;  3MQE A;  4LMF A;  1HCG B;  1LPZ A;  1YO8 A;  1P0S L;  1MQ6 L;  1G1R A;  1GK5 A;  1HAE A;  3KGG A;  2P26 A;  2Y82 B;  1X7A L;  5EX7 A;  3N8X A;  2V91 A;  3LN0 A;  4X8U L;  2OJH A;  1LMJ A;  4YT6 L;  3R05 A;  5GTQ A;  5GX4 A;  2J2U B;  3HO4 A;  1ATA A;  3SRE A;  1N7D A;  3IAX A;  2W2P E;  4Y71 B;  1EBV A;  5EGM B;  3QMO A;  1IQH L;  1PRH A;  1CVM A;  4Q1U A;  2WPJ E;  2DDU A;  2J34 B;  1RFN B;  2W8B A;  2F9B L;  1UZQ A;  2BZ6 L;  5JW1 A;  3LTF B;  2VWN L;  3HS7 A;  1WU1 B;  3CS7 L;  1LPK A;  5CKM A;  1CRU A;  1CX2 A;  4ZAE B;  1CVW L;  5IKT A;  4O1Z A;  3E5Z A;  1FF7 A;  1NZI A;  1F0S B;  1RWI A;  1F7M A;  3POY A;  2P3F L;  2BQ7 A;  3NJP C;  5JB9 E;  1W8B L;  4JZD L;  2XBX L;  2JKH L;  4CUD A;  3HRP A;  3LI3 A;  4X8V L; 
#chains in the Genus database with same CATH topology
 2ZWA A;  4IMB A;  2FHR A;  2GVX A;  4M11 A;  4NA9 L;  4XMI A;  1NN2 A;  2F12 A;  2HU4 A;  3NSS A;  4IYG A;  4D52 B;  3TIA A;  2M74 A;  2MGP A;  1G1S A;  1NSC A;  1YUG A;  4FOQ A;  4GNA A;  5FNS A;  4RRW A;  4ZHA B;  2UWP B;  1NCB N;  1HJ7 A;  4CHB A;  2IAW A;  1NCC N;  1URK A;  3H73 A;  4GN9 A;  4IFL X;  1VCJ A;  4C1Y A;  1APO A;  1DVA L;  3WDZ A;  4XBM A;  2YA4 A;  3AMR A;  4Y7B B;  2Q1J B;  1CQ1 A;  2F28 A;  4FP2 A;  2HTQ A;  4M4N A;  3FBY A;  1NCD N;  2G8S A;  2J94 B;  4HZZ A;  1NFW B;  3BPS E;  2AH2 A;  2X9M A;  2IAU A;  5EO8 A;  5B2D A;  4AQT A;  5JBC E;  4B7Q A;  1MQ5 L;  4OTJ A;  1NMB N;  1IGZ A;  2VAQ A;  4FPJ A;  5GX5 A;  4WEF A;  4X8S L;  3S94 A;  4YZ1 A;  1G1T A;  2XN4 A;  5E8D A;  1FFM A;  3L6V A;  1L5G B;  1A3P A;  3DR2 A;  1E1A A;  4HZX A;  2BOU A;  5D9D A;  1NNC A;  4XLW A;  4PH9 A;  1Z4X A;  4NCS A;  5FZJ A;  4C16 A;  1FJS L;  2XZI A;  2MHP A;  4FOV A;  1XKA L;  3ENS A;  2ZB6 A;  1WP5 A;  3HO5 A;  4YZU B;  4BTT A;  4MWV A;  2WG4 B;  2KV4 A;  2XBV L;  2DG1 A;  3D11 A;  2EI6 B;  3KCG L;  4MWR A;  4ASC A;  5CIS A;  1IVC A;  4HZV A;  1JBU L;  2H2N A;  1EPI A;  3N8W A;  4CPY A;  5IKR A;  1L3Y A;  1XFE A;  1PGE A;  1C5K A;  2VPJ A;  2VW1 A;  1SUU A;  1N1S A;  3LTG D;  5JVZ A;  3TIB A;  2IAP A;  5KN5 C;  4JYU L;  2F25 A;  1G2L B;  4CPZ A;  1SNT A;  4GDI A;  4YW5 A;  2SLI A;  3HS5 A;  1V3C A;  2DSO A;  4JYV L;  3UC1 A;  5KIR A;  4HW6 A;  1O5D L;  1SO7 A;  3NT1 A;  4IQK A;  2VWO L;  1Z4Z A;  2W5N A;  3FW0 A;  2W2N E;  2WFX B;  3G4H A;  4GZO A;  1SZB A;  1QFK L;  4M4V A;  2UWO B;  1S18 A;  3TI8 A;  2W3K B;  1KIT A;  3GVJ A;  3CFW A;  1LK9 A;  1N6E A;  4NC5 A;  3LN1 A;  3QH0 A;  3H5C B;  2RA0 L;  1EMO A;  2BT8 A;  1EQG A;  4RRZ A;  3N8Y B;  3ZYG A;  1F7E A;  4N1B A;  3S8V A;  2GVW A;  4MX0 A;  3OLU A;  3GCW E;  2I9A A;  4CSY A;  1QLG A;  1EPG A;  2JJL A;  1NMA N;  3OLT A;  1XKB A;  2RKC A;  3HPT A;  4FPF A;  5CKQ A;  3LC5 B;  2Y5F L;  3Q6K A;  4MMZ B;  2YA8 A;  2WPH E;  3M36 L;  1U6D X;  3RR3 A;  3O4P A;  5FNU A;  4CUF A;  4GZS A;  4MMY B;  4WEG A;  2Y7Z B;  3SIL A;  4MMX B;  3S6X A;  1DIM A;  2QWB A;  4KS3 A;  3DAS A;  1HT8 A;  3KYA A;  4MC7 A;  4XHX A;  1IVE A;  3SW2 A;  3B7E A;  5F9T A;  3O9K A;  4FOW A;  3ALX A;  1F8C A;  1QBI A;  2QE8 A;  4A0P A;  1EZQ B;  2VSK A;  1W0P A;  1IQE L;  1KKE A;  2QWA A;  2HOR A;  3TK5 B;  1SLI A;  1ATB A;  4MJU A;  1LPG A;  6COX A;  1FE2 A;  2VVV L;  2P3F N;  2BQW A;  2SIM A;  4FPL A;  1KLO A;  5F19 A;  1W0O A;  3KQE L;  4GEZ A;  4G3N A;  1FAX L;  2FP9 A;  4CUE A;  2BMG A;  2UWL B;  2QWI A;  2VK5 A;  3A71 A;  2G00 L;  1N6F A;  2TGF A;  4ZGC A;  3NN9 A;  4XJ9 A;  1ZI0 A;  2FP8 A;  3Q3K B;  4MWW A;  4H52 A;  3ZYI B;  3II7 A;  2JKB A;  1K32 A;  4GDJ A;  2PR3 B;  1K36 A;  3AMS A;  2P94 L;  5L2Y L;  2RNL A;  4X4A A;  1EGF A;  4B7M A;  1DDX A;  1JL9 A;  2HT5 A;  2KB9 A;  3PJQ A;  4GU3 A;  4K1H A;  1CRZ A;  1EQH A;  5GX1 A;  5JYY A;  2F0Z A;  3H72 A;  2W2Q E;  4MWX A;  4YW4 A;  4RRX A;  3TGF A;  1FAK L;  2P93 L;  2F27 A;  3ALW A;  4Q6K A;  4CPN A;  2HTW A;  3V65 B;  3TI4 A;  1LQD A;  2Y5G L;  4A94 C;  2YGP A;  1L7H A;  3CL0 A;  3WWA A;  2W2M E;  2VH6 B;  5IKV A;  5M1Z A;  3Q6P A;  3KQB L;  1IJQ A;  4FQ4 A;  2P3U A;  3WN7 A;  2EI8 B;  1MS0 A;  5I46 L;  1NCA N;  1HRF A;  3S2K A;  4NG9 L;  2YGQ A;  1ADX A;  2K2T A;  3A72 A;  2YA6 A;  3N8W B;  4ISI L;  2ADX A;  3IJE B;  3TK6 B;  1NFY B;  1CQE A;  4XIK A;  1EPJ A;  3KRK A;  3D12 A;  4MWJ A;  4CSD A;  1JV2 B;  2BO2 A;  4Z0L A;  1PJX A;  3BYC A;  3HLH A;  4MZA A;  4KS1 A;  2H2U A;  1AUT L;  1POO A;  4GZT A;  2SIL A;  2CML A;  2FPB A;  2XC0 L;  2W3I B;  3ELA L;  3TH3 L;  2OYE P;  2AEQ A;  4JML A;  4QN6 A;  1L7F A;  2BT7 A;  2P28 B;  4NGA L;  1B9W A;  3DEM A;  1IVG A;  1N6D A;  2BOH A;  2VK6 A;  2QWD A;  1NPE A;  4XOG A;  1ATE A;  4OTY A;  3T1E A;  2FLU X;  3Q7D A;  4XJA A;  3N8V A;  3H71 A;  3INB A;  1INX A;  1IGX A;  5HUN A;  4HZY A;  2XZJ A;  1PFX L;  2FPC A;  1OB1 C;  3V1S A;  1WHF A;  4FPC A;  1HRE A;  1EUR A;  4FOY A;  1YUK B;  2XBY L;  5K0H B;  5B2C A;  4BXW A;  2C4A A;  1HT5 A;  4RS0 A;  1S1D A;  2VW0 A;  2W5O A;  4BXS A;  3K36 A;  5COX A;  3ZYJ B;  4QN7 A;  4K1J A;  3G4E A;  2F10 A;  2GVV A;  2VSM A;  2VH0 B;  2VRS A;  4XJZ A;  4ISH L;  3GIS X;  1BF9 A;  1IQF L;  1V1I A;  4D52 A;  1BJI A;  2RHP A;  1A4Q A;  3GVL A;  2IAO A;  1SLL A;  3LI5 A;  1CVU A;  1IOE L;  1G1Q A;  2XC5 L;  2HU0 A;  2ZZK A;  4ZY3 A;  2HQS A;  4CPM A;  1V3X B;  4X6K A;  1CCF A;  1EPH A;  4JF7 A;  2Y38 A;  4FPY A;  4D90 A;  1INH A;  2WZP P;  2FLR L;  3MDL A;  4E1G A;  4XYX A;  1W20 A;  4GN8 A;  2P16 L;  4Y7A B;  4GNC A;  3LAQ A;  2VWM K;  4RRY A;  3HO3 A;  3N8Z A;  4COX A;  2BZD A;  4M4U A;  4DGR A;  2BF6 A;  4HHQ A;  5L30 L;  2BOX A;  2GD4 A;  1A14 N;  4ZXY L;  1X2J A;  3TI3 A;  4YZ5 A;  2YA7 A;  3HLI A;  1C5M F;  3CKZ A;  3TI6 A;  3IIT B;  1TOZ A;  2Y7X B;  2P95 L;  2WG3 C;  2NPR A;  2PUQ L;  2DG0 A;  4K1K A;  1USR A;  2QWK A;  3KQC L;  1V04 A;  4M3M A;  3TC9 A;  5L2Z L;  3H6J A;  1XOG A;  2W8B B;  3FVZ A;  4YZ2 A;  3OPZ A;  1IVO C;  1U8C B;  1RWL A;  3K9X A;  1IVD A;  5EO7 A;  2A75 A;  4D52 C;  1PTH A;  2GVU A;  4ZXX L;  4M10 A;  4WA5 A;  3CEN L;  1FSB A;  1IQM L;  2J95 B;  1TLE A;  3BEQ A;  1MS4 A;  2VVC K;  3O9J A;  2IAS A;  1W7X L;  1B9T A;  5FZN A;  1Z6E L;  1YUF A;  1MS3 A;  1MZ5 A;  3ADE A;  4YY8 A;  2BQ6 A;  3CYE A;  2OYU P;  3GCX E;  1W21 A;  3LI4 A;  5FWW A;  2IAT A;  1MZ6 A;  5D9B A;  1KLI L;  5IKQ A;  2BAT A;  4FJ6 A;  4H53 A;  5FNT A;  3TIC A;  4UOU A;  4AH4 A;  4AHA A;  4AGI A;  5FDQ A;  4SLI A;  2FZZ L;  1N1I A;  3SOV A;  3CA7 A;  1HX2 A;  1S0J A;  4UF7 A;  3QCW A;  1L7G A;  2Y5H L;  3ASI A;  4JZF L;  5JB8 E;  2YA5 A;  5GX2 A;  3TZI A;  1PXX A;  2W86 A;  1P9J A;  2W2O E;  4X8T L;  2WPI E;  1CCV A;  4FP3 A;  1NFU B;  5JVY A;  1IP0 A;  2HOX A;  2MGR A;  4GNB A;  4IFJ A;  3N8Y A;  2KL7 A;  2H9E C;  4C1Y B;  4GB1 A;  2POO A;  3A9G A;  2WYG B;  2ISM A;  3S8Z A;  3NTB A;  2FLB L;  2F13 A;  2AYL A;  3TI5 A;  5D9C A;  1IQN L;  2AEP A;  2WPM E;  1KIG L;  2WPL E;  3U0S A;  1DIY A;  3LIW B;  4D0F A;  4D0E A;  2HTY A;  2VVZ A;  1Z6C A;  2QWJ A;  2F11 A;  4O5T A;  1NMC A;  5JBA E;  1UZJ A;  2K2S B;  3FCS B;  1DQB A;  1H6L A;  1NPE B;  2CJI B;  2YGO A;  4JZE L;  2F24 A;  3F6U L;  4MWQ A;  4AGT A;  4BBW A;  1MS1 A;  3V64 C;  4YW3 A;  2W26 B;  2WFT A;  1WHE A;  4WA3 A;  1CEJ A;  1COU A;  1F8B A;  2HT8 A;  5GX3 A;  4FM5 A;  2QWC A;  1NSD A;  2HTV A;  2H9E L;  1C9U A;  1V0Z A;  2HTU A;  2IVZ A;  4ZLR A;  1NNB A;  1INF A;  1IQK L;  1XDT R;  4Z6A L;  1TPG A;  3M37 L;  1HZ8 A;  1E8V A;  1K37 A;  3A9H A;  2I9B A;  1EAI C;  3NTG A;  1IVB A;  2HT7 A;  2Z32 A;  2XCY A;  1N1Y A;  4FZH A;  2FD6 A;  5JBB E;  2IAV A;  1IOX A;  2W38 A;  2ZW9 A;  4D8S A;  2XC4 L;  4PWZ A;  7NN9 A;  4YZ4 A;  4G1M B;  1UZK A;  1DX5 I;  3WW9 A;  2WYJ B;  4GZP A;  4MJV A;  3Q6T A;  4XIL A;  4J9T A;  4FPG A;  3KK6 A;  1APQ A;  1F0R B;  1UZP A;  4XL1 A;  2VK7 A;  4D4U A;  2J38 B;  2VWD A;  3BT1 A;  1NSB A;  2WPK E;  2BOK L;  3SAN A;  5HUK A;  2Y80 B;  3C9A C;  3SOQ A;  4CPL A;  4YW2 A;  2FLG A;  3B69 A;  4KS2 A;  1Q4G A;  2QWE A;  1MOX C;  1NT0 A;  3KQD L;  4A7I A;  1ZGK A;  1QIU A;  2EI7 B;  2PHB B;  1V3D A;  1G2M B;  4BTU A;  1MS9 A;  1IUB A;  4Z0K B;  2KNI A;  4GJT A;  4XJR A;  4QN5 A;  3U7U G;  4GZW A;  1LMM A;  3TBD A;  2GHS A;  4IN4 A;  1U67 A;  1IQL L;  4KS5 A;  1NNA A;  5H47 A;  4L7B A;  1IUC A;  1KLJ L;  2IAX A;  2D1J B;  3SLI A;  4BTI A;  1W8N A;  3I1C A;  4FPE A;  4NN9 A;  4DG6 A;  3SOB B;  2VVU L;  6NN9 A;  3JU4 A;  4X49 A;  3F1S B;  3VNG A;  4XJU A;  3P5B L;  2QWF A;  4K3Y A;  4Y79 B;  1IQG L;  4FPO B;  2VW2 A;  4FPH A;  3HS6 A;  2IAR A;  5F1A A;  4L7C A;  5HUM A;  1B9V A;  2B8H A;  4BDW A;  1V0F A;  1WCQ A;  1F8D A;  1V3B A;  3LC3 B;  1W1X A;  2ZB5 A;  1KSN B;  1IVF A;  1M1X B;  2XBW L;  2Y81 B;  1NFX B;  1V2I A;  2BER A;  1I0U A;  1IQJ L;  1YGC L;  4RUT A;  1INY A;  4HHO A;  1A4G A;  4B7R A;  4QN3 A;  3GVK A;  4ZH8 B;  1Q7F A;  2IAQ A;  2P4O A;  4BDX A;  1NQL B;  2VJ3 A;  4TGF A;  1INW A;  4FPK A;  3BT2 A;  1DIL A;  2VWL L;  3PGH A;  4B7N A;  1J9C L;  4LOR A;  4R40 A;  1V0E A;  4O5S A;  2B7D L;  1Z4Y A;  4GN7 A;  4XJQ A;  2P3T A;  1IQI L;  4Y76 B;  2DYH A;  3U73 A;  3VNH A;  1MS5 A;  3EGF A;  4HZW A;  1ZAQ A;  5CKN A;  1MWE A;  4YT7 L;  1S0I A;  1USX A;  1ATD A;  1HAF A;  2F29 A;  3SRG A;  1EMN A;  2J4I B;  4Y6D B;  3FFG L;  1ING A;  3KL6 B;  2AGS A;  4O02 B;  4KS4 A;  3MQE A;  2BSF A;  3K3A A;  3ZGC A;  1XOE A;  4LMF A;  1HCG B;  4GZX A;  4XJ8 A;  1LPZ A;  4CH9 A;  1YO8 A;  1Z4W A;  4HIZ A;  1VCU A;  1P0S L;  1MQ6 L;  2YDP A;  1EUT A;  1W8O A;  2QWH A;  2HTR A;  1G1R A;  1V1H A;  3CL2 A;  3K37 A;  1GK5 A;  1HAE A;  3KGG A;  2P26 A;  4MWL A;  2Y82 B;  2XZK A;  1X2R A;  1X7A L;  4L7D A;  1EUS A;  5EX7 A;  3N8X A;  1Z4V A;  2V91 A;  3LN0 A;  4X8U L;  2OJH A;  1LMJ A;  1EUU A;  4YT6 L;  2W20 A;  3R05 A;  4I00 A;  5GTQ A;  5GX4 A;  3K38 A;  2J2U B;  4GU4 A;  2WOZ A;  3HO4 A;  1ATA A;  2QWG A;  5HUG A;  3SRE A;  1N7D A;  1MS8 A;  3IAX A;  1E8U A;  2W2P E;  4K1I A;  4CPO A;  1WCS A;  3K39 A;  4XJW A;  3ZGD A;  4YZ3 A;  4Y71 B;  1EBV A;  5EGM B;  3QMO A;  1IQH L;  1PRH A;  1CVM A;  1N1V A;  2WPJ E;  4Q1U A;  4X47 A;  2DDU A;  1V3E A;  2J34 B;  4FVK A;  1RFN B;  4XIO A;  1N1T A;  2W8B A;  1MR5 A;  1INV A;  1B9S A;  2F9B L;  4XMA A;  1E8T A;  4XE9 A;  3W09 A;  4B7J A;  1UZQ A;  5F72 C;  4MZE A;  5NN9 A;  2BZ6 L;  5JW1 A;  5FNQ A;  3LTF B;  3NO0 A;  2VWN L;  1Z50 A;  3HS7 A;  4QN4 A;  1WU1 B;  3CS7 L;  1LPK A;  5CKM A;  1CRU A;  4MWU A;  1CX2 A;  4ZAE B;  1CVW L;  5IKT A;  5FNR A;  1F8E A;  4O1Z A;  3E5Z A;  4YW1 A;  1FF7 A;  1NZI A;  1F0S B;  1RWI A;  1F7M A;  4WA4 A;  3POY A;  2P3F L;  4GZQ A;  2BQ7 A;  2C4L A;  3NJP C;  4QNP A;  2YDT A;  4XHB A;  5JB9 E;  3SAL A;  1W8B L;  4JZD L;  5HX0 A;  4MWY A;  2F26 A;  2XBX L;  2JKH L;  1OFZ A;  4CUD A;  3HRP A;  5CGJ A;  4IFN X;  3LI3 A;  4XMB A;  4X8V L; 
#chains in the Genus database with same CATH homology
 4IMB A;  2GVX A;  4M11 A;  4NA9 L;  4IYG A;  2M74 A;  2MGP A;  1G1S A;  4GNA A;  1YUG A;  4RRW A;  4ZHA B;  2UWP B;  1HJ7 A;  2IAW A;  4GN9 A;  1URK A;  1APO A;  1DVA L;  4XBM A;  3AMR A;  4Y7B B;  2Q1J B;  1CQ1 A;  3FBY A;  2G8S A;  2J94 B;  1NFW B;  3BPS E;  2IAU A;  4AQT A;  5JBC E;  1MQ5 L;  4OTJ A;  5GX5 A;  1IGZ A;  2VAQ A;  3S94 A;  4X8S L;  1G1T A;  5E8D A;  1FFM A;  1L5G B;  1A3P A;  3DR2 A;  1E1A A;  2BOU A;  5D9D A;  4XLW A;  4PH9 A;  4C16 A;  1FJS L;  2MHP A;  1XKA L;  3ENS A;  3HO5 A;  4YZU B;  4BTT A;  2WG4 B;  2KV4 A;  2XBV L;  2DG1 A;  2EI6 B;  3KCG L;  5CIS A;  1JBU L;  1EPI A;  3N8W A;  5IKR A;  1L3Y A;  1XFE A;  1PGE A;  1C5K A;  3LTG D;  5JVZ A;  2IAP A;  5KN5 C;  4JYU L;  1G2L B;  3HS5 A;  2DSO A;  4JYV L;  5KIR A;  4HW6 A;  1O5D L;  3NT1 A;  2VWO L;  3FW0 A;  2W2N E;  2WFX B;  3G4H A;  1SZB A;  1QFK L;  2UWO B;  2W3K B;  3CFW A;  3LN1 A;  3QH0 A;  3H5C B;  2RA0 L;  1EMO A;  1EQG A;  4RRZ A;  3N8Y B;  3ZYG A;  1F7E A;  3S8V A;  2GVW A;  3OLU A;  3GCW E;  2I9A A;  4CSY A;  1QLG A;  1EPG A;  3OLT A;  1XKB A;  3HPT A;  5CKQ A;  3LC5 B;  2Y5F L;  3Q6K A;  4MMZ B;  2WPH E;  3M36 L;  3RR3 A;  3O4P A;  4CUF A;  4MMY B;  2Y7Z B;  4MMX B;  3S6X A;  3DAS A;  1HT8 A;  3KYA A;  3SW2 A;  4A0P A;  1QBI A;  2QE8 A;  1EZQ B;  1IQE L;  3TK5 B;  1ATB A;  1LPG A;  6COX A;  1FE2 A;  2VVV L;  2P3F N;  2BQW A;  1KLO A;  5F19 A;  3KQE L;  1FAX L;  2FP9 A;  4CUE A;  2BMG A;  2UWL B;  2G00 L;  2TGF A;  2FP8 A;  3Q3K B;  3ZYI B;  2PR3 B;  1K36 A;  3AMS A;  2P94 L;  5L2Y L;  2RNL A;  1EGF A;  1DDX A;  1JL9 A;  2KB9 A;  1CRZ A;  1EQH A;  5GX1 A;  2W2Q E;  4RRX A;  3TGF A;  1FAK L;  2P93 L;  3V65 B;  1LQD A;  2Y5G L;  4A94 C;  2YGP A;  3WWA A;  2W2M E;  2VH6 B;  5IKV A;  3Q6P A;  3KQB L;  1IJQ A;  2P3U A;  2EI8 B;  5I46 L;  1HRF A;  3S2K A;  4NG9 L;  2YGQ A;  1ADX A;  2K2T A;  3N8W B;  4ISI L;  2ADX A;  3IJE B;  3TK6 B;  1NFY B;  1CQE A;  1EPJ A;  3KRK A;  1JV2 B;  2BO2 A;  4Z0L A;  1PJX A;  3BYC A;  3HLH A;  1AUT L;  1POO A;  2FPB A;  2XC0 L;  2W3I B;  3ELA L;  3TH3 L;  2OYE P;  4JML A;  2P28 B;  4NGA L;  1B9W A;  3DEM A;  2BOH A;  1NPE A;  1ATE A;  4OTY A;  3Q7D A;  3N8V A;  1IGX A;  1PFX L;  2FPC A;  1OB1 C;  3V1S A;  1WHF A;  1HRE A;  1YUK B;  2XBY L;  5K0H B;  4BXW A;  1HT5 A;  4RS0 A;  4BXS A;  5COX A;  3ZYJ B;  3G4E A;  2GVV A;  2VH0 B;  4ISH L;  3GIS X;  1BF9 A;  1IQF L;  2RHP A;  2IAO A;  3LI5 A;  1CVU A;  1IOE L;  1G1Q A;  2XC5 L;  2HQS A;  1V3X B;  1CCF A;  1EPH A;  2Y38 A;  4D90 A;  2WZP P;  2FLR L;  3MDL A;  4E1G A;  4GN8 A;  2P16 L;  4Y7A B;  4GNC A;  3LAQ A;  2VWM K;  4RRY A;  3HO3 A;  3N8Z A;  4COX A;  4HHQ A;  5L30 L;  2BOX A;  2GD4 A;  4ZXY L;  3HLI A;  1C5M F;  3IIT B;  1TOZ A;  2Y7X B;  2P95 L;  2WG3 C;  2NPR A;  2PUQ L;  2DG0 A;  3KQC L;  1V04 A;  3TC9 A;  5L2Z L;  3FVZ A;  2W8B B;  1IVO C;  1U8C B;  1RWL A;  3K9X A;  1PTH A;  2GVU A;  4ZXX L;  4M10 A;  3CEN L;  1FSB A;  1IQM L;  2J95 B;  1TLE A;  2VVC K;  2IAS A;  1W7X L;  1Z6E L;  1YUF A;  2BQ6 A;  2OYU P;  3GCX E;  3LI4 A;  5FWW A;  2IAT A;  5D9B A;  1KLI L;  5IKQ A;  5FDQ A;  2FZZ L;  1N1I A;  3SOV A;  3CA7 A;  1HX2 A;  3QCW A;  2Y5H L;  3ASI A;  4JZF L;  5JB8 E;  5GX2 A;  3TZI A;  1PXX A;  2W86 A;  1P9J A;  2W2O E;  4X8T L;  2WPI E;  1CCV A;  1NFU B;  5JVY A;  1IP0 A;  2MGR A;  4GNB A;  3N8Y A;  2KL7 A;  2H9E C;  2POO A;  3A9G A;  2WYG B;  2ISM A;  3S8Z A;  3NTB A;  2FLB L;  2AYL A;  5D9C A;  1IQN L;  2WPM E;  1KIG L;  2WPL E;  3U0S A;  1DIY A;  3LIW B;  4D0F A;  4D0E A;  1Z6C A;  4O5T A;  5JBA E;  1UZJ A;  2K2S B;  3FCS B;  1DQB A;  1H6L A;  1NPE B;  2CJI B;  2YGO A;  4JZE L;  3F6U L;  3V64 C;  2W26 B;  2WFT A;  1WHE A;  1CEJ A;  1COU A;  5GX3 A;  4FM5 A;  2H9E L;  1C9U A;  2IVZ A;  4ZLR A;  1IQK L;  1XDT R;  4Z6A L;  1TPG A;  3M37 L;  1HZ8 A;  3A9H A;  1K37 A;  2I9B A;  1EAI C;  3NTG A;  2FD6 A;  5JBB E;  2IAV A;  1IOX A;  2XC4 L;  4PWZ A;  4G1M B;  1UZK A;  1DX5 I;  3WW9 A;  2WYJ B;  3Q6T A;  3KK6 A;  1APQ A;  1F0R B;  1UZP A;  4XL1 A;  2J38 B;  3BT1 A;  2WPK E;  2BOK L;  2Y80 B;  3C9A C;  3SOQ A;  2FLG A;  1Q4G A;  1MOX C;  1NT0 A;  3KQD L;  4A7I A;  2EI7 B;  2PHB B;  1G2M B;  4BTU A;  4Z0K B;  2KNI A;  3U7U G;  1LMM A;  3TBD A;  2GHS A;  1U67 A;  1IQL L;  2IAX A;  1KLJ L;  2D1J B;  4BTI A;  3I1C A;  4DG6 A;  3SOB B;  2VVU L;  3F1S B;  3P5B L;  4Y79 B;  1IQG L;  3HS6 A;  2IAR A;  5F1A A;  4BDW A;  3LC3 B;  1KSN B;  1M1X B;  2XBW L;  2Y81 B;  1NFX B;  1I0U A;  1IQJ L;  1YGC L;  4RUT A;  4HHO A;  4ZH8 B;  1Q7F A;  2IAQ A;  2P4O A;  4BDX A;  1NQL B;  2VJ3 A;  4TGF A;  3BT2 A;  2VWL L;  3PGH A;  1J9C L;  4LOR A;  4R40 A;  4O5S A;  2B7D L;  4GN7 A;  2P3T A;  1IQI L;  4Y76 B;  3U73 A;  3EGF A;  1ZAQ A;  5CKN A;  4YT7 L;  1ATD A;  1HAF A;  3SRG A;  1EMN A;  2J4I B;  4Y6D B;  3FFG L;  3KL6 B;  4O02 B;  3MQE A;  4LMF A;  1HCG B;  1LPZ A;  1YO8 A;  1P0S L;  1MQ6 L;  1G1R A;  1GK5 A;  1HAE A;  3KGG A;  2P26 A;  2Y82 B;  1X7A L;  5EX7 A;  3N8X A;  2V91 A;  3LN0 A;  4X8U L;  2OJH A;  1LMJ A;  4YT6 L;  3R05 A;  5GTQ A;  5GX4 A;  2J2U B;  3HO4 A;  1ATA A;  3SRE A;  1N7D A;  3IAX A;  2W2P E;  4Y71 B;  1EBV A;  5EGM B;  3QMO A;  1IQH L;  1PRH A;  1CVM A;  4Q1U A;  2WPJ E;  2DDU A;  2J34 B;  1RFN B;  2W8B A;  2F9B L;  1UZQ A;  2BZ6 L;  5JW1 A;  3LTF B;  2VWN L;  3HS7 A;  1WU1 B;  3CS7 L;  1LPK A;  5CKM A;  1CRU A;  1CX2 A;  4ZAE B;  1CVW L;  5IKT A;  4O1Z A;  3E5Z A;  1FF7 A;  1NZI A;  1F0S B;  1RWI A;  1F7M A;  3POY A;  2P3F L;  2BQ7 A;  3NJP C;  5JB9 E;  1W8B L;  4JZD L;  2XBX L;  2JKH L;  4CUD A;  3HRP A;  3LI3 A;  4X8V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...