1V1IA

Adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a long linker
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
109
structure length
102
Chain Sequence
VSIKKSSGLNFDNTAIAINAGKGLEFDTNTSESPDINPIKTKIGSGIDYNENGAMITKLGAGLSFDNSGAITIGNGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRITIN, FIBER PROTEIN
publication title Adenovirus Fibre Shaft Sequences Fold Into the Native Triple Beta-Spiral Fold When N-Terminally Fused to the Bacteriophage T4 Fibritin Foldon Trimerisation Motif
pubmed doi rcsb
source organism Human adenovirus c
molecule tags Adenovirus
total genus 9
structure length 102
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00608 Adeno_shaft Adenoviral fibre protein (repeat/shaft region)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.20 Mainly Beta Ribbon Laminin reovirus attachment protein sigma1; domain 1 1v1iA01
3.30.60.240 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1v1iA02
2BT8A 1KKEA 2VRSA 4GU3A 1QIUA 2JJLA 1V1HA 3S6XA 1V1IA 2BSFA 4GU4A 2BT7A
chains in the Genus database with same CATH superfamily
2WYGB 1DIYA 1IOXA 1XKAL 3CS7L 1FFMA 1FSBA 1K7UA 1PCEA 1URKA 1R79A 1TIHA 3FSYA 3H5CB 1UVGA 1XDTR 2EI6B 4Y71B 3RU0A 1NT0A 1BUSA 3LN1A 1Z7KB 2BZ6L 5DAEA 3HS5A 1OMTA 1U67A 3LC3B 2Y7ZB 3CENL 3OLUA 3RR3A 3TO9A 3UFFA 4MMYB 1KLJL 3KY9A 3TJQA 3N8VA 1PTQA 1W3SA 1IQML 4M11A 4E1RA 2ORVA 1S20A 1O5DL 5CCLA 1H0ZA 3R5DA 1CX2A 2UZ3A 3KCGL 5IKRA 2BT7A 1TURA 2BOHA 4X8TL 2NPRA 5IKVA 5CISA 1G1QA 2JYYA 2P93L 1V3XB 3TOBA 2XRCA 1W8BL 1DX5I 4CSYA 4CUDA 2P26A 3FFGL 2OU2A 1IY6A 1HRFA 2MHPA 3LAQA 2BO2A 3D00A 1IQNL 1FY7A 2P6AC 4COXA 3SOBB 2LEOA 4E1PA 1B9WA 1SGYI 3KQBL 2WPME 2J9RA 1CT4I 2VRWB 4RS0A 2VWNL 4RRXA 1XA6A 3ZYJB 1NFXB 2VVUL 1SGEI 2V53A 3KQEL 3KQDL 3LTFB 3U73A 2OYEP 4JZDL 2OYUP 3NJPC 1AUTL 2FLRL 3POYA 1UZQA 4Y6DB 5CKMA 1HREA 5F1AA 2K9HA 2YGPA 4D0FA 2ENNA 2GKTI 2B7DL 1CVWL 1EPIA 2WFTA 3HS7A 4YT7L 2E73A 3TZIA 1NXUA 2OZUA 5KIRA 2ODDA 1Y1BA 1ATAA 1KKEA 1ADXA 2J4IB 1SGDI 1HZ8A 2QQCA 1HJ7A 1HX2A 3HO3A 3HO4A 3E2IA 2J38B 5F19A 1XFEA 1PTHA 4ISIL 4Z6AL 2WYJB 1ZAQA 2Y5FL 3F6UL 3QMOA 1U5KA 1JBUL 2ADXA 3QTLD 1LPGA 1UZJA 1TGSI 1AN1I 4JZFL 2WZPP 3V65B 1UVFA 3TO6A 2WPJE 3SW2A 1ULNA 2GIVA 1G2LB 4X8VL 4Y7AB 2BT8A 2BQWA 4UXIA 1BMOA 2KB9A 3N8YA 2W86A 1Z6EL 1EAIC 2V1CA 1YO8A 2WVJA 1TPGA 1F0RB 1GK5A 1JV2B 3UGLA 3GOXA 5JBCE 2J95B 2JKHL 4GU4A 3QAHA 3N8WB 1PJUA 4BTIA 3M36L 1CHOI 3QCWA 1IGZA 3ZYIB 2BOUA 2A20A 2W3IB 1FE2A 3ASIA 1FARA 2E5RA 3EGFA 3SOQA 2WG4B 5JBAE 1W4RA 5E3RA 3UEJA 2Y7XB 2FNFX 3SOVA 4BXWA 3SGQI 4A7IA 4JZEL 2SGPI 1OYVI 5JVZA 1MQ6L 2W2QE 1UHAA 1LMJA 3PGHA 9WGAA 3KQCL 1KBEA 1HDLA 4A24A 1P9ZA 4O02B 2P94L 1G1SA 2M5XA 4BTTA 4LMFA 5JHWC 1P9JA 5L2YL 1M1XB 2N1AB 1IY5A 2P3TA 3IJEB 3ZYGA 4MMZB 2YUUA 2PHBB 1IQJL 1JL9A 1IQFL 4ZAEB 2MGRA 1CCVA 2JZMA 1G2MB 2LUYA 2UVOA 2KMQA 3VDUA 1EPHA 1ATDA 2DIPA 2JA1A 1MJAA 2N71A 1KIGL 2CWFA 1HAEA 2I9BA 1W7XL 1EZQB 3U7UG 1TBOA 4E1GA 2H9EC 2X52A 3OL0A 2CJIB 2BQ6A 4ZXYL 1A3PA 2QQDA 2P16L 1PTRA 2V1CC 3FSXA 2D1JB 2VWOL 4Z0LA 1MOXC 3Q3KB 4DNCA 1FAXL 2EI8B 2LB7A 1CE3A 1CT2I 1J9CL 2NU0I 3MQEA 1TOZA 1QIUA 1N13A 2FD6A 1NUBA 4AQTA 4MPIA 5HI7A 1SZBA 4X8UL 4PH9A 4RRWA 1SGNI 3UGDA 2Y81B 2CJSC 3P5BL 1LPKA 2ENZA 2VWLL 4YT6L 1PXXA 2BOXA 5L30L 2WPKE 4A94C 1YTPA 1DQBA 2J87A 1X4SA 1TBQR 1ATBA 2K2SB 3LC5B 1LPZA 2MGPA 5EX3A 1ULKA 4L9MA 3UEYA 1CGII 4TGFA 1V1IA 2AYLA 5JB8E 1HCGB 5CKNA 2FLGA 1CT0I 2CWGA 2QPOA 2SGEI 1U8CB 4NA9L 4OVOA 2KCXA 1EGFA 2J2UB 1F0SB 5J8FA 2FZZL 2VWMK 1MJBA 3GCXE 4X8SL 5FUXA 1KLIL 4Y79B 3UOEA 1HT5A 1PPFI 3B4VC 1M8CA 3SGBI 2QQ0A 4BDWA 1TUSA 2DB6A 3CA7A 2X3TA 3V64C 1Q4GA 3PDNA 4RRYA 2TGFA 2VVVL 1TBNA 2VH0B 5JB9E 1HJAI 3LIWB 4ZH8B 2RHPA 2XBWL 2GVIA 1IGXA 1F7EA 5EX0A 2WCYA 1EQGA 2WFXB 2Y0MA 1SGPI 3R5AA 4XL1A 2WGCA 3OLTA 2KL7A 4BDXA 1CGJI 1CCFA 2SGFI 1Z6CA 2UWLB 1RFHA 1EQHA 2GD4A 1V1HA 3TBDA 2SGQI 1K7VA 2OVOA 1LR7A 1EPGA 1HT8A 3C9AC 5HQ8A 3OXFA 3VDPA 1OMUA 1BF9A 1WU1B 2UWOB 1NFUB 1LR8A 1RFNB 5IKQA 3GCWE 1CSOI 1P9GA 1WKXA 3NT1A 3FCSB 5EGMB 1FJSL 1LMMA 2W2PE 2NU3I 1KMAA 1IQGL 2P28B 2WPIE 1QFKL 3BT2A 1EMNA 3M37L 3F1SB 4AMLA 2F9BL 2GKVA 2VRSA 4UXHA 2XC5L 4XBMA 4LORA 3CXLA 1G1RA 1YU6C 2ORWA 4GU3A 1SGRI 3TGFA 2XBYL 4NG9L 3TK6B 5FUYA 2J34B 3ENSA 2B8TA 1IP0A 4RUTA 1NQLB 3HPTA 3OXGA 1I0UA 1F7MA 2YGOA 2J94B 2CWHA 2F3CI 5IKTA 4XLWA 2RA0L 3DEMA 3Q7DA 2BSFA 2EI7B 1WGTA 2XBXL 2W3KB 4BXSA 1C5MF 2BOKL 4HGUA 1HEVA 1KLOA 2K2TA 1IJQA 2P3FL 5E3PA 3KK6A 4MMXB 3CFWA 2YQPA 3FBYA 1G1TA 1PFXL 2NU2I 2UWPB 2P95L 4BTUA 1IQHL 1APOA 2RC4A 4ZXXL 3N8YB 2KV4A 5J8CA 1NPEB 1DDXA 3MEKA 1N7DA 1IOEL 1EBVA 1EPJA 4ISHL 3UGIA 5COXA 1Y1CA 1CEJA 2H9EL 3N8XA 3N8ZA 2PQ8A 2N52A 5FDQA 2RIJA 2G00L 3OXLA 3SEKC 4B6DA 2M74A 3HO5A 4C16A 4D0EA 1XBTA 2Y5HL 1FAQA 2KMOA 1SGQI 3BPSE 1NZIA 2WPLE 2BMGA 2FLBL 3GISX 4ZHAB 2JW6A 2KMPA 1UUCA 2ERWA 1NFYB 2RNLA 1HPTA 1DS2I 2PUQL 2BUSA 1APQA 3N8WA 1K36A 2XC0L 3ELAL 2NU1I 4OTJA 3LN0A 3NTGA 3R5CA 1X7AL 2Y5GL 3TOAA 2L7XA 1ULMA 2SGDI 4M10A 5E3QA 4JCVE 1LQDA 2B0UC 1XKBA 1DS3I 1FF7A 1FYBA 2WPHE 5KN5C 5JBBE 3VE5A 5JW1A 1YUKB 1KSNB 1MQ5L 1EMOA 1TLEA 1Q9BA 2HORA 4Y7BB 3K9XA 7WGAA 1YUFA 3HH2C 2Q1JB 1TBRR 2VJ3A 5K0HB 1PGEA 1Y8FA 3E59A 4GI3C 3NTBA 1P0SL 1COUA 3LTGD 2DKVA 5L2ZL 3QWPA 3TH3L 4G1MB 2W26B 2XBVL 4D90A 1K37A 3BJIA 2W2ME 1XX6A 2HOXA 5CKQA 1IQLL 1LR9A 4JYUL 2VVCK 2ARPF 1X74A 2P3UA 1L5GB 3IITB 1TOTA 1WHEA 3TO7A 4Z0KB 1UZKA 1M8BA 1UZPA 2DDUA 6COXA 1IQIL 3KL6B 3KRKA 2L8EA 2OD1A 1KBFA 2KNIA 4RRZA 2WG3C 2Y80B 3R05A 4CUEA 2BQ7A 2QQEA 2W0TA 1DVAL 2YGQA 1CQEA 4SGBI 2JXDA 3QH0A 4OTYA 1ATEA 1K7TA 5CCMA 1FAKL 5JVYA 1PRHA 5FUVA 4Y76B 1OB1C 1VDDA 1WTJA 2KMRA 3R5BA 4FKDA 3FC3A 2N17A 1IW4A 2W2OE 1HAFA 3S6XA 1NFWB 1IQEL 1YGCL 4NGAL 1Z2IA 1YUGA 1R0RI 3OVOA 1N1IA 3HS6A 2JJLA 2W2NE 2GKRI 2I9AA 1WGCA 2PR3B 5I46L 4UXJA 3TK5B 1MT1A 1IQKL 1L3YA 3MDLA 2XC4L 2Y38A 4WP4A 3BT1A 1WHFA 4FM5A 1MJ9A 2ELIA 5FUWA 5E8DA 1LK9A 2Y82B 2ROWA 4O1ZA 1CVUA 4JYVL 1IVOC 2VH6B 2NU4I 2P3FN 4YZUB 1OVOA 4CUFA
chains in the Genus database with same CATH topology
2V1CA 2WVJA 5FUXA 1XBTA 1PPFI 3B4VC 1TIHA 1R79A 1PCEA 1FAQA 1M8CA 2KMOA 1SGQI 3SGBI 2QQ0A 3UGLA 3GOXA 1UVGA 1TUSA 2DB6A 4GU4A 1PJUA 1CHOI 2JW6A 1UUCA 2ERWA 2KMPA 3RU0A 1HPTA 3PDNA 1BUSA 1DS2I 1Z7KB 1TBNA 2BUSA 5DAEA 1OMTA 2A20A 1HJAI 1FARA 2E5RA 3UFFA 2GVIA 2NU1I 3KY9A 5EX0A 3UEJA 1W4RA 2WCYA 3TJQA 1PTQA 2FNFX 1W3SA 2L7XA 1SGPI 2SGDI 4E1RA 2ORVA 4JCVE 2B0UC 5CCLA 1H0ZA 3SGQI 1DS3I 1FYBA 2UZ3A 2SGPI 3VE5A 1OYVI 1CGJI 2BT7A 1TURA 2SGFI 2JYYA 1RFHA 1KBEA 1V1HA 3HH2C 2SGQI 1HDLA 2XRCA 2OVOA 4A24A 1LR7A 1TBRR 5HQ8A 1Y8FA 2M5XA 3E59A 4GI3C 5JHWC 3OXFA 1IY6A 3VDPA 2N1AB 1OMUA 1IY5A 3QWPA 3D00A 2P6AC 2YUUA 1LR8A 2LEOA 4E1PA 1SGYI 1CSOI 2J9RA 2VRWB 1CT4I 2JZMA 3BJIA 1XX6A 2LUYA 2KMQA 3VDUA 2DIPA 1LR9A 2JA1A 1XA6A 2NU3I 2ARPF 1KMAA 1X74A 2N71A 1SGEI 2V53A 1TOTA 1TBOA 2GKVA 2VRSA 3OL0A 1M8BA 4UXHA 3CXLA 2L8EA 2QQDA 1PTRA 2OD1A 2V1CC 1YU6C 2ORWA 1KBFA 4GU3A 1SGRI 2K9HA 2ENNA 2GKTI 1CE3A 5FUYA 2QQEA 1CT2I 2NU0I 2W0TA 2E73A 1QIUA 1N13A 2B8TA 1NUBA 4SGBI 5HI7A 2JXDA 3OXGA 2ODDA 1Y1BA 1SGNI 1KKEA 5CCMA 3UGDA 1SGDI 2QQCA 2F3CI 2CJSC 5FUVA 1VDDA 2KMRA 4FKDA 2ENZA 2BSFA 3FC3A 3E2IA 2N17A 1IW4A 3S6XA 4HGUA 1R0RI 3OVOA 1YTPA 1U5KA 2JJLA 2J87A 2GKRI 2YQPA 1X4SA 4UXJA 3QTLD 1MT1A 1TGSI 1AN1I 1TBQR 2NU2I 2ELIA 5EX3A 4L9MA 5FUWA 1UVFA 1CGII 3UEYA 3MEKA 1V1IA 3UGIA 2SGEI 1CT0I 2QPOA 1Y1CA 4OVOA 2ROWA 2BT8A 4UXIA 1BMOA 2KCXA 2NU4I 2N52A 1OVOA 4B6DA 3SEKC 3OXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BT8 A;  1KKE A;  2VRS A;  4GU3 A;  1QIU A;  2JJL A;  1V1H A;  3S6X A;  1V1I A;  2BSF A;  4GU4 A;  2BT7 A; 
#chains in the Genus database with same CATH topology
 2WYG B;  1DIY A;  1IOX A;  1XKA L;  3CS7 L;  1FFM A;  1FSB A;  1K7U A;  1PCE A;  1URK A;  1R79 A;  1TIH A;  3FSY A;  3H5C B;  1UVG A;  1XDT R;  2EI6 B;  4Y71 B;  3RU0 A;  1NT0 A;  1BUS A;  3LN1 A;  1Z7K B;  2BZ6 L;  5DAE A;  3HS5 A;  1OMT A;  1U67 A;  3LC3 B;  2Y7Z B;  3CEN L;  3OLU A;  3RR3 A;  3TO9 A;  3UFF A;  4MMY B;  1KLJ L;  3KY9 A;  3TJQ A;  3N8V A;  1PTQ A;  1W3S A;  1IQM L;  4M11 A;  4E1R A;  2ORV A;  1S20 A;  1O5D L;  5CCL A;  1H0Z A;  3R5D A;  1CX2 A;  2UZ3 A;  3KCG L;  5IKR A;  2BT7 A;  1TUR A;  2BOH A;  4X8T L;  2NPR A;  5IKV A;  5CIS A;  1G1Q A;  2JYY A;  2P93 L;  1V3X B;  3TOB A;  2XRC A;  1W8B L;  1DX5 I;  4CSY A;  4CUD A;  2P26 A;  3FFG L;  2OU2 A;  1IY6 A;  1HRF A;  2MHP A;  3LAQ A;  2BO2 A;  3D00 A;  1IQN L;  1FY7 A;  2P6A C;  4COX A;  3SOB B;  2LEO A;  4E1P A;  1B9W A;  1SGY I;  3KQB L;  2WPM E;  2J9R A;  1CT4 I;  2VRW B;  4RS0 A;  2VWN L;  4RRX A;  1XA6 A;  3ZYJ B;  1NFX B;  2VVU L;  1SGE I;  2V53 A;  3KQE L;  3KQD L;  3LTF B;  3U73 A;  2OYE P;  4JZD L;  2OYU P;  3NJP C;  1AUT L;  2FLR L;  3POY A;  1UZQ A;  4Y6D B;  5CKM A;  1HRE A;  5F1A A;  2K9H A;  2YGP A;  4D0F A;  2ENN A;  2GKT I;  2B7D L;  1CVW L;  1EPI A;  2WFT A;  3HS7 A;  4YT7 L;  2E73 A;  3TZI A;  1NXU A;  2OZU A;  5KIR A;  2ODD A;  1Y1B A;  1ATA A;  1KKE A;  1ADX A;  2J4I B;  1SGD I;  1HZ8 A;  2QQC A;  1HJ7 A;  1HX2 A;  3HO3 A;  3HO4 A;  3E2I A;  2J38 B;  5F19 A;  1XFE A;  1PTH A;  4ISI L;  4Z6A L;  2WYJ B;  1ZAQ A;  2Y5F L;  3F6U L;  3QMO A;  1U5K A;  1JBU L;  2ADX A;  3QTL D;  1LPG A;  1UZJ A;  1TGS I;  1AN1 I;  4JZF L;  2WZP P;  3V65 B;  1UVF A;  3TO6 A;  2WPJ E;  3SW2 A;  1ULN A;  2GIV A;  1G2L B;  4X8V L;  4Y7A B;  2BT8 A;  2BQW A;  4UXI A;  1BMO A;  2KB9 A;  3N8Y A;  2W86 A;  1Z6E L;  1EAI C;  2V1C A;  1YO8 A;  2WVJ A;  1TPG A;  1F0R B;  1GK5 A;  1JV2 B;  3UGL A;  3GOX A;  5JBC E;  2J95 B;  2JKH L;  4GU4 A;  3QAH A;  3N8W B;  1PJU A;  4BTI A;  3M36 L;  1CHO I;  3QCW A;  1IGZ A;  3ZYI B;  2BOU A;  2A20 A;  2W3I B;  1FE2 A;  3ASI A;  1FAR A;  2E5R A;  3EGF A;  3SOQ A;  2WG4 B;  5JBA E;  1W4R A;  5E3R A;  3UEJ A;  2Y7X B;  2FNF X;  3SOV A;  4BXW A;  3SGQ I;  4A7I A;  4JZE L;  2SGP I;  1OYV I;  5JVZ A;  1MQ6 L;  2W2Q E;  1UHA A;  1LMJ A;  3PGH A;  9WGA A;  3KQC L;  1KBE A;  1HDL A;  4A24 A;  1P9Z A;  4O02 B;  2P94 L;  1G1S A;  2M5X A;  4BTT A;  4LMF A;  5JHW C;  1P9J A;  5L2Y L;  1M1X B;  2N1A B;  1IY5 A;  2P3T A;  3IJE B;  3ZYG A;  4MMZ B;  2YUU A;  2PHB B;  1IQJ L;  1JL9 A;  1IQF L;  4ZAE B;  2MGR A;  1CCV A;  2JZM A;  1G2M B;  2LUY A;  2UVO A;  2KMQ A;  3VDU A;  1EPH A;  1ATD A;  2DIP A;  2JA1 A;  1MJA A;  2N71 A;  1KIG L;  2CWF A;  1HAE A;  2I9B A;  1W7X L;  1EZQ B;  3U7U G;  1TBO A;  4E1G A;  2H9E C;  2X52 A;  3OL0 A;  2CJI B;  2BQ6 A;  4ZXY L;  1A3P A;  2QQD A;  2P16 L;  1PTR A;  2V1C C;  3FSX A;  2D1J B;  2VWO L;  4Z0L A;  1MOX C;  3Q3K B;  4DNC A;  1FAX L;  2EI8 B;  2LB7 A;  1CE3 A;  1CT2 I;  1J9C L;  2NU0 I;  3MQE A;  1TOZ A;  1QIU A;  1N13 A;  2FD6 A;  1NUB A;  4AQT A;  4MPI A;  5HI7 A;  1SZB A;  4X8U L;  4PH9 A;  4RRW A;  1SGN I;  3UGD A;  2Y81 B;  2CJS C;  3P5B L;  1LPK A;  2ENZ A;  2VWL L;  4YT6 L;  1PXX A;  2BOX A;  5L30 L;  2WPK E;  4A94 C;  1YTP A;  1DQB A;  2J87 A;  1X4S A;  1TBQ R;  1ATB A;  2K2S B;  3LC5 B;  1LPZ A;  2MGP A;  5EX3 A;  1ULK A;  4L9M A;  3UEY A;  1CGI I;  4TGF A;  1V1I A;  2AYL A;  5JB8 E;  1HCG B;  5CKN A;  2FLG A;  1CT0 I;  2CWG A;  2QPO A;  2SGE I;  1U8C B;  4NA9 L;  4OVO A;  2KCX A;  1EGF A;  2J2U B;  1F0S B;  5J8F A;  2FZZ L;  2VWM K;  1MJB A;  3GCX E;  4X8S L;  5FUX A;  1KLI L;  4Y79 B;  3UOE A;  1HT5 A;  1PPF I;  3B4V C;  1M8C A;  3SGB I;  2QQ0 A;  4BDW A;  1TUS A;  2DB6 A;  3CA7 A;  2X3T A;  3V64 C;  1Q4G A;  3PDN A;  4RRY A;  2TGF A;  2VVV L;  1TBN A;  2VH0 B;  5JB9 E;  1HJA I;  3LIW B;  4ZH8 B;  2RHP A;  2XBW L;  2GVI A;  1IGX A;  1F7E A;  5EX0 A;  2WCY A;  1EQG A;  2WFX B;  2Y0M A;  1SGP I;  3R5A A;  4XL1 A;  2WGC A;  3OLT A;  2KL7 A;  4BDX A;  1CGJ I;  1CCF A;  2SGF I;  1Z6C A;  2UWL B;  1RFH A;  1EQH A;  2GD4 A;  1V1H A;  3TBD A;  2SGQ I;  1K7V A;  2OVO A;  1LR7 A;  1EPG A;  1HT8 A;  3C9A C;  5HQ8 A;  3OXF A;  3VDP A;  1OMU A;  1BF9 A;  1WU1 B;  2UWO B;  1NFU B;  1LR8 A;  1RFN B;  5IKQ A;  3GCW E;  1CSO I;  1P9G A;  1WKX A;  3NT1 A;  3FCS B;  5EGM B;  1FJS L;  1LMM A;  2W2P E;  2NU3 I;  1KMA A;  1IQG L;  2P28 B;  2WPI E;  1QFK L;  3BT2 A;  1EMN A;  3M37 L;  3F1S B;  4AML A;  2F9B L;  2GKV A;  2VRS A;  4UXH A;  2XC5 L;  4XBM A;  4LOR A;  3CXL A;  1G1R A;  1YU6 C;  2ORW A;  4GU3 A;  1SGR I;  3TGF A;  2XBY L;  4NG9 L;  3TK6 B;  5FUY A;  2J34 B;  3ENS A;  2B8T A;  1IP0 A;  4RUT A;  1NQL B;  3HPT A;  3OXG A;  1I0U A;  1F7M A;  2YGO A;  2J94 B;  2CWH A;  2F3C I;  5IKT A;  4XLW A;  2RA0 L;  3DEM A;  3Q7D A;  2BSF A;  2EI7 B;  1WGT A;  2XBX L;  2W3K B;  4BXS A;  1C5M F;  2BOK L;  4HGU A;  1HEV A;  1KLO A;  2K2T A;  1IJQ A;  2P3F L;  5E3P A;  3KK6 A;  4MMX B;  3CFW A;  2YQP A;  3FBY A;  1G1T A;  1PFX L;  2NU2 I;  2UWP B;  2P95 L;  4BTU A;  1IQH L;  1APO A;  2RC4 A;  4ZXX L;  3N8Y B;  2KV4 A;  5J8C A;  1NPE B;  1DDX A;  3MEK A;  1N7D A;  1IOE L;  1EBV A;  1EPJ A;  4ISH L;  3UGI A;  5COX A;  1Y1C A;  1CEJ A;  2H9E L;  3N8X A;  3N8Z A;  2PQ8 A;  2N52 A;  5FDQ A;  2RIJ A;  2G00 L;  3OXL A;  3SEK C;  4B6D A;  2M74 A;  3HO5 A;  4C16 A;  4D0E A;  1XBT A;  2Y5H L;  1FAQ A;  2KMO A;  1SGQ I;  3BPS E;  1NZI A;  2WPL E;  2BMG A;  2FLB L;  3GIS X;  4ZHA B;  2JW6 A;  2KMP A;  1UUC A;  2ERW A;  1NFY B;  2RNL A;  1HPT A;  1DS2 I;  2PUQ L;  2BUS A;  1APQ A;  3N8W A;  1K36 A;  2XC0 L;  3ELA L;  2NU1 I;  4OTJ A;  3LN0 A;  3NTG A;  3R5C A;  1X7A L;  2Y5G L;  3TOA A;  2L7X A;  1ULM A;  2SGD I;  4M10 A;  5E3Q A;  4JCV E;  1LQD A;  2B0U C;  1XKB A;  1DS3 I;  1FF7 A;  1FYB A;  2WPH E;  5KN5 C;  5JBB E;  3VE5 A;  5JW1 A;  1YUK B;  1KSN B;  1MQ5 L;  1EMO A;  1TLE A;  1Q9B A;  2HOR A;  4Y7B B;  3K9X A;  7WGA A;  1YUF A;  3HH2 C;  2Q1J B;  1TBR R;  2VJ3 A;  5K0H B;  1PGE A;  1Y8F A;  3E59 A;  4GI3 C;  3NTB A;  1P0S L;  1COU A;  3LTG D;  2DKV A;  5L2Z L;  3QWP A;  3TH3 L;  4G1M B;  2W26 B;  2XBV L;  4D90 A;  1K37 A;  3BJI A;  2W2M E;  1XX6 A;  2HOX A;  5CKQ A;  1IQL L;  1LR9 A;  4JYU L;  2VVC K;  2ARP F;  1X74 A;  2P3U A;  1L5G B;  3IIT B;  1TOT A;  1WHE A;  3TO7 A;  4Z0K B;  1UZK A;  1M8B A;  1UZP A;  2DDU A;  6COX A;  1IQI L;  3KL6 B;  3KRK A;  2L8E A;  2OD1 A;  1KBF A;  2KNI A;  4RRZ A;  2WG3 C;  2Y80 B;  3R05 A;  4CUE A;  2BQ7 A;  2QQE A;  2W0T A;  1DVA L;  2YGQ A;  1CQE A;  4SGB I;  2JXD A;  3QH0 A;  4OTY A;  1ATE A;  1K7T A;  5CCM A;  1FAK L;  5JVY A;  1PRH A;  5FUV A;  4Y76 B;  1OB1 C;  1VDD A;  1WTJ A;  2KMR A;  3R5B A;  4FKD A;  3FC3 A;  2N17 A;  1IW4 A;  2W2O E;  1HAF A;  3S6X A;  1NFW B;  1IQE L;  1YGC L;  4NGA L;  1Z2I A;  1YUG A;  1R0R I;  3OVO A;  1N1I A;  3HS6 A;  2JJL A;  2W2N E;  2GKR I;  2I9A A;  1WGC A;  2PR3 B;  5I46 L;  4UXJ A;  3TK5 B;  1MT1 A;  1IQK L;  1L3Y A;  3MDL A;  2XC4 L;  2Y38 A;  4WP4 A;  3BT1 A;  1WHF A;  4FM5 A;  1MJ9 A;  2ELI A;  5FUW A;  5E8D A;  1LK9 A;  2Y82 B;  2ROW A;  4O1Z A;  1CVU A;  4JYV L;  1IVO C;  2VH6 B;  2NU4 I;  2P3F N;  4YZU B;  1OVO A;  4CUF A; 
#chains in the Genus database with same CATH homology
 2V1C A;  2WVJ A;  5FUX A;  1XBT A;  1PPF I;  3B4V C;  1TIH A;  1R79 A;  1PCE A;  1FAQ A;  1M8C A;  2KMO A;  1SGQ I;  3SGB I;  2QQ0 A;  3UGL A;  3GOX A;  1UVG A;  1TUS A;  2DB6 A;  4GU4 A;  1PJU A;  1CHO I;  2JW6 A;  1UUC A;  2ERW A;  2KMP A;  3RU0 A;  1HPT A;  3PDN A;  1BUS A;  1DS2 I;  1Z7K B;  1TBN A;  2BUS A;  5DAE A;  1OMT A;  2A20 A;  1HJA I;  1FAR A;  2E5R A;  3UFF A;  2GVI A;  2NU1 I;  3KY9 A;  5EX0 A;  3UEJ A;  1W4R A;  2WCY A;  3TJQ A;  1PTQ A;  2FNF X;  1W3S A;  2L7X A;  1SGP I;  2SGD I;  4E1R A;  2ORV A;  4JCV E;  2B0U C;  5CCL A;  1H0Z A;  3SGQ I;  1DS3 I;  1FYB A;  2UZ3 A;  2SGP I;  3VE5 A;  1OYV I;  1CGJ I;  2BT7 A;  1TUR A;  2SGF I;  2JYY A;  1RFH A;  1KBE A;  1V1H A;  3HH2 C;  2SGQ I;  1HDL A;  2XRC A;  2OVO A;  4A24 A;  1LR7 A;  1TBR R;  5HQ8 A;  1Y8F A;  2M5X A;  3E59 A;  4GI3 C;  5JHW C;  3OXF A;  1IY6 A;  3VDP A;  2N1A B;  1OMU A;  1IY5 A;  3QWP A;  3D00 A;  2P6A C;  2YUU A;  1LR8 A;  2LEO A;  4E1P A;  1SGY I;  1CSO I;  2J9R A;  2VRW B;  1CT4 I;  2JZM A;  3BJI A;  1XX6 A;  2LUY A;  2KMQ A;  3VDU A;  2DIP A;  1LR9 A;  2JA1 A;  1XA6 A;  2NU3 I;  2ARP F;  1KMA A;  1X74 A;  2N71 A;  1SGE I;  2V53 A;  1TOT A;  1TBO A;  2GKV A;  2VRS A;  3OL0 A;  1M8B A;  4UXH A;  3CXL A;  2L8E A;  2QQD A;  1PTR A;  2OD1 A;  2V1C C;  1YU6 C;  2ORW A;  1KBF A;  4GU3 A;  1SGR I;  2K9H A;  2ENN A;  2GKT I;  1CE3 A;  5FUY A;  2QQE A;  1CT2 I;  2NU0 I;  2W0T A;  2E73 A;  1QIU A;  1N13 A;  2B8T A;  1NUB A;  4SGB I;  5HI7 A;  2JXD A;  3OXG A;  2ODD A;  1Y1B A;  1SGN I;  1KKE A;  5CCM A;  3UGD A;  1SGD I;  2QQC A;  2F3C I;  2CJS C;  5FUV A;  1VDD A;  2KMR A;  4FKD A;  2ENZ A;  2BSF A;  3FC3 A;  3E2I A;  2N17 A;  1IW4 A;  3S6X A;  4HGU A;  1R0R I;  3OVO A;  1YTP A;  1U5K A;  2JJL A;  2J87 A;  2GKR I;  2YQP A;  1X4S A;  4UXJ A;  3QTL D;  1MT1 A;  1TGS I;  1AN1 I;  1TBQ R;  2NU2 I;  2ELI A;  5EX3 A;  4L9M A;  5FUW A;  1UVF A;  1CGI I;  3UEY A;  3MEK A;  1V1I A;  3UGI A;  2SGE I;  1CT0 I;  2QPO A;  1Y1C A;  4OVO A;  2ROW A;  2BT8 A;  4UXI A;  1BMO A;  2KCX A;  2NU4 I;  2N52 A;  1OVO A;  4B6D A;  3SEK C;  3OXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...