1V1IA

Adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a long linker
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
109
structure length
102
Chain Sequence
VSIKKSSGLNFDNTAIAINAGKGLEFDTNTSESPDINPIKTKIGSGIDYNENGAMITKLGAGLSFDNSGAITIGNGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Adenovirus
molecule keywords FIBRITIN, FIBER PROTEIN
publication title Adenovirus Fibre Shaft Sequences Fold Into the Native Triple Beta-Spiral Fold When N-Terminally Fused to the Bacteriophage T4 Fibritin Foldon Trimerisation Motif
pubmed doi rcsb
source organism Human adenovirus c
total genus 9
structure length 102
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00608 Adeno_shaft Adenoviral fibre protein (repeat/shaft region)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.20 Mainly Beta Ribbon Laminin reovirus attachment protein sigma1; domain 1 1v1iA01
3.30.60.240 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1v1iA02
1KKEA 2BSFA 2VRSA 4GU4A 2BT7A 2JJLA 3S6XA 1V1HA 4GU3A 1V1IA 1QIUA 2BT8A
chains in the Genus database with same CATH superfamily
3QMOA 4B6DA 1Y1CA 3OXLA 2H9EC 3QTLD 1NPEB 5JBAE 5FUYA 1IQJL 2CJSC 1XDTR 1PJUA 2WFXB 1O5DL 2BZ6L 1CVUA 2G00L 4NA9L 2EI6B 2ORVA 2J95B 2ROWA 2B7DL 2VRWB 1IQLL 3TJQA 1KLOA 1XFEA 2VVVL 2YGQA 2NU4I 2QQ0A 2QQCA 2EI7B 1AN1I 2XC0L 4C16A 2JJLA 3EGFA 1Z7KB 3SGBI 1L5GB 2P26A 2KMPA 3UEJA 2GD4A 3HS5A 1GK5A 3UGDA 3ZYIB 5KIRA 3PGHA 2JZMA 1ATBA 2V53A 1TLEA 1IW4A 1NFWB 1LMJA 1XKAL 2SGPI 1IP0A 4PH9A 1IVOC 2XC5L 3U73A 5KN5C 3GOXA 1K7TA 2YGOA 3TZIA 4L9MA 2VH6B 2GIVA 3FSXA 2ORWA 1F7MA 5JVZA 5JBCE 3R05A 1MJBA 1A3PA 1MJ9A 2OVOA 2P28B 1FAKL 3POYA 1ATAA 3N8WB 5E3RA 3NJPC 4OVOA 2WPJE 3R5CA 1M1XB 2DDUA 2I9AA 3FSYA 1MQ5L 1NQLB 2Y5GL 1RFHA 4Y6DB 2VWMK 1NFYB 1XBTA 2D1JB 1HAEA 3SOVA 3H5CB 2K2TA 5J8CA 1FYBA 2CWGA 1NFXB 2VWLL 3D00A 5F19A 2Y7XB 5IKVA 5E3PA 1OB1C 2BQWA 2VWNL 2J2UB 1WU1B 3OLUA 4Z6AL 1EMOA 1FSBA 2RNLA 2CJIB 3LC5B 2Y5HL 4MMXB 3CFWA 3NTBA 2KCXA 1IQGL 4BXSA 2UZ3A 5FUVA 3LN1A 2GKTI 1WTJA 2BQ6A 1Y1BA 5JHWC 2K9HA 1C5MF 5HI7A 3QCWA 3TK6B 2DIPA 2Q1JB 4JZFL 2P93L 2W2NE 2F9BL 1XX6A 1N13A 3GCWE 4UXHA 1VDDA 3B4VC 1KLJL 2FLGA 1EPIA 1SGRI 1Y8FA 1IGZA 2JXDA 5I46L 2FLBL 2OYEP 2HORA 1SGNI 2F3CI 2YUUA 3PDNA 4ZH8B 1FY7A 4CUEA 2DKVA 2X52A 1UZKA 3KQBL 2NPRA 5JB8E 2B0UC 1CCFA 2Y5FL 5CKQA 1HDLA 3LC3B 1F7EA 2E5RA 3KQCL 2J34B 3TBDA 3OXGA 1M8CA 1W4RA 1PFXL 2PHBB 2KMRA 1CHOI 3F6UL 3ELAL 2J9RA 3TOAA 3LTFB 3N8YB 1NXUA 2TGFA 1LK9A 1LR9A 1TBNA 2SGFI 2OU2A 2AYLA 3TGFA 2VH0B 2KNIA 1OMUA 4BTUA 1K7VA 1CT2I 2ENNA 3S6XA 1PTQA 3VDUA 4COXA 2XBVL 1PGEA 2WPIE 3GISX 2WYJB 1LQDA 5EX3A 4DNCA 3SOQA 2PQ8A 2Y81B 3HH2C 1I0UA 1W8BL 3SW2A 2Y0MA 2ADXA 1YUGA 1WHEA 2NU3I 2W3KB 3VE5A 2N52A 3E2IA 3V64C 1IQEL 2P94L 1IJQA 5L30L 2UWOB 4ISIL 5EX0A 4A94C 2HOXA 1MQ6L 1LPKA 2BT8A 1EAIC 4XL1A 1W3SA 2OZUA 2CWFA 2JA1A 5DAEA 3SEKC 1APOA 3F1SB 3KRKA 2N1AB 1EPGA 3UGLA 3TK5B 4MMZB 2XBYL 3IITB 4E1RA 1IQKL 2I9BA 3K9XA 5IKTA 1ULMA 3UEYA 3RR3A 4RRWA 1EPJA 4M10A 2UVOA 1WKXA 4WP4A 4HGUA 2P3FL 1OYVI 2BQ7A 3R5BA 1G2MB 3LTGD 4RRZA 2KMOA 2UWPB 2A20A 2YGPA 4O02B 2ARPF 3LN0A 3IJEB 1AUTL 4X8VL 3DEMA 2L7XA 1SZBA 4ZHAB 3N8XA 2JKHL 1JV2B 4YZUB 3R5DA 1HAFA 4OTJA 2WPLE 2LEOA 2VWOL 2P3UA 4JYVL 1KIGL 3FCSB 2P6AC 5L2ZL 2SGDI 1QIUA 1UZQA 2GKVA 1URKA 5J8FA 1F0RB 3E59A 2MHPA 1X4SA 1UUCA 1KBEA 3CXLA 4ZAEB 1FE2A 4JZEL 4M11A 1MJAA 5CCLA 4A24A 2W2QE 4LMFA 1DS3I 1CVWL 3BJIA 4MPIA 2Y7ZB 1YGCL 4ISHL 3N8WA 5FUXA 1SGEI 3C9AC 1KSNB 3FC3A 1HRFA 1OVOA 1COUA 2WG3C 3P5BL 2OYUP 1CCVA 3TO9A 3NTGA 4Y79B 3RU0A 1MT1A 2J38B 3UGIA 2M74A 2BO2A 1UZJA 5E8DA 2P3FN 2Y38A 2FLRL 1P9GA 3BT1A 2WFTA 1CT0I 2V1CA 4FKDA 4NGAL 4CUDA 1F0SB 1HT5A 2P16L 2PR3B 2WYGB 4BXWA 1TBOA 2MGRA 3HS7A 1W7XL 3VDPA 1TIHA 1WHFA 7WGAA 2RA0L 3LIWB 4D0FA 2KMQA 2NU0I 2WCYA 4JCVE 1TBQR 2FD6A 1HZ8A 1IGXA 5F1AA 2J4IB 3UFFA 2BUSA 1K7UA 1IY5A 2QQEA 2OD1A 2V1CC 2YQPA 1LR7A 4BDWA 3KQDL 4BTIA 1G1QA 2H9EL 4BDXA 2X3TA 4Y7BB 5L2YL 3N8ZA 5EGMB 1EGFA 1UVGA 2NU1I 2W0TA 1YO8A 1XKBA 1U67A 1DVAL 2RHPA 1TOZA 1HEVA 2EI8B 4O1ZA 1FARA 3CS7L 1P9ZA 3QAHA 3TO7A 4TGFA 5CKMA 1U5KA 1KMAA 1APQA 1PTRA 2GKRI 5COXA 3FBYA 2UWLB 5E3QA 1MOXC 4GU3A 2KL7A 3N8YA 1G2LB 1YU6C 1NUBA 1R79A 2XRCA 1FJSL 4FM5A 1HJAI 2W2OE 4D0EA 4E1PA 1DIYA 1IQFL 4RUTA 1WGTA 1N1IA 3HPTA 1TOTA 1LMMA 2ELIA 1CGII 1G1TA 1CEJA 1R0RI 3NT1A 4RRXA 3N8VA 1V3XB 2J87A 2BOUA 2QPOA 2P3TA 1EZQB 1N7DA 1PRHA 2J94B 1LPGA 4X8TL 2LB7A 1ULKA 2XBXL 4UXIA 9WGAA 2BOHA 1CSOI 1PCEA 2FZZL 4CUFA 3QH0A 1UVFA 3HS6A 3HO3A 5FUWA 4LORA 2XBWL 5JW1A 3U7UG 2ODDA 1IOXA 1L3YA 2M5XA 3TO6A 4X8UL 2L8EA 2RIJA 3GCXE 4D90A 2W3IB 4NG9L 1CGJI 2SGEI 1HT8A 1YUKB 2KB9A 1TUSA 2SGQI 2P95L 1EQHA 3BPSE 5IKQA 1J9CL 1FAQA 2Y82B 1ATDA 2WPKE 4YT7L 3KK6A 1IQNL 5HQ8A 1TGSI 3CENL 1WGCA 2ENZA 2WZPP 1V1HA 1PXXA 3LAQA 4JZDL 2BSFA 1DDXA 2FNFX 1YUFA 4AMLA 4UXJA 1EPHA 2N17A 3SGQI 1H0ZA 1FAXL 1ULNA 3KL6B 2K2SB 2ERWA 2WGCA 2BOKL 4Y71B 4A7IA 1LR8A 1B9WA 1P0SL 2GVIA 2N71A 3M37L 1SGYI 6COXA 2W86A 2XC4L 3M36L 1IOEL 1IQIL 2KV4A 3FFGL 1UZPA 4YT6L 3BT2A 4GU4A 1TPGA 4AQTA 1Q9BA 3R5AA 5FDQA 1P9JA 3HO5A 3TH3L 1JBUL 5IKRA 1ADXA 2Y80B 2MGPA 1JL9A 4JYUL 1OMTA 5JB9E 1SGPI 1K37A 2JYYA 1SGQI 2WVJA 4E1GA 1DX5I 5JVYA 3OXFA 1QFKL 2VVUL 1ATEA 3TOBA 1CQEA 4ZXYL 1Z6EL 4OTYA 3ASIA 1Q4GA 1X74A 2NU2I 4RS0A 1IQHL 1TURA 4SGBI 1NZIA 2W2ME 5CKNA 1G1SA 4XLWA 1TBRR 3V65B 1X7AL 1CT4I 4Z0KB 4G1MB 1NFUB 2WPHE 2WG4B 2VRSA 1FF7A 1HCGB 1YTPA 3ZYJB 3SOBB 1KBFA 3Q7DA 3CA7A 1IY6A 2QQDA 1CX2A 5CCMA 3MEKA 3MQEA 2PUQL 2W26B 1M8BA 1EQGA 4Z0LA 4RRYA 3KCGL 3ZYGA 1BUSA 5CISA 1PTHA 1DS2I 4ZXXL 4Y76B 4GI3C 1FFMA 3UOEA 1ZAQA 1HREA 1U8CB 2BT7A 5JBBE 2CWHA 3KY9A 4CSYA 1DQBA 2B8TA 2BMGA 2WPME 3MDLA 3KQEL 2DB6A 2BOXA 3Q3KB 3QWPA 2E73A 1CE3A 1RFNB 1Z6CA 2LUYA 1Z2IA 1KLIL 1G1RA 4X8SL 2VJ3A 2RC4A 1K36A 3OL0A 1HX2A 2W2PE 1LPZA 2VVCK 1EBVA 4XBMA 4Y7AB 4MMYB 3ENSA 1IQML 1HPTA 1BMOA 1SGDI 1S20A 1KKEA 1PPFI 1HJ7A 3OLTA 4BTTA 1NT0A 2JW6A 1V1IA 1BF9A 3OVOA 3HO4A 1EMNA 1XA6A 5K0HB 1UHAA
chains in the Genus database with same CATH topology
1TBOA 2KMRA 1CHOI 4B6DA 1Y1CA 2J9RA 3OXLA 3QTLD 4UXJA 1TBNA 3VDPA 1LR9A 1TIHA 2N17A 2SGFI 5FUYA 2CJSC 3SGQI 1H0ZA 2ERWA 1PJUA 1LR8A 1OMUA 2NU0I 2KMQA 2WCYA 4JCVE 1CT2I 2ENNA 2GVIA 1TBQR 3S6XA 2N71A 1PTQA 1SGYI 3VDUA 3UFFA 2BUSA 2ORVA 2ROWA 1IY5A 2QQEA 5EX3A 2VRWB 4GU4A 2OD1A 2V1CC 3HH2C 3TJQA 2QQ0A 2QQCA 2NU4I 2YQPA 1LR7A 1AN1I 2NU3I 3VE5A 2N52A 3E2IA 2JJLA 1OMTA 1SGPI 2JYYA 1SGQI 1Z7KB 2WVJA 3SGBI 3UEJA 3UGDA 2KMPA 5EX0A 3OXFA 1UVGA 2JZMA 2V53A 1IW4A 2NU1I 2BT8A 2W0TA 2SGPI 1W3SA 3GOXA 1X74A 2JA1A 2NU2I 5DAEA 3SEKC 4L9MA 1FARA 1TURA 2N1AB 1U5KA 4SGBI 3UGLA 2ORWA 1KMAA 1PTRA 2GKRI 2OVOA 1TBRR 4E1RA 4GU3A 4OVOA 1CT4I 1YU6C 1NUBA 1R79A 3UEYA 2XRCA 1RFHA 4HGUA 2VRSA 1HJAI 1OYVI 1XBTA 1YTPA 4E1PA 1KBFA 1TOTA 2ELIA 1FYBA 1IY6A 2QQDA 2KMOA 1CGII 2A20A 3D00A 5CCMA 3MEKA 1R0RI 2BSFA 2ARPF 1M8BA 2J87A 2L7XA 2QPOA 1BUSA 1DS2I 4GI3C 2LEOA 2KCXA 2BT7A 2UZ3A 2P6AC 5FUVA 3KY9A 4UXIA 2SGDI 2GKTI 1QIUA 1CSOI 1Y1BA 1PCEA 2B8TA 2GKVA 2K9HA 5HI7A 5JHWC 2DIPA 3E59A 2DB6A 1UVFA 1X4SA 5FUWA 1UUCA 1XX6A 1KBEA 2ODDA 3QWPA 3CXLA 1N13A 2E73A 1CE3A 5CCLA 4UXHA 4A24A 1VDDA 3B4VC 2LUYA 1DS3I 1SGRI 2M5XA 1Y8FA 3BJIA 2L8EA 3OL0A 5FUXA 2FNFX 2JXDA 1SGEI 1CGJI 1SGNI 2F3CI 2SGEI 2YUUA 1TUSA 3PDNA 1HPTA 1OVOA 3FC3A 1BMOA 1SGDI 2SGQI 1KKEA 1PPFI 3RU0A 1MT1A 1FAQA 3UGIA 2B0UC 2JW6A 1V1IA 3OVOA 4FKDA 1CT0I 2V1CA 5HQ8A 1HDLA 1TGSI 2E5RA 2ENZA 1XA6A 1V1HA 3OXGA 1M8CA 1W4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKE A;  2BSF A;  2VRS A;  4GU4 A;  2BT7 A;  2JJL A;  3S6X A;  1V1H A;  4GU3 A;  1V1I A;  1QIU A;  2BT8 A; 
#chains in the Genus database with same CATH topology
 3QMO A;  4B6D A;  1Y1C A;  3OXL A;  2H9E C;  3QTL D;  1NPE B;  5JBA E;  5FUY A;  1IQJ L;  2CJS C;  1XDT R;  1PJU A;  2WFX B;  1O5D L;  2BZ6 L;  1CVU A;  2G00 L;  4NA9 L;  2EI6 B;  2ORV A;  2J95 B;  2ROW A;  2B7D L;  2VRW B;  1IQL L;  3TJQ A;  1KLO A;  1XFE A;  2VVV L;  2YGQ A;  2NU4 I;  2QQ0 A;  2QQC A;  2EI7 B;  1AN1 I;  2XC0 L;  4C16 A;  2JJL A;  3EGF A;  1Z7K B;  3SGB I;  1L5G B;  2P26 A;  2KMP A;  3UEJ A;  2GD4 A;  3HS5 A;  1GK5 A;  3UGD A;  3ZYI B;  5KIR A;  3PGH A;  2JZM A;  1ATB A;  2V53 A;  1TLE A;  1IW4 A;  1NFW B;  1LMJ A;  1XKA L;  2SGP I;  1IP0 A;  4PH9 A;  1IVO C;  2XC5 L;  3U73 A;  5KN5 C;  3GOX A;  1K7T A;  2YGO A;  3TZI A;  4L9M A;  2VH6 B;  2GIV A;  3FSX A;  2ORW A;  1F7M A;  5JVZ A;  5JBC E;  3R05 A;  1MJB A;  1A3P A;  1MJ9 A;  2OVO A;  2P28 B;  1FAK L;  3POY A;  1ATA A;  3N8W B;  5E3R A;  3NJP C;  4OVO A;  2WPJ E;  3R5C A;  1M1X B;  2DDU A;  2I9A A;  3FSY A;  1MQ5 L;  1NQL B;  2Y5G L;  1RFH A;  4Y6D B;  2VWM K;  1NFY B;  1XBT A;  2D1J B;  1HAE A;  3SOV A;  3H5C B;  2K2T A;  5J8C A;  1FYB A;  2CWG A;  1NFX B;  2VWL L;  3D00 A;  5F19 A;  2Y7X B;  5IKV A;  5E3P A;  1OB1 C;  2BQW A;  2VWN L;  2J2U B;  1WU1 B;  3OLU A;  4Z6A L;  1EMO A;  1FSB A;  2RNL A;  2CJI B;  3LC5 B;  2Y5H L;  4MMX B;  3CFW A;  3NTB A;  2KCX A;  1IQG L;  4BXS A;  2UZ3 A;  5FUV A;  3LN1 A;  2GKT I;  1WTJ A;  2BQ6 A;  1Y1B A;  5JHW C;  2K9H A;  1C5M F;  5HI7 A;  3QCW A;  3TK6 B;  2DIP A;  2Q1J B;  4JZF L;  2P93 L;  2W2N E;  2F9B L;  1XX6 A;  1N13 A;  3GCW E;  4UXH A;  1VDD A;  3B4V C;  1KLJ L;  2FLG A;  1EPI A;  1SGR I;  1Y8F A;  1IGZ A;  2JXD A;  5I46 L;  2FLB L;  2OYE P;  2HOR A;  1SGN I;  2F3C I;  2YUU A;  3PDN A;  4ZH8 B;  1FY7 A;  4CUE A;  2DKV A;  2X52 A;  1UZK A;  3KQB L;  2NPR A;  5JB8 E;  2B0U C;  1CCF A;  2Y5F L;  5CKQ A;  1HDL A;  3LC3 B;  1F7E A;  2E5R A;  3KQC L;  2J34 B;  3TBD A;  3OXG A;  1M8C A;  1W4R A;  1PFX L;  2PHB B;  2KMR A;  1CHO I;  3F6U L;  3ELA L;  2J9R A;  3TOA A;  3LTF B;  3N8Y B;  1NXU A;  2TGF A;  1LK9 A;  1LR9 A;  1TBN A;  2SGF I;  2OU2 A;  2AYL A;  3TGF A;  2VH0 B;  2KNI A;  1OMU A;  4BTU A;  1K7V A;  1CT2 I;  2ENN A;  3S6X A;  1PTQ A;  3VDU A;  4COX A;  2XBV L;  1PGE A;  2WPI E;  3GIS X;  2WYJ B;  1LQD A;  5EX3 A;  4DNC A;  3SOQ A;  2PQ8 A;  2Y81 B;  3HH2 C;  1I0U A;  1W8B L;  3SW2 A;  2Y0M A;  2ADX A;  1YUG A;  1WHE A;  2NU3 I;  2W3K B;  3VE5 A;  2N52 A;  3E2I A;  3V64 C;  1IQE L;  2P94 L;  1IJQ A;  5L30 L;  2UWO B;  4ISI L;  5EX0 A;  4A94 C;  2HOX A;  1MQ6 L;  1LPK A;  2BT8 A;  1EAI C;  4XL1 A;  1W3S A;  2OZU A;  2CWF A;  2JA1 A;  5DAE A;  3SEK C;  1APO A;  3F1S B;  3KRK A;  2N1A B;  1EPG A;  3UGL A;  3TK5 B;  4MMZ B;  2XBY L;  3IIT B;  4E1R A;  1IQK L;  2I9B A;  3K9X A;  5IKT A;  1ULM A;  3UEY A;  3RR3 A;  4RRW A;  1EPJ A;  4M10 A;  2UVO A;  1WKX A;  4WP4 A;  4HGU A;  2P3F L;  1OYV I;  2BQ7 A;  3R5B A;  1G2M B;  3LTG D;  4RRZ A;  2KMO A;  2UWP B;  2A20 A;  2YGP A;  4O02 B;  2ARP F;  3LN0 A;  3IJE B;  1AUT L;  4X8V L;  3DEM A;  2L7X A;  1SZB A;  4ZHA B;  3N8X A;  2JKH L;  1JV2 B;  4YZU B;  3R5D A;  1HAF A;  4OTJ A;  2WPL E;  2LEO A;  2VWO L;  2P3U A;  4JYV L;  1KIG L;  3FCS B;  2P6A C;  5L2Z L;  2SGD I;  1QIU A;  1UZQ A;  2GKV A;  1URK A;  5J8F A;  1F0R B;  3E59 A;  2MHP A;  1X4S A;  1UUC A;  1KBE A;  3CXL A;  4ZAE B;  1FE2 A;  4JZE L;  4M11 A;  1MJA A;  5CCL A;  4A24 A;  2W2Q E;  4LMF A;  1DS3 I;  1CVW L;  3BJI A;  4MPI A;  2Y7Z B;  1YGC L;  4ISH L;  3N8W A;  5FUX A;  1SGE I;  3C9A C;  1KSN B;  3FC3 A;  1HRF A;  1OVO A;  1COU A;  2WG3 C;  3P5B L;  2OYU P;  1CCV A;  3TO9 A;  3NTG A;  4Y79 B;  3RU0 A;  1MT1 A;  2J38 B;  3UGI A;  2M74 A;  2BO2 A;  1UZJ A;  5E8D A;  2P3F N;  2Y38 A;  2FLR L;  1P9G A;  3BT1 A;  2WFT A;  1CT0 I;  2V1C A;  4FKD A;  4NGA L;  4CUD A;  1F0S B;  1HT5 A;  2P16 L;  2PR3 B;  2WYG B;  4BXW A;  1TBO A;  2MGR A;  3HS7 A;  1W7X L;  3VDP A;  1TIH A;  1WHF A;  7WGA A;  2RA0 L;  3LIW B;  4D0F A;  2KMQ A;  2NU0 I;  2WCY A;  4JCV E;  1TBQ R;  2FD6 A;  1HZ8 A;  1IGX A;  5F1A A;  2J4I B;  3UFF A;  2BUS A;  1K7U A;  1IY5 A;  2QQE A;  2OD1 A;  2V1C C;  2YQP A;  1LR7 A;  4BDW A;  3KQD L;  4BTI A;  1G1Q A;  2H9E L;  4BDX A;  2X3T A;  4Y7B B;  5L2Y L;  3N8Z A;  5EGM B;  1EGF A;  1UVG A;  2NU1 I;  2W0T A;  1YO8 A;  1XKB A;  1U67 A;  1DVA L;  2RHP A;  1TOZ A;  1HEV A;  2EI8 B;  4O1Z A;  1FAR A;  3CS7 L;  1P9Z A;  3QAH A;  3TO7 A;  4TGF A;  5CKM A;  1U5K A;  1KMA A;  1APQ A;  1PTR A;  2GKR I;  5COX A;  3FBY A;  2UWL B;  5E3Q A;  1MOX C;  4GU3 A;  2KL7 A;  3N8Y A;  1G2L B;  1YU6 C;  1NUB A;  1R79 A;  2XRC A;  1FJS L;  4FM5 A;  1HJA I;  2W2O E;  4D0E A;  4E1P A;  1DIY A;  1IQF L;  4RUT A;  1WGT A;  1N1I A;  3HPT A;  1TOT A;  1LMM A;  2ELI A;  1CGI I;  1G1T A;  1CEJ A;  1R0R I;  3NT1 A;  4RRX A;  3N8V A;  1V3X B;  2J87 A;  2BOU A;  2QPO A;  2P3T A;  1EZQ B;  1N7D A;  1PRH A;  2J94 B;  1LPG A;  4X8T L;  2LB7 A;  1ULK A;  2XBX L;  4UXI A;  9WGA A;  2BOH A;  1CSO I;  1PCE A;  2FZZ L;  4CUF A;  3QH0 A;  1UVF A;  3HS6 A;  3HO3 A;  5FUW A;  4LOR A;  2XBW L;  5JW1 A;  3U7U G;  2ODD A;  1IOX A;  1L3Y A;  2M5X A;  3TO6 A;  4X8U L;  2L8E A;  2RIJ A;  3GCX E;  4D90 A;  2W3I B;  4NG9 L;  1CGJ I;  2SGE I;  1HT8 A;  1YUK B;  2KB9 A;  1TUS A;  2SGQ I;  2P95 L;  1EQH A;  3BPS E;  5IKQ A;  1J9C L;  1FAQ A;  2Y82 B;  1ATD A;  2WPK E;  4YT7 L;  3KK6 A;  1IQN L;  5HQ8 A;  1TGS I;  3CEN L;  1WGC A;  2ENZ A;  2WZP P;  1V1H A;  1PXX A;  3LAQ A;  4JZD L;  2BSF A;  1DDX A;  2FNF X;  1YUF A;  4AML A;  4UXJ A;  1EPH A;  2N17 A;  3SGQ I;  1H0Z A;  1FAX L;  1ULN A;  3KL6 B;  2K2S B;  2ERW A;  2WGC A;  2BOK L;  4Y71 B;  4A7I A;  1LR8 A;  1B9W A;  1P0S L;  2GVI A;  2N71 A;  3M37 L;  1SGY I;  6COX A;  2W86 A;  2XC4 L;  3M36 L;  1IOE L;  1IQI L;  2KV4 A;  3FFG L;  1UZP A;  4YT6 L;  3BT2 A;  4GU4 A;  1TPG A;  4AQT A;  1Q9B A;  3R5A A;  5FDQ A;  1P9J A;  3HO5 A;  3TH3 L;  1JBU L;  5IKR A;  1ADX A;  2Y80 B;  2MGP A;  1JL9 A;  4JYU L;  1OMT A;  5JB9 E;  1SGP I;  1K37 A;  2JYY A;  1SGQ I;  2WVJ A;  4E1G A;  1DX5 I;  5JVY A;  3OXF A;  1QFK L;  2VVU L;  1ATE A;  3TOB A;  1CQE A;  4ZXY L;  1Z6E L;  4OTY A;  3ASI A;  1Q4G A;  1X74 A;  2NU2 I;  4RS0 A;  1IQH L;  1TUR A;  4SGB I;  1NZI A;  2W2M E;  5CKN A;  1G1S A;  4XLW A;  1TBR R;  3V65 B;  1X7A L;  1CT4 I;  4Z0K B;  4G1M B;  1NFU B;  2WPH E;  2WG4 B;  2VRS A;  1FF7 A;  1HCG B;  1YTP A;  3ZYJ B;  3SOB B;  1KBF A;  3Q7D A;  3CA7 A;  1IY6 A;  2QQD A;  1CX2 A;  5CCM A;  3MEK A;  3MQE A;  2PUQ L;  2W26 B;  1M8B A;  1EQG A;  4Z0L A;  4RRY A;  3KCG L;  3ZYG A;  1BUS A;  5CIS A;  1PTH A;  1DS2 I;  4ZXX L;  4Y76 B;  4GI3 C;  1FFM A;  3UOE A;  1ZAQ A;  1HRE A;  1U8C B;  2BT7 A;  5JBB E;  2CWH A;  3KY9 A;  4CSY A;  1DQB A;  2B8T A;  2BMG A;  2WPM E;  3MDL A;  3KQE L;  2DB6 A;  2BOX A;  3Q3K B;  3QWP A;  2E73 A;  1CE3 A;  1RFN B;  1Z6C A;  2LUY A;  1Z2I A;  1KLI L;  1G1R A;  4X8S L;  2VJ3 A;  2RC4 A;  1K36 A;  3OL0 A;  1HX2 A;  2W2P E;  1LPZ A;  2VVC K;  1EBV A;  4XBM A;  4Y7A B;  4MMY B;  3ENS A;  1IQM L;  1HPT A;  1BMO A;  1SGD I;  1S20 A;  1KKE A;  1PPF I;  1HJ7 A;  3OLT A;  4BTT A;  1NT0 A;  2JW6 A;  1V1I A;  1BF9 A;  3OVO A;  3HO4 A;  1EMN A;  1XA6 A;  5K0H B;  1UHA A; 
#chains in the Genus database with same CATH homology
 1TBO A;  2KMR A;  1CHO I;  4B6D A;  1Y1C A;  2J9R A;  3OXL A;  3QTL D;  4UXJ A;  1TBN A;  3VDP A;  1LR9 A;  1TIH A;  2N17 A;  2SGF I;  5FUY A;  2CJS C;  3SGQ I;  1H0Z A;  2ERW A;  1PJU A;  1LR8 A;  1OMU A;  2NU0 I;  2KMQ A;  2WCY A;  4JCV E;  1CT2 I;  2ENN A;  2GVI A;  1TBQ R;  3S6X A;  2N71 A;  1PTQ A;  1SGY I;  3VDU A;  3UFF A;  2BUS A;  2ORV A;  2ROW A;  1IY5 A;  2QQE A;  5EX3 A;  2VRW B;  4GU4 A;  2OD1 A;  2V1C C;  3HH2 C;  3TJQ A;  2QQ0 A;  2QQC A;  2NU4 I;  2YQP A;  1LR7 A;  1AN1 I;  2NU3 I;  3VE5 A;  2N52 A;  3E2I A;  2JJL A;  1OMT A;  1SGP I;  2JYY A;  1SGQ I;  1Z7K B;  2WVJ A;  3SGB I;  3UEJ A;  3UGD A;  2KMP A;  5EX0 A;  3OXF A;  1UVG A;  2JZM A;  2V53 A;  1IW4 A;  2NU1 I;  2BT8 A;  2W0T A;  2SGP I;  1W3S A;  3GOX A;  1X74 A;  2JA1 A;  2NU2 I;  5DAE A;  3SEK C;  4L9M A;  1FAR A;  1TUR A;  2N1A B;  1U5K A;  4SGB I;  3UGL A;  2ORW A;  1KMA A;  1PTR A;  2GKR I;  2OVO A;  1TBR R;  4E1R A;  4GU3 A;  4OVO A;  1CT4 I;  1YU6 C;  1NUB A;  1R79 A;  3UEY A;  2XRC A;  1RFH A;  4HGU A;  2VRS A;  1HJA I;  1OYV I;  1XBT A;  1YTP A;  4E1P A;  1KBF A;  1TOT A;  2ELI A;  1FYB A;  1IY6 A;  2QQD A;  2KMO A;  1CGI I;  2A20 A;  3D00 A;  5CCM A;  3MEK A;  1R0R I;  2BSF A;  2ARP F;  1M8B A;  2J87 A;  2L7X A;  2QPO A;  1BUS A;  1DS2 I;  4GI3 C;  2LEO A;  2KCX A;  2BT7 A;  2UZ3 A;  2P6A C;  5FUV A;  3KY9 A;  4UXI A;  2SGD I;  2GKT I;  1QIU A;  1CSO I;  1Y1B A;  1PCE A;  2B8T A;  2GKV A;  2K9H A;  5HI7 A;  5JHW C;  2DIP A;  3E59 A;  2DB6 A;  1UVF A;  1X4S A;  5FUW A;  1UUC A;  1XX6 A;  1KBE A;  2ODD A;  3QWP A;  3CXL A;  1N13 A;  2E73 A;  1CE3 A;  5CCL A;  4UXH A;  4A24 A;  1VDD A;  3B4V C;  2LUY A;  1DS3 I;  1SGR I;  2M5X A;  1Y8F A;  3BJI A;  2L8E A;  3OL0 A;  5FUX A;  2FNF X;  2JXD A;  1SGE I;  1CGJ I;  1SGN I;  2F3C I;  2SGE I;  2YUU A;  1TUS A;  3PDN A;  1HPT A;  1OVO A;  3FC3 A;  1BMO A;  1SGD I;  2SGQ I;  1KKE A;  1PPF I;  3RU0 A;  1MT1 A;  1FAQ A;  3UGI A;  2B0U C;  2JW6 A;  1V1I A;  3OVO A;  4FKD A;  1CT0 I;  2V1C A;  5HQ8 A;  1HDL A;  1TGS I;  2E5R A;  2ENZ A;  1XA6 A;  1V1H A;  3OXG A;  1M8C A;  1W4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...