2F9BL

Discovery of novel heterocyclic factor viia inhibitors
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
QCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of novel heterocyclic factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
total genus 18
structure length 94
sequence length 94
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2f9bL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2f9bL01
2KL7A 1J9CL 3Q7DA 3R05A 4Y71B 4Z0KB 3F6UL 1P0SL 1A3PA 1FSBA 1DX5I 1UZJA 3KQEL 4OTJA 2WPME 4O1ZA 5JB9E 1Z6EL 4Y7BB 4X8VL 1B9WA 2Y5GL 2J38B 3H5CB 3TK5B 2MGRA 2W2OE 1GK5A 3NTGA 3U7UG 1KLJL 1YUKB 1HAEA 2P26A 1FJSL 2FLBL 4RRWA 2RA0L 3HO4A 4RUTA 1NZIA 1CVUA 4Y7AB 5JBAE 2FLRL 1KIGL 3N8ZA 5KN5C 3NT1A 2D1JB 2XBYL 1FAKL 1PXXA 4YT6L 1ADXA 1MOXC 1CCVA 4RRXA 3LN1A 3K9XA 2YGOA 2YGPA 5IKRA 3QH0A 2B7DL 4E1GA 1IQML 2Y7XB 2RNLA 1PFXL 2W26B 1EMNA 1DQBA 1WU1B 3LTGD 2WPJE 5CISA 2VWOL 4BXWA 4D0FA 3GCXE 1LPZA 1O5DL 3LC5B 1HRFA 1CX2A 1WHFA 2TGFA 4O02B 2OYEP 2P3FN 5CKMA 3POYA 3SW2A 3EGFA 2WYGB 1IQJL 3BT1A 1LPGA 2VWNL 3ELAL 1COUA 3TH3L 3LC3B 2EI6B 1UZQA 5L2YL 2J95B 4CSYA 1HT5A 5EGMB 1P9JA 1ATDA 1NQLB 1IGXA 3V64C 3PGHA 1IOEL 3IJEB 5CKNA 3KQBL 1XKBA 3C9AC 2WFXB 4JYUL 2WG4B 1FAXL 1HZ8A 2XBVL 5FDQA 1EMOA 3HS7A 3KL6B 1Q4GA 3N8VA 1YUFA 2AYLA 1PRHA 5L30L 2Y81B 3SOQA 2K2TA 3TZIA 1YUGA 3N8WB 1MQ6L 1ZAQA 4D0EA 4OTYA 4Z6AL 1RFNB 4X8UL 1BF9A 1IQLL 3BPSE 3RR3A 2NPRA 2PHBB 4CUFA 2P94L 2WYJB 4M10A 2BO2A 3FBYA 2BZ6L 6COXA 1G1TA 3LIWB 4BDWA 1CVWL 1IQIL 2WFTA 2FD6A 1YO8A 1IOXA 2RHPA 4Y79B 1ATAA 1X7AL 1Z6CA 5JW1A 2XC5L 1LQDA 2Y82B 1QFKL 1ATBA 1KSNB 2P16L 2M74A 3CA7A 1LPKA 2OYUP 4COXA 1NT0A 1HX2A 2W2NE 5E8DA 2GD4A 3ASIA 3HO3A 4ISIL 5JVZA 5CKQA 1IGZA 4ZHAB 3U73A 2VH6B 2I9BA 1JV2B 1M1XB 3CS7L 1W8BL 2Y80B 4Y6DB 1SZBA 1U67A 4C16A 1F7MA 3KRKA 1IQFL 1IVOC 1C5MF 3NJPC 4Y76B 4A7IA 4TGFA 2BQ6A 1JL9A 2VH0B 3GCWE 3SOBB 1LMJA 5F19A 4RS0A 1EZQB 1TOZA 3M36L 5F1AA 5IKQA 2VWLL 1K37A 3DEMA 5K0HB 2BOUA 2Y38A 3ZYIB 4X8TL 1IQNL 2K2SB 1K36A 1V3XB 2VVVL 1F7EA 1KLOA 1EAIC 2P28B 2VWMK 3HO5A 3TK6B 1PGEA 3FCSB 1NFWB 2UWLB 5KIRA 4JZFL 1L5GB 3FFGL 5JVYA 2W3IB 2J34B 3MDLA 1IQKL 4M11A 1G1RA 1ATEA 3F1SB 3QCWA 1JBUL 2W2QE 3CENL 2BQWA 2FLGA 1N1IA 2XBXL 1DIYA 3N8XA 1TPGA 4YT7L 1HT8A 5COXA 5JBBE 4Z0LA 4NG9L 1IQGL 4MMZB 1FE2A 1EPHA 4JYVL 4CUDA 1MQ5L 1PTHA 1CQEA 2J94B 3N8YA 2ADXA 4BTIA 3KK6A 4RRZA 2P93L 2EI7B 2Y5HL 2W86A 3BT2A 3P5BL 2XC0L 5JBCE 3QMOA 2MHPA 2P3TA 1IP0A 1XFEA 3GISX 2I9AA 4BXSA 2WPIE 3HS5A 1EQHA 1EPGA 3KQCL 1NFXB 1OB1C 1URKA 4LORA 2PR3B 1DDXA 1N7DA 2H9EL 4XBMA 4XLWA 1EGFA 1EQGA 3TGFA 1G2LB 2BMGA 1NFYB 3HS6A 2WPKE 1KLIL 1CCFA 2W2PE 5I46L 1DVAL 4ZAEB 1FF7A 4ZH8B 2XBWL 4ISHL 5L2ZL 3LAQA 5JB8E 2VVUL 3M37L 2Q1JB 3NTBA 4CUEA 4FM5A 2UWPB 2BQ7A 2VJ3A 1IJQA 1XDTR 1APOA 4RRYA 1UZPA 4YZUB 4MMXB 1G2MB 4MMYB 3Q3KB 4JZDL 1HREA 3LN0A 2KV4A 2J4IB 1EBVA 2UWOB 4NGAL 2Y5FL 2W3KB 3KQDL 2EI8B 4AQTA 1AUTL 3ZYJB 1UZKA 1APQA 1HJ7A 1F0SB 3LTFB 3ZYGA 1NFUB 3TBDA 1NPEB 2BOXA 3SOVA 1EPIA 1HAFA 1YGCL 2Y7ZB 4XL1A 2FZZL 1XKAL 2P3UA 3ENSA 3N8WA 2BOHA 1L3YA 1G1SA 2CJIB 4D90A 2WG3C 2KB9A 1FFMA 2P95L 2W2ME 3V65B 2WPHE 2JKHL 1IQEL 5IKVA 2G00L 1WHEA 1I0UA 3HPTA 3CFWA 1F0RB 4PH9A 3KCGL 3N8YB 2DDUA 4LMFA 1U8CB 4NA9L 4G1MB 3OLUA 1HCGB 2XC4L 1G1QA 4X8SL 4ZXXL 4BTTA 2WPLE 1W7XL 1IQHL 2P3FL 3IITB 2J2UB 3OLTA 2VVCK 4BTUA 2MGPA 2PUQL 3MQEA 1TLEA 4JZEL 1EPJA 4BDXA 4ZXYL 2BOKL 1CEJA 2F9BL 5IKTA
chains in the Genus database with same CATH superfamily
2KL7A 1J9CL 3Q7DA 3R05A 4Y71B 4Z0KB 2KNIA 3F6UL 1P0SL 1A3PA 1FSBA 1DX5I 1V1HA 1UZJA 3KQEL 4OTJA 2WPME 4O1ZA 5JB9E 1Z6EL 4Y7BB 4X8VL 2H9EC 1B9WA 2Y5GL 2J38B 3H5CB 3TK5B 2MGRA 2W2OE 2HORA 1V1IA 1GK5A 3NTGA 3U7UG 1KLJL 1YUKB 1HAEA 2P26A 1FJSL 2FLBL 4RRWA 2RA0L 3HO4A 4RUTA 1NZIA 1CVUA 4Y7AB 5JBAE 2VRSA 2FLRL 1KIGL 2HOXA 3N8ZA 5KN5C 4A94C 3NT1A 2D1JB 2XBYL 4GU3A 1FAKL 1PXXA 2BT8A 4YT6L 1ADXA 1MOXC 1CCVA 4RRXA 1QIUA 3LN1A 3K9XA 2YGOA 2YGPA 5IKRA 3QH0A 2B7DL 4E1GA 1IQML 2Y7XB 2RNLA 1PFXL 2W26B 1EMNA 1DQBA 1WU1B 3LTGD 2WPJE 5CISA 2VWOL 4BXWA 4D0FA 3GCXE 1LPZA 1O5DL 3LC5B 1HRFA 1CX2A 1WHFA 2TGFA 4O02B 2OYEP 2P3FN 4GU4A 5CKMA 3POYA 3SW2A 3EGFA 2WYGB 1IQJL 3BT1A 1LPGA 2VWNL 3ELAL 1COUA 3TH3L 3LC3B 2EI6B 1UZQA 5L2YL 2J95B 4CSYA 1HT5A 5EGMB 1P9JA 1ATDA 1NQLB 1IGXA 3V64C 3PGHA 1IOEL 3IJEB 5CKNA 3KQBL 1XKBA 3C9AC 2WFXB 4JYUL 2WG4B 1FAXL 1HZ8A 2XBVL 5FDQA 1EMOA 3HS7A 3KL6B 1Q4GA 3N8VA 1YUFA 2AYLA 1PRHA 5L30L 2Y81B 3SOQA 2K2TA 3TZIA 1YUGA 3N8WB 1MQ6L 1ZAQA 4D0EA 4OTYA 4Z6AL 1RFNB 1KKEA 4X8UL 1BF9A 1IQLL 3BPSE 3RR3A 2NPRA 2PHBB 4CUFA 2P94L 2WYJB 4M10A 2BO2A 3FBYA 2BZ6L 6COXA 1G1TA 3LIWB 4BDWA 1CVWL 1IQIL 2WFTA 2FD6A 1YO8A 1IOXA 2RHPA 4Y79B 1ATAA 1X7AL 1Z6CA 5JW1A 2XC5L 1LQDA 2Y82B 1QFKL 1ATBA 1KSNB 2P16L 2M74A 3CA7A 1LPKA 2OYUP 4COXA 1NT0A 1HX2A 2W2NE 5E8DA 2GD4A 3ASIA 3HO3A 4ISIL 5JVZA 5CKQA 1IGZA 4ZHAB 3U73A 2VH6B 2I9BA 1JV2B 1M1XB 3CS7L 1W8BL 2Y80B 4Y6DB 1SZBA 1U67A 4C16A 1F7MA 3KRKA 1IQFL 1IVOC 1C5MF 3NJPC 4Y76B 4A7IA 4TGFA 2BQ6A 1JL9A 1LMMA 2VH0B 3GCWE 3SOBB 1LMJA 5F19A 4RS0A 1LK9A 1EZQB 1TOZA 3M36L 5F1AA 5IKQA 2VWLL 1K37A 3DEMA 5K0HB 2BOUA 2Y38A 2WZPP 3ZYIB 4X8TL 1IQNL 2K2SB 1K36A 1V3XB 2VVVL 1F7EA 1KLOA 1EAIC 2P28B 2VWMK 3HO5A 3TK6B 1PGEA 3FCSB 1NFWB 2UWLB 5KIRA 4JZFL 1L5GB 3FFGL 3S6XA 5JVYA 2W3IB 2J34B 3MDLA 1IQKL 4M11A 1G1RA 1ATEA 3F1SB 3QCWA 1JBUL 2W2QE 3CENL 2BQWA 2FLGA 1N1IA 2XBXL 1DIYA 3N8XA 1TPGA 4YT7L 1HT8A 5COXA 5JBBE 4Z0LA 4NG9L 1IQGL 4MMZB 1FE2A 1EPHA 4JYVL 4CUDA 1MQ5L 1PTHA 1CQEA 2J94B 3N8YA 2ADXA 4BTIA 3KK6A 4RRZA 2P93L 2EI7B 2Y5HL 2W86A 3BT2A 3P5BL 2XC0L 5JBCE 2YGQA 3QMOA 2MHPA 2P3TA 1IP0A 1XFEA 3GISX 2I9AA 4BXSA 2WPIE 3HS5A 1EQHA 1EPGA 3KQCL 1NFXB 1OB1C 1URKA 4LORA 2PR3B 1DDXA 1N7DA 2H9EL 4XBMA 4XLWA 1EGFA 1EQGA 3TGFA 1G2LB 2BMGA 2JJLA 1NFYB 2BT7A 3HS6A 2WPKE 1KLIL 1CCFA 2W2PE 5I46L 1DVAL 4ZAEB 1FF7A 4ZH8B 2XBWL 4ISHL 5L2ZL 3LAQA 5JB8E 2VVUL 3M37L 2Q1JB 3NTBA 4CUEA 4FM5A 2UWPB 2BQ7A 2VJ3A 1IJQA 1XDTR 1APOA 4RRYA 1UZPA 4YZUB 4MMXB 1G2MB 4MMYB 3Q3KB 4JZDL 1HREA 3LN0A 2KV4A 2J4IB 1EBVA 2UWOB 4NGAL 2Y5FL 2W3KB 3KQDL 2EI8B 4AQTA 1AUTL 3ZYJB 1UZKA 1APQA 1HJ7A 1F0SB 3LTFB 3ZYGA 1NFUB 3TBDA 1NPEB 2BOXA 3SOVA 2BSFA 1EPIA 1HAFA 1YGCL 2Y7ZB 4XL1A 2FZZL 1XKAL 2P3UA 3ENSA 3N8WA 2BOHA 1L3YA 1G1SA 2CJIB 4D90A 2WG3C 2KB9A 1FFMA 2P95L 2W2ME 3V65B 2WPHE 2JKHL 1IQEL 5IKVA 2G00L 1WHEA 1I0UA 3HPTA 3CFWA 1F0RB 4PH9A 3KCGL 3N8YB 2DDUA 4LMFA 1U8CB 4NA9L 4G1MB 3OLUA 1HCGB 2XC4L 1G1QA 4X8SL 4ZXXL 4BTTA 2WPLE 1W7XL 1IQHL 2P3FL 3IITB 2J2UB 3OLTA 2VVCK 4BTUA 2MGPA 2PUQL 3MQEA 1TLEA 4JZEL 1EPJA 4BDXA 4ZXYL 2BOKL 1CEJA 2F9BL 5IKTA
chains in the Genus database with same CATH topology
2KL7A 1J9CL 3Q7DA 3R05A 4Y71B 4Z0KB 2KNIA 3F6UL 1P0SL 1A3PA 1FSBA 1DX5I 1UZJA 3KQEL 4OTJA 2WPME 4O1ZA 5JB9E 1Z6EL 4Y7BB 4X8VL 2H9EC 1B9WA 2Y5GL 2J38B 3H5CB 3TK5B 2MGRA 2W2OE 1GK5A 3NTGA 3U7UG 1KLJL 1YUKB 1HAEA 2P26A 1FJSL 2FLBL 4RRWA 2RA0L 3HO4A 4RUTA 1NZIA 1CVUA 4Y7AB 5JBAE 2FLRL 1KIGL 3N8ZA 5KN5C 4A94C 3NT1A 2D1JB 2XBYL 1FAKL 1PXXA 4YT6L 1ADXA 1MOXC 1CCVA 4RRXA 3LN1A 3K9XA 2YGOA 2YGPA 5IKRA 3QH0A 2B7DL 4E1GA 1IQML 2Y7XB 2RNLA 1PFXL 2W26B 1EMNA 1DQBA 1WU1B 3LTGD 2WPJE 5CISA 2VWOL 4BXWA 4D0FA 3GCXE 1LPZA 1O5DL 3LC5B 1HRFA 1CX2A 1WHFA 2TGFA 4O02B 2OYEP 2P3FN 5CKMA 3POYA 3SW2A 3EGFA 2WYGB 1IQJL 3BT1A 1LPGA 2VWNL 3ELAL 1COUA 3TH3L 3LC3B 2EI6B 1UZQA 5L2YL 2J95B 4CSYA 1HT5A 5EGMB 1P9JA 1ATDA 1NQLB 1IGXA 3V64C 3PGHA 1IOEL 3IJEB 5CKNA 3KQBL 1XKBA 3C9AC 2WFXB 4JYUL 2WG4B 1FAXL 1HZ8A 2XBVL 5FDQA 1EMOA 3HS7A 3KL6B 1Q4GA 3N8VA 1YUFA 2AYLA 1PRHA 5L30L 2Y81B 3SOQA 2K2TA 3TZIA 1YUGA 3N8WB 1MQ6L 1ZAQA 4D0EA 4OTYA 4Z6AL 1RFNB 4X8UL 1BF9A 1IQLL 3BPSE 3RR3A 2NPRA 2PHBB 4CUFA 2P94L 2WYJB 4M10A 2BO2A 3FBYA 2BZ6L 6COXA 1G1TA 3LIWB 4BDWA 1CVWL 1IQIL 2WFTA 2FD6A 1YO8A 1IOXA 2RHPA 4Y79B 1ATAA 1X7AL 1Z6CA 5JW1A 2XC5L 1LQDA 2Y82B 1QFKL 1ATBA 1KSNB 2P16L 2M74A 3CA7A 1LPKA 2OYUP 4COXA 1NT0A 1HX2A 2W2NE 5E8DA 2GD4A 3ASIA 3HO3A 4ISIL 5JVZA 5CKQA 1IGZA 4ZHAB 3U73A 2VH6B 2I9BA 1JV2B 1M1XB 3CS7L 1W8BL 2Y80B 4Y6DB 1SZBA 1U67A 4C16A 1F7MA 3KRKA 1IQFL 1IVOC 1C5MF 3NJPC 4Y76B 4A7IA 4TGFA 2BQ6A 1JL9A 1LMMA 2VH0B 3GCWE 3SOBB 1LMJA 5F19A 4RS0A 1EZQB 1TOZA 3M36L 5F1AA 5IKQA 2VWLL 1K37A 3DEMA 5K0HB 2BOUA 2Y38A 2WZPP 3ZYIB 4X8TL 1IQNL 2K2SB 1K36A 1V3XB 2VVVL 1F7EA 1KLOA 1EAIC 2P28B 2VWMK 3HO5A 3TK6B 1PGEA 3FCSB 1NFWB 2UWLB 5KIRA 4JZFL 1L5GB 3FFGL 3S6XA 5JVYA 2W3IB 2J34B 3MDLA 1IQKL 4M11A 1G1RA 1ATEA 3F1SB 3QCWA 1JBUL 2W2QE 3CENL 2BQWA 2FLGA 1N1IA 2XBXL 1DIYA 3N8XA 1TPGA 4YT7L 1HT8A 5COXA 5JBBE 4Z0LA 4NG9L 1IQGL 4MMZB 1FE2A 1EPHA 4JYVL 4CUDA 1MQ5L 1PTHA 1CQEA 2J94B 3N8YA 2ADXA 4BTIA 3KK6A 4RRZA 2P93L 2EI7B 2Y5HL 2W86A 3BT2A 3P5BL 2XC0L 5JBCE 2YGQA 3QMOA 2MHPA 2P3TA 1IP0A 1XFEA 3GISX 2I9AA 4BXSA 2WPIE 3HS5A 1EQHA 1EPGA 3KQCL 1NFXB 1OB1C 1URKA 4LORA 2PR3B 1DDXA 1N7DA 2H9EL 4XBMA 4XLWA 1EGFA 1EQGA 3TGFA 1G2LB 2BMGA 1NFYB 3HS6A 2WPKE 1KLIL 1CCFA 2W2PE 5I46L 1DVAL 4ZAEB 1FF7A 4ZH8B 2XBWL 4ISHL 5L2ZL 3LAQA 5JB8E 2VVUL 3M37L 2Q1JB 3NTBA 4CUEA 4FM5A 2UWPB 2BQ7A 2VJ3A 1IJQA 1XDTR 1APOA 4RRYA 1UZPA 4YZUB 4MMXB 1G2MB 4MMYB 3Q3KB 4JZDL 1HREA 3LN0A 2KV4A 2J4IB 1EBVA 2UWOB 4NGAL 2Y5FL 2W3KB 3KQDL 2EI8B 4AQTA 1AUTL 3ZYJB 1UZKA 1APQA 1HJ7A 1F0SB 3LTFB 3ZYGA 1NFUB 3TBDA 1NPEB 2BOXA 3SOVA 1EPIA 1HAFA 1YGCL 2Y7ZB 4XL1A 2FZZL 1XKAL 2P3UA 3ENSA 3N8WA 2BOHA 1L3YA 1G1SA 2CJIB 4D90A 2WG3C 2KB9A 1FFMA 2P95L 2W2ME 3V65B 2WPHE 2JKHL 1IQEL 5IKVA 2G00L 1WHEA 1I0UA 3HPTA 3CFWA 1F0RB 4PH9A 3KCGL 3N8YB 2DDUA 4LMFA 1U8CB 4NA9L 4G1MB 3OLUA 1HCGB 2XC4L 1G1QA 4X8SL 4ZXXL 4BTTA 2WPLE 1W7XL 1IQHL 2P3FL 3IITB 2J2UB 3OLTA 2VVCK 4BTUA 2MGPA 2PUQL 3MQEA 1TLEA 4JZEL 1EPJA 4BDXA 4ZXYL 2BOKL 1CEJA 2F9BL 5IKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KL7 A;  1J9C L;  3Q7D A;  3R05 A;  4Y71 B;  4Z0K B;  3F6U L;  1P0S L;  1A3P A;  1FSB A;  1DX5 I;  1UZJ A;  3KQE L;  4OTJ A;  2WPM E;  4O1Z A;  5JB9 E;  1Z6E L;  4Y7B B;  4X8V L;  1B9W A;  2Y5G L;  2J38 B;  3H5C B;  3TK5 B;  2MGR A;  2W2O E;  1GK5 A;  3NTG A;  3U7U G;  1KLJ L;  1YUK B;  1HAE A;  2P26 A;  1FJS L;  2FLB L;  4RRW A;  2RA0 L;  3HO4 A;  4RUT A;  1NZI A;  1CVU A;  4Y7A B;  5JBA E;  2FLR L;  1KIG L;  3N8Z A;  5KN5 C;  3NT1 A;  2D1J B;  2XBY L;  1FAK L;  1PXX A;  4YT6 L;  1ADX A;  1MOX C;  1CCV A;  4RRX A;  3LN1 A;  3K9X A;  2YGO A;  2YGP A;  5IKR A;  3QH0 A;  2B7D L;  4E1G A;  1IQM L;  2Y7X B;  2RNL A;  1PFX L;  2W26 B;  1EMN A;  1DQB A;  1WU1 B;  3LTG D;  2WPJ E;  5CIS A;  2VWO L;  4BXW A;  4D0F A;  3GCX E;  1LPZ A;  1O5D L;  3LC5 B;  1HRF A;  1CX2 A;  1WHF A;  2TGF A;  4O02 B;  2OYE P;  2P3F N;  5CKM A;  3POY A;  3SW2 A;  3EGF A;  2WYG B;  1IQJ L;  3BT1 A;  1LPG A;  2VWN L;  3ELA L;  1COU A;  3TH3 L;  3LC3 B;  2EI6 B;  1UZQ A;  5L2Y L;  2J95 B;  4CSY A;  1HT5 A;  5EGM B;  1P9J A;  1ATD A;  1NQL B;  1IGX A;  3V64 C;  3PGH A;  1IOE L;  3IJE B;  5CKN A;  3KQB L;  1XKB A;  3C9A C;  2WFX B;  4JYU L;  2WG4 B;  1FAX L;  1HZ8 A;  2XBV L;  5FDQ A;  1EMO A;  3HS7 A;  3KL6 B;  1Q4G A;  3N8V A;  1YUF A;  2AYL A;  1PRH A;  5L30 L;  2Y81 B;  3SOQ A;  2K2T A;  3TZI A;  1YUG A;  3N8W B;  1MQ6 L;  1ZAQ A;  4D0E A;  4OTY A;  4Z6A L;  1RFN B;  4X8U L;  1BF9 A;  1IQL L;  3BPS E;  3RR3 A;  2NPR A;  2PHB B;  4CUF A;  2P94 L;  2WYJ B;  4M10 A;  2BO2 A;  3FBY A;  2BZ6 L;  6COX A;  1G1T A;  3LIW B;  4BDW A;  1CVW L;  1IQI L;  2WFT A;  2FD6 A;  1YO8 A;  1IOX A;  2RHP A;  4Y79 B;  1ATA A;  1X7A L;  1Z6C A;  5JW1 A;  2XC5 L;  1LQD A;  2Y82 B;  1QFK L;  1ATB A;  1KSN B;  2P16 L;  2M74 A;  3CA7 A;  1LPK A;  2OYU P;  4COX A;  1NT0 A;  1HX2 A;  2W2N E;  5E8D A;  2GD4 A;  3ASI A;  3HO3 A;  4ISI L;  5JVZ A;  5CKQ A;  1IGZ A;  4ZHA B;  3U73 A;  2VH6 B;  2I9B A;  1JV2 B;  1M1X B;  3CS7 L;  1W8B L;  2Y80 B;  4Y6D B;  1SZB A;  1U67 A;  4C16 A;  1F7M A;  3KRK A;  1IQF L;  1IVO C;  1C5M F;  3NJP C;  4Y76 B;  4A7I A;  4TGF A;  2BQ6 A;  1JL9 A;  2VH0 B;  3GCW E;  3SOB B;  1LMJ A;  5F19 A;  4RS0 A;  1EZQ B;  1TOZ A;  3M36 L;  5F1A A;  5IKQ A;  2VWL L;  1K37 A;  3DEM A;  5K0H B;  2BOU A;  2Y38 A;  3ZYI B;  4X8T L;  1IQN L;  2K2S B;  1K36 A;  1V3X B;  2VVV L;  1F7E A;  1KLO A;  1EAI C;  2P28 B;  2VWM K;  3HO5 A;  3TK6 B;  1PGE A;  3FCS B;  1NFW B;  2UWL B;  5KIR A;  4JZF L;  1L5G B;  3FFG L;  5JVY A;  2W3I B;  2J34 B;  3MDL A;  1IQK L;  4M11 A;  1G1R A;  1ATE A;  3F1S B;  3QCW A;  1JBU L;  2W2Q E;  3CEN L;  2BQW A;  2FLG A;  1N1I A;  2XBX L;  1DIY A;  3N8X A;  1TPG A;  4YT7 L;  1HT8 A;  5COX A;  5JBB E;  4Z0L A;  4NG9 L;  1IQG L;  4MMZ B;  1FE2 A;  1EPH A;  4JYV L;  4CUD A;  1MQ5 L;  1PTH A;  1CQE A;  2J94 B;  3N8Y A;  2ADX A;  4BTI A;  3KK6 A;  4RRZ A;  2P93 L;  2EI7 B;  2Y5H L;  2W86 A;  3BT2 A;  3P5B L;  2XC0 L;  5JBC E;  3QMO A;  2MHP A;  2P3T A;  1IP0 A;  1XFE A;  3GIS X;  2I9A A;  4BXS A;  2WPI E;  3HS5 A;  1EQH A;  1EPG A;  3KQC L;  1NFX B;  1OB1 C;  1URK A;  4LOR A;  2PR3 B;  1DDX A;  1N7D A;  2H9E L;  4XBM A;  4XLW A;  1EGF A;  1EQG A;  3TGF A;  1G2L B;  2BMG A;  1NFY B;  3HS6 A;  2WPK E;  1KLI L;  1CCF A;  2W2P E;  5I46 L;  1DVA L;  4ZAE B;  1FF7 A;  4ZH8 B;  2XBW L;  4ISH L;  5L2Z L;  3LAQ A;  5JB8 E;  2VVU L;  3M37 L;  2Q1J B;  3NTB A;  4CUE A;  4FM5 A;  2UWP B;  2BQ7 A;  2VJ3 A;  1IJQ A;  1XDT R;  1APO A;  4RRY A;  1UZP A;  4YZU B;  4MMX B;  1G2M B;  4MMY B;  3Q3K B;  4JZD L;  1HRE A;  3LN0 A;  2KV4 A;  2J4I B;  1EBV A;  2UWO B;  4NGA L;  2Y5F L;  2W3K B;  3KQD L;  2EI8 B;  4AQT A;  1AUT L;  3ZYJ B;  1UZK A;  1APQ A;  1HJ7 A;  1F0S B;  3LTF B;  3ZYG A;  1NFU B;  3TBD A;  1NPE B;  2BOX A;  3SOV A;  1EPI A;  1HAF A;  1YGC L;  2Y7Z B;  4XL1 A;  2FZZ L;  1XKA L;  2P3U A;  3ENS A;  3N8W A;  2BOH A;  1L3Y A;  1G1S A;  2CJI B;  4D90 A;  2WG3 C;  2KB9 A;  1FFM A;  2P95 L;  2W2M E;  3V65 B;  2WPH E;  2JKH L;  1IQE L;  5IKV A;  2G00 L;  1WHE A;  1I0U A;  3HPT A;  3CFW A;  1F0R B;  4PH9 A;  3KCG L;  3N8Y B;  2DDU A;  4LMF A;  1U8C B;  4NA9 L;  4G1M B;  3OLU A;  1HCG B;  2XC4 L;  1G1Q A;  4X8S L;  4ZXX L;  4BTT A;  2WPL E;  1W7X L;  1IQH L;  2P3F L;  3IIT B;  2J2U B;  3OLT A;  2VVC K;  4BTU A;  2MGP A;  2PUQ L;  3MQE A;  1TLE A;  4JZE L;  1EPJ A;  4BDX A;  4ZXY L;  2BOK L;  1CEJ A;  2F9B L;  5IKT A; 
#chains in the Genus database with same CATH topology
 2KL7 A;  1J9C L;  3Q7D A;  3R05 A;  4Y71 B;  4Z0K B;  2KNI A;  3F6U L;  1P0S L;  1A3P A;  1FSB A;  1DX5 I;  1V1H A;  1UZJ A;  3KQE L;  4OTJ A;  2WPM E;  4O1Z A;  5JB9 E;  1Z6E L;  4Y7B B;  4X8V L;  2H9E C;  1B9W A;  2Y5G L;  2J38 B;  3H5C B;  3TK5 B;  2MGR A;  2W2O E;  2HOR A;  1V1I A;  1GK5 A;  3NTG A;  3U7U G;  1KLJ L;  1YUK B;  1HAE A;  2P26 A;  1FJS L;  2FLB L;  4RRW A;  2RA0 L;  3HO4 A;  4RUT A;  1NZI A;  1CVU A;  4Y7A B;  5JBA E;  2VRS A;  2FLR L;  1KIG L;  2HOX A;  3N8Z A;  5KN5 C;  4A94 C;  3NT1 A;  2D1J B;  2XBY L;  4GU3 A;  1FAK L;  1PXX A;  2BT8 A;  4YT6 L;  1ADX A;  1MOX C;  1CCV A;  4RRX A;  1QIU A;  3LN1 A;  3K9X A;  2YGO A;  2YGP A;  5IKR A;  3QH0 A;  2B7D L;  4E1G A;  1IQM L;  2Y7X B;  2RNL A;  1PFX L;  2W26 B;  1EMN A;  1DQB A;  1WU1 B;  3LTG D;  2WPJ E;  5CIS A;  2VWO L;  4BXW A;  4D0F A;  3GCX E;  1LPZ A;  1O5D L;  3LC5 B;  1HRF A;  1CX2 A;  1WHF A;  2TGF A;  4O02 B;  2OYE P;  2P3F N;  4GU4 A;  5CKM A;  3POY A;  3SW2 A;  3EGF A;  2WYG B;  1IQJ L;  3BT1 A;  1LPG A;  2VWN L;  3ELA L;  1COU A;  3TH3 L;  3LC3 B;  2EI6 B;  1UZQ A;  5L2Y L;  2J95 B;  4CSY A;  1HT5 A;  5EGM B;  1P9J A;  1ATD A;  1NQL B;  1IGX A;  3V64 C;  3PGH A;  1IOE L;  3IJE B;  5CKN A;  3KQB L;  1XKB A;  3C9A C;  2WFX B;  4JYU L;  2WG4 B;  1FAX L;  1HZ8 A;  2XBV L;  5FDQ A;  1EMO A;  3HS7 A;  3KL6 B;  1Q4G A;  3N8V A;  1YUF A;  2AYL A;  1PRH A;  5L30 L;  2Y81 B;  3SOQ A;  2K2T A;  3TZI A;  1YUG A;  3N8W B;  1MQ6 L;  1ZAQ A;  4D0E A;  4OTY A;  4Z6A L;  1RFN B;  1KKE A;  4X8U L;  1BF9 A;  1IQL L;  3BPS E;  3RR3 A;  2NPR A;  2PHB B;  4CUF A;  2P94 L;  2WYJ B;  4M10 A;  2BO2 A;  3FBY A;  2BZ6 L;  6COX A;  1G1T A;  3LIW B;  4BDW A;  1CVW L;  1IQI L;  2WFT A;  2FD6 A;  1YO8 A;  1IOX A;  2RHP A;  4Y79 B;  1ATA A;  1X7A L;  1Z6C A;  5JW1 A;  2XC5 L;  1LQD A;  2Y82 B;  1QFK L;  1ATB A;  1KSN B;  2P16 L;  2M74 A;  3CA7 A;  1LPK A;  2OYU P;  4COX A;  1NT0 A;  1HX2 A;  2W2N E;  5E8D A;  2GD4 A;  3ASI A;  3HO3 A;  4ISI L;  5JVZ A;  5CKQ A;  1IGZ A;  4ZHA B;  3U73 A;  2VH6 B;  2I9B A;  1JV2 B;  1M1X B;  3CS7 L;  1W8B L;  2Y80 B;  4Y6D B;  1SZB A;  1U67 A;  4C16 A;  1F7M A;  3KRK A;  1IQF L;  1IVO C;  1C5M F;  3NJP C;  4Y76 B;  4A7I A;  4TGF A;  2BQ6 A;  1JL9 A;  1LMM A;  2VH0 B;  3GCW E;  3SOB B;  1LMJ A;  5F19 A;  4RS0 A;  1LK9 A;  1EZQ B;  1TOZ A;  3M36 L;  5F1A A;  5IKQ A;  2VWL L;  1K37 A;  3DEM A;  5K0H B;  2BOU A;  2Y38 A;  2WZP P;  3ZYI B;  4X8T L;  1IQN L;  2K2S B;  1K36 A;  1V3X B;  2VVV L;  1F7E A;  1KLO A;  1EAI C;  2P28 B;  2VWM K;  3HO5 A;  3TK6 B;  1PGE A;  3FCS B;  1NFW B;  2UWL B;  5KIR A;  4JZF L;  1L5G B;  3FFG L;  3S6X A;  5JVY A;  2W3I B;  2J34 B;  3MDL A;  1IQK L;  4M11 A;  1G1R A;  1ATE A;  3F1S B;  3QCW A;  1JBU L;  2W2Q E;  3CEN L;  2BQW A;  2FLG A;  1N1I A;  2XBX L;  1DIY A;  3N8X A;  1TPG A;  4YT7 L;  1HT8 A;  5COX A;  5JBB E;  4Z0L A;  4NG9 L;  1IQG L;  4MMZ B;  1FE2 A;  1EPH A;  4JYV L;  4CUD A;  1MQ5 L;  1PTH A;  1CQE A;  2J94 B;  3N8Y A;  2ADX A;  4BTI A;  3KK6 A;  4RRZ A;  2P93 L;  2EI7 B;  2Y5H L;  2W86 A;  3BT2 A;  3P5B L;  2XC0 L;  5JBC E;  2YGQ A;  3QMO A;  2MHP A;  2P3T A;  1IP0 A;  1XFE A;  3GIS X;  2I9A A;  4BXS A;  2WPI E;  3HS5 A;  1EQH A;  1EPG A;  3KQC L;  1NFX B;  1OB1 C;  1URK A;  4LOR A;  2PR3 B;  1DDX A;  1N7D A;  2H9E L;  4XBM A;  4XLW A;  1EGF A;  1EQG A;  3TGF A;  1G2L B;  2BMG A;  2JJL A;  1NFY B;  2BT7 A;  3HS6 A;  2WPK E;  1KLI L;  1CCF A;  2W2P E;  5I46 L;  1DVA L;  4ZAE B;  1FF7 A;  4ZH8 B;  2XBW L;  4ISH L;  5L2Z L;  3LAQ A;  5JB8 E;  2VVU L;  3M37 L;  2Q1J B;  3NTB A;  4CUE A;  4FM5 A;  2UWP B;  2BQ7 A;  2VJ3 A;  1IJQ A;  1XDT R;  1APO A;  4RRY A;  1UZP A;  4YZU B;  4MMX B;  1G2M B;  4MMY B;  3Q3K B;  4JZD L;  1HRE A;  3LN0 A;  2KV4 A;  2J4I B;  1EBV A;  2UWO B;  4NGA L;  2Y5F L;  2W3K B;  3KQD L;  2EI8 B;  4AQT A;  1AUT L;  3ZYJ B;  1UZK A;  1APQ A;  1HJ7 A;  1F0S B;  3LTF B;  3ZYG A;  1NFU B;  3TBD A;  1NPE B;  2BOX A;  3SOV A;  2BSF A;  1EPI A;  1HAF A;  1YGC L;  2Y7Z B;  4XL1 A;  2FZZ L;  1XKA L;  2P3U A;  3ENS A;  3N8W A;  2BOH A;  1L3Y A;  1G1S A;  2CJI B;  4D90 A;  2WG3 C;  2KB9 A;  1FFM A;  2P95 L;  2W2M E;  3V65 B;  2WPH E;  2JKH L;  1IQE L;  5IKV A;  2G00 L;  1WHE A;  1I0U A;  3HPT A;  3CFW A;  1F0R B;  4PH9 A;  3KCG L;  3N8Y B;  2DDU A;  4LMF A;  1U8C B;  4NA9 L;  4G1M B;  3OLU A;  1HCG B;  2XC4 L;  1G1Q A;  4X8S L;  4ZXX L;  4BTT A;  2WPL E;  1W7X L;  1IQH L;  2P3F L;  3IIT B;  2J2U B;  3OLT A;  2VVC K;  4BTU A;  2MGP A;  2PUQ L;  3MQE A;  1TLE A;  4JZE L;  1EPJ A;  4BDX A;  4ZXY L;  2BOK L;  1CEJ A;  2F9B L;  5IKT A; 
#chains in the Genus database with same CATH homology
 2KL7 A;  1J9C L;  3Q7D A;  3R05 A;  4Y71 B;  4Z0K B;  2KNI A;  3F6U L;  1P0S L;  1A3P A;  1FSB A;  1DX5 I;  1UZJ A;  3KQE L;  4OTJ A;  2WPM E;  4O1Z A;  5JB9 E;  1Z6E L;  4Y7B B;  4X8V L;  2H9E C;  1B9W A;  2Y5G L;  2J38 B;  3H5C B;  3TK5 B;  2MGR A;  2W2O E;  1GK5 A;  3NTG A;  3U7U G;  1KLJ L;  1YUK B;  1HAE A;  2P26 A;  1FJS L;  2FLB L;  4RRW A;  2RA0 L;  3HO4 A;  4RUT A;  1NZI A;  1CVU A;  4Y7A B;  5JBA E;  2FLR L;  1KIG L;  3N8Z A;  5KN5 C;  4A94 C;  3NT1 A;  2D1J B;  2XBY L;  1FAK L;  1PXX A;  4YT6 L;  1ADX A;  1MOX C;  1CCV A;  4RRX A;  3LN1 A;  3K9X A;  2YGO A;  2YGP A;  5IKR A;  3QH0 A;  2B7D L;  4E1G A;  1IQM L;  2Y7X B;  2RNL A;  1PFX L;  2W26 B;  1EMN A;  1DQB A;  1WU1 B;  3LTG D;  2WPJ E;  5CIS A;  2VWO L;  4BXW A;  4D0F A;  3GCX E;  1LPZ A;  1O5D L;  3LC5 B;  1HRF A;  1CX2 A;  1WHF A;  2TGF A;  4O02 B;  2OYE P;  2P3F N;  5CKM A;  3POY A;  3SW2 A;  3EGF A;  2WYG B;  1IQJ L;  3BT1 A;  1LPG A;  2VWN L;  3ELA L;  1COU A;  3TH3 L;  3LC3 B;  2EI6 B;  1UZQ A;  5L2Y L;  2J95 B;  4CSY A;  1HT5 A;  5EGM B;  1P9J A;  1ATD A;  1NQL B;  1IGX A;  3V64 C;  3PGH A;  1IOE L;  3IJE B;  5CKN A;  3KQB L;  1XKB A;  3C9A C;  2WFX B;  4JYU L;  2WG4 B;  1FAX L;  1HZ8 A;  2XBV L;  5FDQ A;  1EMO A;  3HS7 A;  3KL6 B;  1Q4G A;  3N8V A;  1YUF A;  2AYL A;  1PRH A;  5L30 L;  2Y81 B;  3SOQ A;  2K2T A;  3TZI A;  1YUG A;  3N8W B;  1MQ6 L;  1ZAQ A;  4D0E A;  4OTY A;  4Z6A L;  1RFN B;  4X8U L;  1BF9 A;  1IQL L;  3BPS E;  3RR3 A;  2NPR A;  2PHB B;  4CUF A;  2P94 L;  2WYJ B;  4M10 A;  2BO2 A;  3FBY A;  2BZ6 L;  6COX A;  1G1T A;  3LIW B;  4BDW A;  1CVW L;  1IQI L;  2WFT A;  2FD6 A;  1YO8 A;  1IOX A;  2RHP A;  4Y79 B;  1ATA A;  1X7A L;  1Z6C A;  5JW1 A;  2XC5 L;  1LQD A;  2Y82 B;  1QFK L;  1ATB A;  1KSN B;  2P16 L;  2M74 A;  3CA7 A;  1LPK A;  2OYU P;  4COX A;  1NT0 A;  1HX2 A;  2W2N E;  5E8D A;  2GD4 A;  3ASI A;  3HO3 A;  4ISI L;  5JVZ A;  5CKQ A;  1IGZ A;  4ZHA B;  3U73 A;  2VH6 B;  2I9B A;  1JV2 B;  1M1X B;  3CS7 L;  1W8B L;  2Y80 B;  4Y6D B;  1SZB A;  1U67 A;  4C16 A;  1F7M A;  3KRK A;  1IQF L;  1IVO C;  1C5M F;  3NJP C;  4Y76 B;  4A7I A;  4TGF A;  2BQ6 A;  1JL9 A;  1LMM A;  2VH0 B;  3GCW E;  3SOB B;  1LMJ A;  5F19 A;  4RS0 A;  1EZQ B;  1TOZ A;  3M36 L;  5F1A A;  5IKQ A;  2VWL L;  1K37 A;  3DEM A;  5K0H B;  2BOU A;  2Y38 A;  2WZP P;  3ZYI B;  4X8T L;  1IQN L;  2K2S B;  1K36 A;  1V3X B;  2VVV L;  1F7E A;  1KLO A;  1EAI C;  2P28 B;  2VWM K;  3HO5 A;  3TK6 B;  1PGE A;  3FCS B;  1NFW B;  2UWL B;  5KIR A;  4JZF L;  1L5G B;  3FFG L;  3S6X A;  5JVY A;  2W3I B;  2J34 B;  3MDL A;  1IQK L;  4M11 A;  1G1R A;  1ATE A;  3F1S B;  3QCW A;  1JBU L;  2W2Q E;  3CEN L;  2BQW A;  2FLG A;  1N1I A;  2XBX L;  1DIY A;  3N8X A;  1TPG A;  4YT7 L;  1HT8 A;  5COX A;  5JBB E;  4Z0L A;  4NG9 L;  1IQG L;  4MMZ B;  1FE2 A;  1EPH A;  4JYV L;  4CUD A;  1MQ5 L;  1PTH A;  1CQE A;  2J94 B;  3N8Y A;  2ADX A;  4BTI A;  3KK6 A;  4RRZ A;  2P93 L;  2EI7 B;  2Y5H L;  2W86 A;  3BT2 A;  3P5B L;  2XC0 L;  5JBC E;  2YGQ A;  3QMO A;  2MHP A;  2P3T A;  1IP0 A;  1XFE A;  3GIS X;  2I9A A;  4BXS A;  2WPI E;  3HS5 A;  1EQH A;  1EPG A;  3KQC L;  1NFX B;  1OB1 C;  1URK A;  4LOR A;  2PR3 B;  1DDX A;  1N7D A;  2H9E L;  4XBM A;  4XLW A;  1EGF A;  1EQG A;  3TGF A;  1G2L B;  2BMG A;  1NFY B;  3HS6 A;  2WPK E;  1KLI L;  1CCF A;  2W2P E;  5I46 L;  1DVA L;  4ZAE B;  1FF7 A;  4ZH8 B;  2XBW L;  4ISH L;  5L2Z L;  3LAQ A;  5JB8 E;  2VVU L;  3M37 L;  2Q1J B;  3NTB A;  4CUE A;  4FM5 A;  2UWP B;  2BQ7 A;  2VJ3 A;  1IJQ A;  1XDT R;  1APO A;  4RRY A;  1UZP A;  4YZU B;  4MMX B;  1G2M B;  4MMY B;  3Q3K B;  4JZD L;  1HRE A;  3LN0 A;  2KV4 A;  2J4I B;  1EBV A;  2UWO B;  4NGA L;  2Y5F L;  2W3K B;  3KQD L;  2EI8 B;  4AQT A;  1AUT L;  3ZYJ B;  1UZK A;  1APQ A;  1HJ7 A;  1F0S B;  3LTF B;  3ZYG A;  1NFU B;  3TBD A;  1NPE B;  2BOX A;  3SOV A;  1EPI A;  1HAF A;  1YGC L;  2Y7Z B;  4XL1 A;  2FZZ L;  1XKA L;  2P3U A;  3ENS A;  3N8W A;  2BOH A;  1L3Y A;  1G1S A;  2CJI B;  4D90 A;  2WG3 C;  2KB9 A;  1FFM A;  2P95 L;  2W2M E;  3V65 B;  2WPH E;  2JKH L;  1IQE L;  5IKV A;  2G00 L;  1WHE A;  1I0U A;  3HPT A;  3CFW A;  1F0R B;  4PH9 A;  3KCG L;  3N8Y B;  2DDU A;  4LMF A;  1U8C B;  4NA9 L;  4G1M B;  3OLU A;  1HCG B;  2XC4 L;  1G1Q A;  4X8S L;  4ZXX L;  4BTT A;  2WPL E;  1W7X L;  1IQH L;  2P3F L;  3IIT B;  2J2U B;  3OLT A;  2VVC K;  4BTU A;  2MGP A;  2PUQ L;  3MQE A;  1TLE A;  4JZE L;  1EPJ A;  4BDX A;  4ZXY L;  2BOK L;  1CEJ A;  2F9B L;  5IKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...