1V1IA

Adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a long linker
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
109
structure length
102
Chain Sequence
VSIKKSSGLNFDNTAIAINAGKGLEFDTNTSESPDINPIKTKIGSGIDYNENGAMITKLGAGLSFDNSGAITIGNGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRITIN, FIBER PROTEIN
publication title Adenovirus Fibre Shaft Sequences Fold Into the Native Triple Beta-Spiral Fold When N-Terminally Fused to the Bacteriophage T4 Fibritin Foldon Trimerisation Motif
pubmed doi rcsb
source organism Human adenovirus c
molecule tags Adenovirus
total genus 9
structure length 102
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00608 Adeno_shaft Adenoviral fibre protein (repeat/shaft region)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.20 Mainly Beta Ribbon Laminin reovirus attachment protein sigma1; domain 1 1v1iA01
3.30.60.240 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1v1iA02
1KKEA 3S6XA 2VRSA 2JJLA 2BT8A 1V1IA 4GU4A 2BSFA 1V1HA 4GU3A 1QIUA 2BT7A
chains in the Genus database with same CATH superfamily
2MGPA 2FLGA 2P16L 1W4RA 2CWHA 2E73A 3LC5B 2XC5L 1X74A 2VWOL 1Z2IA 3N8WA 2W2OE 2PQ8A 3HPTA 1O5DL 2GKRI 2WYGB 1MJ9A 3H5CB 3TBDA 1X4SA 5I46L 2FNFX 5L2YL 1FSBA 2KNIA 2SGQI 2V53A 1YTPA 1HEVA 3MDLA 2OD1A 2QQDA 1HAFA 2VH0B 2BOHA 4FM5A 1CQEA 3MQEA 4G1MB 2PUQL 1MT1A 3LC3B 5F19A 1HRFA 1FAXL 6COXA 3Q3KB 2FZZL 4XL1A 4ZXYL 2ORVA 1G1RA 1HPTA 1HREA 3QTLD 2CJIB 1N1IA 4E1PA 1KKEA 3N8ZA 3M37L 2JJLA 5JBBE 3K9XA 2WVJA 2GIVA 3OVOA 1LMJA 4OVOA 2JZMA 2KL7A 1V1IA 2FLBL 3CFWA 2NPRA 4RRYA 1Y8FA 1IY5A 3E2IA 1TOZA 3VE5A 3N8YB 1FF7A 1KBEA 2WPME 1HT5A 1EQGA 1W8BL 2BQWA 3SOVA 4WP4A 3HO5A 5J8CA 5EX0A 1P0SL 2BOUA 2I9AA 2GVIA 1CE3A 1DDXA 2I9BA 1BMOA 4AMLA 1UVGA 3ELAL 1K36A 2DDUA 1NFXB 1R0RI 3ZYJB 5CKNA 4RRZA 2NU0I 1WGCA 4RUTA 5F1AA 1ULKA 1TBNA 1DQBA 3HO3A 5J8FA 3DEMA 1EQHA 2VVUL 2J4IB 3GCWE 1CCFA 1XBTA 1B9WA 2VH6B 4BTUA 4UXHA 2W2QE 3BT1A 2TGFA 5KIRA 3FBYA 3NTGA 2LUYA 1PJUA 2X52A 3VDPA 4O1ZA 1UZKA 2DB6A 2L7XA 4Y7BB 1Z7KB 1YO8A 3UGLA 1ULNA 4GU3A 3CA7A 3KCGL 3CS7L 3C9AC 3POYA 1NFYB 1F0SB 4JYVL 3TH3L 4CUFA 1XX6A 1HT8A 4A7IA 3R5CA 1LR9A 2K2TA 3LIWB 3UFFA 1IY6A 2GD4A 1LMMA 2UZ3A 2K2SB 3R5DA 1NFUB 1IQIL 1P9ZA 4CUDA 3UEYA 5DAEA 1XA6A 1P9GA 3N8VA 3V64C 1K37A 5JB9E 1SGPI 1EZQB 2N17A 4Y76B 1G2MB 1LK9A 3S6XA 3KQEL 2VRSA 3P5BL 1HCGB 2B7DL 2F9BL 2J94B 3QCWA 2B0UC 3TOBA 2P95L 4E1RA 1F7MA 1Y1BA 2VVCK 3NTBA 2WFXB 2W2NE 2RIJA 4MMXB 3UEJA 2M5XA 2J2UB 2ORWA 2ERWA 2QPOA 1WU1B 2D1JB 2W26B 5EGMB 1EPJA 2J9RA 1DVAL 1XFEA 5JVZA 2EI7B 3KRKA 2ODDA 2WYJB 2OYUP 3UOEA 1Q4GA 2A20A 2P3FN 3F6UL 1VDDA 2Y81B 2BOXA 1U67A 2RHPA 4Y71B 1H0ZA 1V1HA 1GK5A 4BDXA 3TK5B 3GCXE 2MGRA 1FFMA 1J9CL 1EPGA 1G1SA 4YT6L 2RNLA 1UUCA 1NXUA 1TBQR 1IQGL 2P93L 2ROWA 5K0HB 3LAQA 1LQDA 1CVUA 2JYYA 1OMTA 1XKAL 1PCEA 5FUXA 3QWPA 1IQHL 2KMPA 1ADXA 1UHAA 2K9HA 5FUYA 4X8VL 2BT8A 3OXLA 2J95B 2J34B 3BT2A 2Y0MA 4RRWA 3BJIA 1IQLL 2BZ6L 1AN1I 2XBVL 3OXFA 2DKVA 2NU3I 2YQPA 3E59A 1FYBA 1SGNI 4JCVE 1LR7A 1IP0A 2B8TA 2ENNA 1HZ8A 2SGEI 2VRWB 5JW1A 4JZDL 1F0RB 4GU4A 2V1CA 5L2ZL 1BF9A 1TURA 2W86A 3LN1A 2JXDA 1TOTA 1MOXC 4Z0LA 5L30L 5JHWC 4D90A 1I0UA 1CSOI 2Y80B 1CT0I 1SZBA 2CWFA 4CUEA 1NQLB 2WFTA 4BTTA 1YU6C 1NUBA 3CXLA 1EMNA 2RA0L 1UZPA 2KCXA 1M8CA 2SGPI 2Y7ZB 2OZUA 2XC4L 2BUSA 1PRHA 1IQNL 2LB7A 2P6AC 4JZEL 2E5RA 1ZAQA 1EPHA 4YT7L 5IKQA 4E1GA 2WPIE 2QQCA 1OMUA 3UGIA 4A94C 3ASIA 3ZYIB 4AQTA 2KV4A 2KB9A 3RR3A 1KMAA 1OYVI 4Z6AL 2VVVL 1CT2I 4Y6DB 1UZQA 2KMOA 2HORA 2CWGA 1LPKA 2WZPP 1TGSI 4BXSA 2CJSC 1G1TA 1WTJA 3SEKC 1WHEA 5CISA 4RS0A 2J87A 4ZHAB 1YUGA 1DX5I 1IGZA 4UXJA 1W3SA 3OLUA 4Y79B 1APOA 2WPJE 3RU0A 1V3XB 4ISHL 2WPHE 9WGAA 1L3YA 1YUFA 3PGHA 3R05A 2ENZA 2XRCA 2BQ6A 2ADXA 2VWNL 4SGBI 3CENL 1UVFA 3R5AA 1KLJL 2Y5FL 2F3CI 2W3IB 2P26A 1ATEA 3BPSE 3NT1A 1IGXA 1TBRR 1XKBA 2ARPF 4Z0KB 3N8WB 5JB8E 2XBWL 3N8YA 1LR8A 1NZIA 3Q7DA 4JZFL 2BOKL 1NT0A 2FD6A 5CCLA 1WKXA 1IQFL 4M11A 1KLOA 2Y38A 5CKMA 2N71A 3F1SB 4JYUL 1M8BA 4NA9L 3LTGD 3KL6B 1NFWB 4XBMA 2JW6A 4ZXXL 5CCMA 5E3PA 1IJQA 1YGCL 5FUWA 2SGDI 1R79A 3QH0A 4FKDA 1ATAA 2BT7A 3QMOA 1N7DA 1IQKL 1CGJI 1KLIL 5COXA 1S20A 1IQJL 1L5GB 1QIUA 1RFHA 1IQML 1IOXA 3TGFA 3HS7A 1MJAA 3SOQA 4MMZB 1W7XL 4OTJA 2L8EA 1FAQA 3D00A 4COXA 1OB1C 2OYEP 2GKTI 2YGQA 3HO4A 1XDTR 4TGFA 2JA1A 2XBYL 4X8SL 3MEKA 1PTRA 2YGPA 2P3TA 1TPGA 2UWLB 1PPFI 3IITB 2MHPA 1P9JA 1SGQI 2NU1I 1IOEL 2KMRA 4PH9A 3LTFB 1CEJA 1PGEA 1IQEL 1FY7A 5FDQA 4BTIA 2XBXL 3KK6A 3VDUA 3U7UG 1DS3I 1BUSA 2Y82B 4YZUB 1TBOA 1EMOA 1LPZA 1EBVA 1AUTL 2PHBB 2W2PE 2GKVA 4Y7AB 1M1XB 3TK6B 1U8CB 3QAHA 3TO6A 3OL0A 1UZJA 5FUVA 1HX2A 1HAEA 1MQ5L 1IW4A 4UXIA 1RFNB 4MMYB 2WCYA 1FJSL 4CSYA 1HJAI 1K7UA 3KY9A 4A24A 1SGDI 3SGQI 1PXXA 1WGTA 1KSNB 1TUSA 1Y1CA 3TOAA 2BMGA 2UWOB 2P3UA 1Z6CA 2UWPB 1EGFA 3M36L 3B4VC 2P94L 1EAIC 5HQ8A 2HOXA 3OXGA 2QQ0A 2Y5HL 4ZAEB 3V65B 2YUUA 3TO9A 5IKRA 2NU2I 3KQCL 4C16A 2W0TA 2KMQA 3OLTA 1MJBA 2QQEA 2NU4I 2OU2A 1N13A 3FSYA 3R5BA 1SGYI 1CHOI 3FFGL 1JV2B 3GOXA 1WHFA 5JBAE 1CT4I 4HGUA 3GISX 4OTYA 1EPIA 2VWLL 3SW2A 2LEOA 2RC4A 1OVOA 3ZYGA 2DIPA 2AYLA 4BDWA 2BQ7A 2Y7XB 1K7TA 4NG9L 2EI6B 3EGFA 2N52A 3HH2C 2G00L 3SOBB 2P28B 4XLWA 1PFXL 1ATBA 4X8TL 2WG3C 1G2LB 2PR3B 2W3KB 3PDNA 2WG4B 1KIGL 5CKQA 5JBCE 1SGRI 2H9EL 1SGEI 2EI8B 4M10A 4GI3C 4X8UL 1LPGA 1NPEB 3N8XA 2WPLE 5JVYA 3TJQA 5EX3A 2VJ3A 3TZIA 1PTQA 1YUKB 2YGOA 4D0EA 3ENSA 1URKA 2N1AB 3FCSB 2WPKE 2ELIA 1HJ7A 2W2ME 1PTHA 2BSFA 1TLEA 4D0FA 3FSXA 5E3QA 5IKTA 1HDLA 2M74A 1C5MF 2FLRL 3KQDL 2WGCA 2XC0L 3HS6A 3U73A 4BXWA 5E3RA 1Z6EL 1CGII 3FC3A 1ATDA 4MPIA 4LMFA 1FARA 4ISIL 7WGAA 1A3PA 3SGBI 5IKVA 2SGFI 1KBFA 1CX2A 1MQ6L 1TIHA 2H9EC 2Q1JB 1K7VA 1G1QA 2BO2A 2JKHL 3IJEB 2UVOA 5HI7A 2Y5GL 1DIYA 2OVOA 3LN0A 1F7EA 1Q9BA 2J38B 4B6DA 1CVWL 4LORA 1CCVA 1X7AL 1QFKL 1IVOC 3NJPC 3UGDA 4NGAL 1JBUL 2VWMK 2V1CC 1FE2A 1APQA 4RRXA 5KN5C 1DS2I 2P3FL 1U5KA 3TO7A 3HS5A 4DNCA 3KQBL 4L9MA 5E8DA 4ZH8B 1FAKL 2X3TA 1COUA 1ULMA 4O02B 1JL9A
chains in the Genus database with same CATH topology
3S6XA 2VRSA 3B4VC 1W4RA 2CJSC 1TGSI 2E73A 5HQ8A 3OXGA 2B0UC 2QQ0A 3SEKC 4E1RA 1X74A 1Y1BA 2J87A 2YUUA 2NU2I 2W0TA 2GKRI 1W3SA 4UXJA 2KMQA 3RU0A 2QQEA 1X4SA 2FNFX 2NU4I 2M5XA 3UEJA 2ORWA 1N13A 2ERWA 2QPOA 2ENZA 2XRCA 2SGQI 1SGYI 2V53A 1CHOI 1YTPA 2J9RA 4SGBI 1UVFA 2OD1A 2QQDA 3GOXA 1CT4I 2F3CI 4HGUA 2ODDA 1MT1A 1TBRR 2ARPF 2LEOA 1OVOA 2A20A 1VDDA 2DIPA 1LR8A 2ORVA 1H0ZA 1HPTA 3QTLD 1V1HA 2N52A 4E1PA 3HH2C 5CCLA 1KKEA 2JJLA 2WVJA 2N71A 1M8BA 1UUCA 3OVOA 3PDNA 1TBQR 1SGRI 4OVOA 2JW6A 1SGEI 2JZMA 5CCMA 1V1IA 2ROWA 4GI3C 1Y8FA 5FUWA 2SGDI 1R79A 1IY5A 3E2IA 3VE5A 4FKDA 3TJQA 2BT7A 5EX3A 1KBEA 1PTQA 1OMTA 2JYYA 1PCEA 1CGJI 5FUXA 3QWPA 2KMPA 2N1AB 5EX0A 5FUYA 1QIUA 1RFHA 2K9HA 2GVIA 2ELIA 1CE3A 2BT8A 3OXLA 1BMOA 1UVGA 2BSFA 2L8EA 1HDLA 3BJIA 1AN1I 3OXFA 1R0RI 3D00A 1FAQA 2GKTI 2NU0I 2NU3I 2YQPA 3E59A 1TBNA 2JA1A 1SGNI 4JCVE 1LR7A 1CGII 1FYBA 3FC3A 2B8TA 2ENNA 3MEKA 2SGEI 1PTRA 1XBTA 1FARA 2VRWB 4GU4A 2V1CA 4UXHA 3SGBI 1PPFI 1TURA 2SGFI 2JXDA 1KBFA 1SGQI 1TOTA 2NU1I 2LUYA 2KMRA 1TIHA 5JHWC 1CT0I 1PJUA 1CSOI 3VDPA 3VDUA 2DB6A 1DS3I 3CXLA 1YU6C 1NUBA 1BUSA 1TBOA 2L7XA 1Z7KB 5HI7A 2OVOA 2KCXA 1M8CA 2SGPI 3UGLA 4GU3A 2GKVA 4B6DA 3OL0A 5FUVA 2BUSA 1XX6A 1LR9A 2P6AC 2E5RA 3UGDA 1IW4A 4UXIA 3UFFA 1IY6A 2V1CC 2WCYA 1HJAI 2UZ3A 3KY9A 4A24A 2QQCA 1OMUA 1SGDI 3SGQI 3UGIA 1DS2I 3UEYA 5DAEA 1U5KA 1TUSA 1XA6A 1KMAA 1Y1CA 4L9MA 1OYVI 1SGPI 1CT2I 2N17A 2KMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKE A;  3S6X A;  2VRS A;  2JJL A;  2BT8 A;  1V1I A;  4GU4 A;  2BSF A;  1V1H A;  4GU3 A;  1QIU A;  2BT7 A; 
#chains in the Genus database with same CATH topology
 2MGP A;  2FLG A;  2P16 L;  1W4R A;  2CWH A;  2E73 A;  3LC5 B;  2XC5 L;  1X74 A;  2VWO L;  1Z2I A;  3N8W A;  2W2O E;  2PQ8 A;  3HPT A;  1O5D L;  2GKR I;  2WYG B;  1MJ9 A;  3H5C B;  3TBD A;  1X4S A;  5I46 L;  2FNF X;  5L2Y L;  1FSB A;  2KNI A;  2SGQ I;  2V53 A;  1YTP A;  1HEV A;  3MDL A;  2OD1 A;  2QQD A;  1HAF A;  2VH0 B;  2BOH A;  4FM5 A;  1CQE A;  3MQE A;  4G1M B;  2PUQ L;  1MT1 A;  3LC3 B;  5F19 A;  1HRF A;  1FAX L;  6COX A;  3Q3K B;  2FZZ L;  4XL1 A;  4ZXY L;  2ORV A;  1G1R A;  1HPT A;  1HRE A;  3QTL D;  2CJI B;  1N1I A;  4E1P A;  1KKE A;  3N8Z A;  3M37 L;  2JJL A;  5JBB E;  3K9X A;  2WVJ A;  2GIV A;  3OVO A;  1LMJ A;  4OVO A;  2JZM A;  2KL7 A;  1V1I A;  2FLB L;  3CFW A;  2NPR A;  4RRY A;  1Y8F A;  1IY5 A;  3E2I A;  1TOZ A;  3VE5 A;  3N8Y B;  1FF7 A;  1KBE A;  2WPM E;  1HT5 A;  1EQG A;  1W8B L;  2BQW A;  3SOV A;  4WP4 A;  3HO5 A;  5J8C A;  5EX0 A;  1P0S L;  2BOU A;  2I9A A;  2GVI A;  1CE3 A;  1DDX A;  2I9B A;  1BMO A;  4AML A;  1UVG A;  3ELA L;  1K36 A;  2DDU A;  1NFX B;  1R0R I;  3ZYJ B;  5CKN A;  4RRZ A;  2NU0 I;  1WGC A;  4RUT A;  5F1A A;  1ULK A;  1TBN A;  1DQB A;  3HO3 A;  5J8F A;  3DEM A;  1EQH A;  2VVU L;  2J4I B;  3GCW E;  1CCF A;  1XBT A;  1B9W A;  2VH6 B;  4BTU A;  4UXH A;  2W2Q E;  3BT1 A;  2TGF A;  5KIR A;  3FBY A;  3NTG A;  2LUY A;  1PJU A;  2X52 A;  3VDP A;  4O1Z A;  1UZK A;  2DB6 A;  2L7X A;  4Y7B B;  1Z7K B;  1YO8 A;  3UGL A;  1ULN A;  4GU3 A;  3CA7 A;  3KCG L;  3CS7 L;  3C9A C;  3POY A;  1NFY B;  1F0S B;  4JYV L;  3TH3 L;  4CUF A;  1XX6 A;  1HT8 A;  4A7I A;  3R5C A;  1LR9 A;  2K2T A;  3LIW B;  3UFF A;  1IY6 A;  2GD4 A;  1LMM A;  2UZ3 A;  2K2S B;  3R5D A;  1NFU B;  1IQI L;  1P9Z A;  4CUD A;  3UEY A;  5DAE A;  1XA6 A;  1P9G A;  3N8V A;  3V64 C;  1K37 A;  5JB9 E;  1SGP I;  1EZQ B;  2N17 A;  4Y76 B;  1G2M B;  1LK9 A;  3S6X A;  3KQE L;  2VRS A;  3P5B L;  1HCG B;  2B7D L;  2F9B L;  2J94 B;  3QCW A;  2B0U C;  3TOB A;  2P95 L;  4E1R A;  1F7M A;  1Y1B A;  2VVC K;  3NTB A;  2WFX B;  2W2N E;  2RIJ A;  4MMX B;  3UEJ A;  2M5X A;  2J2U B;  2ORW A;  2ERW A;  2QPO A;  1WU1 B;  2D1J B;  2W26 B;  5EGM B;  1EPJ A;  2J9R A;  1DVA L;  1XFE A;  5JVZ A;  2EI7 B;  3KRK A;  2ODD A;  2WYJ B;  2OYU P;  3UOE A;  1Q4G A;  2A20 A;  2P3F N;  3F6U L;  1VDD A;  2Y81 B;  2BOX A;  1U67 A;  2RHP A;  4Y71 B;  1H0Z A;  1V1H A;  1GK5 A;  4BDX A;  3TK5 B;  3GCX E;  2MGR A;  1FFM A;  1J9C L;  1EPG A;  1G1S A;  4YT6 L;  2RNL A;  1UUC A;  1NXU A;  1TBQ R;  1IQG L;  2P93 L;  2ROW A;  5K0H B;  3LAQ A;  1LQD A;  1CVU A;  2JYY A;  1OMT A;  1XKA L;  1PCE A;  5FUX A;  3QWP A;  1IQH L;  2KMP A;  1ADX A;  1UHA A;  2K9H A;  5FUY A;  4X8V L;  2BT8 A;  3OXL A;  2J95 B;  2J34 B;  3BT2 A;  2Y0M A;  4RRW A;  3BJI A;  1IQL L;  2BZ6 L;  1AN1 I;  2XBV L;  3OXF A;  2DKV A;  2NU3 I;  2YQP A;  3E59 A;  1FYB A;  1SGN I;  4JCV E;  1LR7 A;  1IP0 A;  2B8T A;  2ENN A;  1HZ8 A;  2SGE I;  2VRW B;  5JW1 A;  4JZD L;  1F0R B;  4GU4 A;  2V1C A;  5L2Z L;  1BF9 A;  1TUR A;  2W86 A;  3LN1 A;  2JXD A;  1TOT A;  1MOX C;  4Z0L A;  5L30 L;  5JHW C;  4D90 A;  1I0U A;  1CSO I;  2Y80 B;  1CT0 I;  1SZB A;  2CWF A;  4CUE A;  1NQL B;  2WFT A;  4BTT A;  1YU6 C;  1NUB A;  3CXL A;  1EMN A;  2RA0 L;  1UZP A;  2KCX A;  1M8C A;  2SGP I;  2Y7Z B;  2OZU A;  2XC4 L;  2BUS A;  1PRH A;  1IQN L;  2LB7 A;  2P6A C;  4JZE L;  2E5R A;  1ZAQ A;  1EPH A;  4YT7 L;  5IKQ A;  4E1G A;  2WPI E;  2QQC A;  1OMU A;  3UGI A;  4A94 C;  3ASI A;  3ZYI B;  4AQT A;  2KV4 A;  2KB9 A;  3RR3 A;  1KMA A;  1OYV I;  4Z6A L;  2VVV L;  1CT2 I;  4Y6D B;  1UZQ A;  2KMO A;  2HOR A;  2CWG A;  1LPK A;  2WZP P;  1TGS I;  4BXS A;  2CJS C;  1G1T A;  1WTJ A;  3SEK C;  1WHE A;  5CIS A;  4RS0 A;  2J87 A;  4ZHA B;  1YUG A;  1DX5 I;  1IGZ A;  4UXJ A;  1W3S A;  3OLU A;  4Y79 B;  1APO A;  2WPJ E;  3RU0 A;  1V3X B;  4ISH L;  2WPH E;  9WGA A;  1L3Y A;  1YUF A;  3PGH A;  3R05 A;  2ENZ A;  2XRC A;  2BQ6 A;  2ADX A;  2VWN L;  4SGB I;  3CEN L;  1UVF A;  3R5A A;  1KLJ L;  2Y5F L;  2F3C I;  2W3I B;  2P26 A;  1ATE A;  3BPS E;  3NT1 A;  1IGX A;  1TBR R;  1XKB A;  2ARP F;  4Z0K B;  3N8W B;  5JB8 E;  2XBW L;  3N8Y A;  1LR8 A;  1NZI A;  3Q7D A;  4JZF L;  2BOK L;  1NT0 A;  2FD6 A;  5CCL A;  1WKX A;  1IQF L;  4M11 A;  1KLO A;  2Y38 A;  5CKM A;  2N71 A;  3F1S B;  4JYU L;  1M8B A;  4NA9 L;  3LTG D;  3KL6 B;  1NFW B;  4XBM A;  2JW6 A;  4ZXX L;  5CCM A;  5E3P A;  1IJQ A;  1YGC L;  5FUW A;  2SGD I;  1R79 A;  3QH0 A;  4FKD A;  1ATA A;  2BT7 A;  3QMO A;  1N7D A;  1IQK L;  1CGJ I;  1KLI L;  5COX A;  1S20 A;  1IQJ L;  1L5G B;  1QIU A;  1RFH A;  1IQM L;  1IOX A;  3TGF A;  3HS7 A;  1MJA A;  3SOQ A;  4MMZ B;  1W7X L;  4OTJ A;  2L8E A;  1FAQ A;  3D00 A;  4COX A;  1OB1 C;  2OYE P;  2GKT I;  2YGQ A;  3HO4 A;  1XDT R;  4TGF A;  2JA1 A;  2XBY L;  4X8S L;  3MEK A;  1PTR A;  2YGP A;  2P3T A;  1TPG A;  2UWL B;  1PPF I;  3IIT B;  2MHP A;  1P9J A;  1SGQ I;  2NU1 I;  1IOE L;  2KMR A;  4PH9 A;  3LTF B;  1CEJ A;  1PGE A;  1IQE L;  1FY7 A;  5FDQ A;  4BTI A;  2XBX L;  3KK6 A;  3VDU A;  3U7U G;  1DS3 I;  1BUS A;  2Y82 B;  4YZU B;  1TBO A;  1EMO A;  1LPZ A;  1EBV A;  1AUT L;  2PHB B;  2W2P E;  2GKV A;  4Y7A B;  1M1X B;  3TK6 B;  1U8C B;  3QAH A;  3TO6 A;  3OL0 A;  1UZJ A;  5FUV A;  1HX2 A;  1HAE A;  1MQ5 L;  1IW4 A;  4UXI A;  1RFN B;  4MMY B;  2WCY A;  1FJS L;  4CSY A;  1HJA I;  1K7U A;  3KY9 A;  4A24 A;  1SGD I;  3SGQ I;  1PXX A;  1WGT A;  1KSN B;  1TUS A;  1Y1C A;  3TOA A;  2BMG A;  2UWO B;  2P3U A;  1Z6C A;  2UWP B;  1EGF A;  3M36 L;  3B4V C;  2P94 L;  1EAI C;  5HQ8 A;  2HOX A;  3OXG A;  2QQ0 A;  2Y5H L;  4ZAE B;  3V65 B;  2YUU A;  3TO9 A;  5IKR A;  2NU2 I;  3KQC L;  4C16 A;  2W0T A;  2KMQ A;  3OLT A;  1MJB A;  2QQE A;  2NU4 I;  2OU2 A;  1N13 A;  3FSY A;  3R5B A;  1SGY I;  1CHO I;  3FFG L;  1JV2 B;  3GOX A;  1WHF A;  5JBA E;  1CT4 I;  4HGU A;  3GIS X;  4OTY A;  1EPI A;  2VWL L;  3SW2 A;  2LEO A;  2RC4 A;  1OVO A;  3ZYG A;  2DIP A;  2AYL A;  4BDW A;  2BQ7 A;  2Y7X B;  1K7T A;  4NG9 L;  2EI6 B;  3EGF A;  2N52 A;  3HH2 C;  2G00 L;  3SOB B;  2P28 B;  4XLW A;  1PFX L;  1ATB A;  4X8T L;  2WG3 C;  1G2L B;  2PR3 B;  2W3K B;  3PDN A;  2WG4 B;  1KIG L;  5CKQ A;  5JBC E;  1SGR I;  2H9E L;  1SGE I;  2EI8 B;  4M10 A;  4GI3 C;  4X8U L;  1LPG A;  1NPE B;  3N8X A;  2WPL E;  5JVY A;  3TJQ A;  5EX3 A;  2VJ3 A;  3TZI A;  1PTQ A;  1YUK B;  2YGO A;  4D0E A;  3ENS A;  1URK A;  2N1A B;  3FCS B;  2WPK E;  2ELI A;  1HJ7 A;  2W2M E;  1PTH A;  2BSF A;  1TLE A;  4D0F A;  3FSX A;  5E3Q A;  5IKT A;  1HDL A;  2M74 A;  1C5M F;  2FLR L;  3KQD L;  2WGC A;  2XC0 L;  3HS6 A;  3U73 A;  4BXW A;  5E3R A;  1Z6E L;  1CGI I;  3FC3 A;  1ATD A;  4MPI A;  4LMF A;  1FAR A;  4ISI L;  7WGA A;  1A3P A;  3SGB I;  5IKV A;  2SGF I;  1KBF A;  1CX2 A;  1MQ6 L;  1TIH A;  2H9E C;  2Q1J B;  1K7V A;  1G1Q A;  2BO2 A;  2JKH L;  3IJE B;  2UVO A;  5HI7 A;  2Y5G L;  1DIY A;  2OVO A;  3LN0 A;  1F7E A;  1Q9B A;  2J38 B;  4B6D A;  1CVW L;  4LOR A;  1CCV A;  1X7A L;  1QFK L;  1IVO C;  3NJP C;  3UGD A;  4NGA L;  1JBU L;  2VWM K;  2V1C C;  1FE2 A;  1APQ A;  4RRX A;  5KN5 C;  1DS2 I;  2P3F L;  1U5K A;  3TO7 A;  3HS5 A;  4DNC A;  3KQB L;  4L9M A;  5E8D A;  4ZH8 B;  1FAK L;  2X3T A;  1COU A;  1ULM A;  4O02 B;  1JL9 A; 
#chains in the Genus database with same CATH homology
 3S6X A;  2VRS A;  3B4V C;  1W4R A;  2CJS C;  1TGS I;  2E73 A;  5HQ8 A;  3OXG A;  2B0U C;  2QQ0 A;  3SEK C;  4E1R A;  1X74 A;  1Y1B A;  2J87 A;  2YUU A;  2NU2 I;  2W0T A;  2GKR I;  1W3S A;  4UXJ A;  2KMQ A;  3RU0 A;  2QQE A;  1X4S A;  2FNF X;  2NU4 I;  2M5X A;  3UEJ A;  2ORW A;  1N13 A;  2ERW A;  2QPO A;  2ENZ A;  2XRC A;  2SGQ I;  1SGY I;  2V53 A;  1CHO I;  1YTP A;  2J9R A;  4SGB I;  1UVF A;  2OD1 A;  2QQD A;  3GOX A;  1CT4 I;  2F3C I;  4HGU A;  2ODD A;  1MT1 A;  1TBR R;  2ARP F;  2LEO A;  1OVO A;  2A20 A;  1VDD A;  2DIP A;  1LR8 A;  2ORV A;  1H0Z A;  1HPT A;  3QTL D;  1V1H A;  2N52 A;  4E1P A;  3HH2 C;  5CCL A;  1KKE A;  2JJL A;  2WVJ A;  2N71 A;  1M8B A;  1UUC A;  3OVO A;  3PDN A;  1TBQ R;  1SGR I;  4OVO A;  2JW6 A;  1SGE I;  2JZM A;  5CCM A;  1V1I A;  2ROW A;  4GI3 C;  1Y8F A;  5FUW A;  2SGD I;  1R79 A;  1IY5 A;  3E2I A;  3VE5 A;  4FKD A;  3TJQ A;  2BT7 A;  5EX3 A;  1KBE A;  1PTQ A;  1OMT A;  2JYY A;  1PCE A;  1CGJ I;  5FUX A;  3QWP A;  2KMP A;  2N1A B;  5EX0 A;  5FUY A;  1QIU A;  1RFH A;  2K9H A;  2GVI A;  2ELI A;  1CE3 A;  2BT8 A;  3OXL A;  1BMO A;  1UVG A;  2BSF A;  2L8E A;  1HDL A;  3BJI A;  1AN1 I;  3OXF A;  1R0R I;  3D00 A;  1FAQ A;  2GKT I;  2NU0 I;  2NU3 I;  2YQP A;  3E59 A;  1TBN A;  2JA1 A;  1SGN I;  4JCV E;  1LR7 A;  1CGI I;  1FYB A;  3FC3 A;  2B8T A;  2ENN A;  3MEK A;  2SGE I;  1PTR A;  1XBT A;  1FAR A;  2VRW B;  4GU4 A;  2V1C A;  4UXH A;  3SGB I;  1PPF I;  1TUR A;  2SGF I;  2JXD A;  1KBF A;  1SGQ I;  1TOT A;  2NU1 I;  2LUY A;  2KMR A;  1TIH A;  5JHW C;  1CT0 I;  1PJU A;  1CSO I;  3VDP A;  3VDU A;  2DB6 A;  1DS3 I;  3CXL A;  1YU6 C;  1NUB A;  1BUS A;  1TBO A;  2L7X A;  1Z7K B;  5HI7 A;  2OVO A;  2KCX A;  1M8C A;  2SGP I;  3UGL A;  4GU3 A;  2GKV A;  4B6D A;  3OL0 A;  5FUV A;  2BUS A;  1XX6 A;  1LR9 A;  2P6A C;  2E5R A;  3UGD A;  1IW4 A;  4UXI A;  3UFF A;  1IY6 A;  2V1C C;  2WCY A;  1HJA I;  2UZ3 A;  3KY9 A;  4A24 A;  2QQC A;  1OMU A;  1SGD I;  3SGQ I;  3UGI A;  1DS2 I;  3UEY A;  5DAE A;  1U5K A;  1TUS A;  1XA6 A;  1KMA A;  1Y1C A;  4L9M A;  1OYV I;  1SGP I;  1CT2 I;  2N17 A;  2KMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...