3ZYJB

Netring1 in complex with ngl1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
330
structure length
326
Chain Sequence
b'YDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFESTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4C
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
total genus 63
structure length 326
sequence length 330
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyjB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyjB02
2J2UB 2EI7B 3N8YB 1YUKB 1XDTR 1IQEL 1P9JA 3TH3L 4ZAEB 3SOQA 4JZFL 3F6UL 4XLWA 3POYA 1IQNL 4MMXB 4D0FA 6COXA 3CS7L 1FJSL 1SZBA 1JL9A 3V65B 2WPIE 2NPRA 2Y38A 4BDXA 5JBBE 2XBYL 2PUQL 2BQWA 2P3TA 1ATEA 2OYEP 1A3PA 2Y5HL 1L3YA 1AUTL 1V3XB 5JB8E 3BPSE 1JV2B 1OB1C 5CKQA 2VH6B 1MOXC 1K36A 5F19A 3GISX 2XBXL 4MMZB 4JYUL 4X8SL 3KQEL 3ZYGA 2WPME 1DVAL 3SOBB 3NJPC 4RS0A 5CKMA 4G1MB 1XKBA 2Y82B 1ATAA 2PR3B 1CEJA 5KIRA 3P5BL 3R05A 1FE2A 1C5MF 2XC0L 4X8TL 1F0SB 1B9WA 1Q4GA 1DQBA 4YT7L 1M1XB 1HCGB 4OTYA 5IKTA 5CISA 4O1ZA 2BOHA 2PHBB 3M37L 4BXWA 2UWLB 1J9CL 2P16L 2WYJB 3ENSA 1NFXB 2P3UA 3EGFA 4BDWA 5JVYA 3TK6B 4RUTA 1EZQB 1P0SL 5JVZA 4Y7AB 4CUEA 2P3FL 3TGFA 3CA7A 1UZJA 3LTGD 2FLGA 3BT1A 3QMOA 1ADXA 4Y71B 1GK5A 5L30L 1Z6CA 1EPHA 1WU1B 2EI6B 1FSBA 1JBUL 2H9EL 2P95L 2RHPA 1EPIA 2YGOA 2XC4L 2W26B 2BMGA 4URTA 1G1QA 1HX2A 1U67A 4Y6DB 2W3IB 2VH0B 5JBAE 4D0EA 1CCFA 1EQGA 4BTTA 1EMOA 1ZAQA 2XBWL 4Y7BB 5L2ZL 1IVOC 3N8VA 1N7DA 2P28B 1XKAL 4NG9L 1NFYB 2Y80B 3LAQA 3LN1A 3NTGA 2UWOB 4XBMA 4FM5A 2UWPB 5IKQA 4BTIA 4A7IA 2P93L 3N8WA 1PTHA 2GD4A 2P3FN 2MHPA 3N8YA 2WPJE 3HO5A 1PRHA 3FBYA 4AQSA 1NZIA 2WFTA 1IQLL 1APQA 1IQIL 2WPLE 4M10A 2W2QE 4OVEA 5I46L 1G1TA 2W2OE 1DIYA 4ZXXL 3CFWA 3KQCL 1N1IA 3OLTA 3HS7A 1HT8A 1EBVA 4Z0LA 5COXA 3PGHA 2K2TA 1PGEA 2G00L 3BT2A 2TGFA 4NGAL 4CUDA 1DX5I 1KLJL 3KRKA 1X7AL 2W2NE 2XC5L 2B7DL 4Z6AL 2VVVL 3N8XA 1IQGL 1ATDA 4O02B 1UZKA 2J38B 1G2MB 4AQTA 3KL6B 2M74A 3TZIA 1IQKL 4JYVL 3SOVA 1YUFA 1NFWB 1FAKL 1HAFA 1HT5A 2W2PE 4PLOA 3GCXE 2CJIB 2P94L 2W3KB 3NTBA 4ISIL 1TOZA 2FZZL 4Y79B 1NQLB 3V64C 1URKA 4E1GA 2FLRL 1YGCL 1IGZA 3DEMA 4BXSA 1F7EA 1WHEA 3LC5B 5IKVA 2ADXA 1XFEA 3ELAL 5KN5C 2XBVL 1CVUA 1W8BL 3MDLA 4BTUA 1LQDA 3LTFB 2WPKE 2WG3C 1L5GB 4PH9A 1KSNB 2RA0L 4NA9L 2WFXB 3IJEB 1LMJA 3U73A 2BOKL 2VWLL 3U7UG 1QFKL 5F1AA 4TGFA 5CKNA 3FCSB 1IOEL 3K9XA 4RRWA 1I0UA 2WG4B 5IKRA 1Z6EL 5K0HB 3ZYIB 1IQJL 3HO4A 4YT6L 1LPGA 1PXXA 4YZUB 1BF9A 3M36L 2VJ3A 3HPTA 3OLUA 1IQHL 1RFNB 2BZ6L 2W86A 1IQFL 2AYLA 1NT0A 2Y7XB 2BO2A 3Q7DA 2MGRA 2VWNL 2MGPA 2VWMK 3QH0A 1IP0A 1HRFA 1TLEA 1APOA 3GCWE 1TPGA 1KIGL 1MQ5L 3MQEA 4PLNA 4JZEL 1MQ6L 2BQ7A 2F9BL 4C16A 4Z0KB 3QCWA 1CQEA 1ATBA 5EGMB 4CUFA 3Q3KB 5E8DA 1COUA 1NPEB 1KLIL 2OYUP 4Y76B 2Y81B 3N8ZA 1PFXL 1FAXL 3LN0A 3H5CB 4ZH8B 2J4IB 1W7XL 3IITB 3KQBL 4X8UL 1G1SA 3HO3A 2FLBL 2Y5FL 4ZHAB 1YO8A 4COXA 5JBCE 1EPJA 1CVWL 2JKHL 2WPHE 2Y7ZB 4LMFA 5JB9E 1LPKA 2VVUL 2W2ME 4RRZA 3KCGL 4ISHL 1EAIC 2DDUA 3TK5B 2WYGB 1KLOA 2J34B 3RR3A 1F7MA 2BOUA 1G2LB 2KL7A 3HS5A 4LORA 1IGXA 1IOXA 5L2YL 2I9BA 3HS6A 3ZYJB 2YGPA 4CSYA 3SW2A 1O5DL 1UZQA 4X8VL 1IQML 4MMYB 2I9AA 3LC3B 3CENL 4XL1A 1FF7A 1NFUB 2K2SB 3C9AC 2P26A 4RRYA 5JW1A 1YUGA 5FDQA 4ZXYL 1HREA 1UZPA 2VVCK 1EQHA 1CCVA 1HJ7A 1EPGA 3ASIA 1CX2A 2VWOL 1LPZA 1DDXA 2KB9A 1EGFA 2Q1JB 2RNLA 1U8CB 2D1JB 2EI8B 2KV4A 1F0RB 2FD6A 1HZ8A 1EMNA 1G1RA 4D90A 2J94B 3KK6A 3TBDA 1FFMA 1HAEA 1WHFA 3NT1A 4PLMA 2J95B 4OTJA 1IJQA 3KQDL 4M11A 2BQ6A 2Y5GL 3LIWB 4RRXA 2BOXA 3FFGL 4JZDL 1K37A 3F1SB 3N8WB
chains in the Genus database with same CATH superfamily
2LS6A 3NW4A 3MFCA 2DCKA 4CCLA 5C4WB 2EI7B 3KMHA 4AFBA 1YUKB 2WZEA 4AQ2A 1XDTR 5DUUA 3RRDA 4DINB 2XLAA 3FMGA 4RD7A 3MICA 4YFZA 4RGGA 3DXTA 3LSDA 2OZ6A 2XB6C 3BTXA 3FBMA 1GP6A 5IW0A 1S0CA 5DZFA 5IT6A 4GU4A 1V9U3 3POYA 2VM9A 2WA3A 6COXA 2PYTA 2YG0A 2VW1A 5LATA 5KXEA 3VKMA 1K5JA 2VBDA 2WABA 1SZBA 1JL9A 1JYCA 2ETEA 2HJIA 2JG8B 2O8QA 2P5BA 2VD7A 3BCWA 3HAGA 3N35A 4GXLA 4IEOA 2VUAA 4LUMA 4QB2A 5FJKA 5A33A 3S7IA 1PK6C 2BNOA 1LOGA 4QMAA 4C1WA 5CEHA 3JZVA 3QD6A 3Q9OA 4QPYA 3T2OA 3NRUA 4XQWA 3SC7X 3W21A 5IATA 5FWEA 5HCBA 3IKWA 2RM21 2RS12 5FPVA 5JBBE 5TSWA 4E4SA 2ZGSA 3HOBA 4AEDA 1CN1A 2O0OA 2QQUA 4OZXA 3VBRC 4UXAA 5DN2A 2BNMA 3LEIA 4E9KA 3SHRA 4L99A 5FMBA 3O5SA 4M3CE 1OH3A 2ENRA 3CZJA 5E1RA 5KC6A 4QXBA 3ZSMA 4HLTA 3GZUC 4IE4A 5A3NA 1O4TA 1O3RA 4R9BA 3VDAA 4C91A 2WNVB 5JB8E 1TNFA 3BPSE 3OSDA 1S55A 4JDOA 1WMXA 1FNZA 1LHUA 1OD3A 1WCUA 2D6KA 1OB1C 2W1QA 5C33A 4Q4W1 1S0BA 1AYM1 2CGOA 5C4WC 1TZOA 4JCKA 3NSTA 2XVLA 2O1QA 4AI0A 1N1SA 1W6OB 3AK0A 2VZPA 3UESA 4Q4V1 3LKJA 4M4PA 2XBXL 1UPIA 4TWTA 4HN0A 3OD0A 1N1YA 1YJLA 4X8SL 4DUWA 1IQDC 2D6NA 3KQEL 2DU0A 5CVRA 1DVAL 2VZOA 3H8UA 4XOGA 2Y0IA 3LCPA 3U10A 1XNBA 2VTXA 3LGRA 2HWC2 3ACLA 2CAUA 2DCZA 1XC6A 2FZ1A 1QQP3 1ZVFA 4O65A 4YG0A 5EIYB 1V70A 3ZFGC 1VBB1 4LBQD 2KM2A 3RZKA 1NLQA 2Y82B 3VKFC 1W6NA 4QPGA 3TRSB 1ATAA 1B35B 1HQLA 2QVSB 3UJQA 1AR81 4OLLA 3O7OA 4YW1A 1O4YA 1UD1A 2CDPA 1F8VA 2WQ8A 5BNPB 5FY8A 2D6LX 3O1OA 4X8TL 2LROA 2WZR1 4CE8A 2YBPA 1YWKA 2GMPA 3A22A 1HCGB 4D0QA 5FYUA 4C90A 2D5HA 5K9YA 4O1ZA 2WAAA 2BOHA 1LJ7A 1R64A 2UWLB 1J9CL 2WYJB 3EGFA 5JVYA 1NFXB 1M06G 1LAJA 1OA3A 4ZS2A 1W2TA 3T2PA 3IIAA 1PM4A 2W39A 2WWSA 3P6BA 3ZFGB 1XXNA 3RZMA 5HI0A 3D3AA 1OQEA 4UWDA 2E26A 5JXGA 1AXZA 5FUNA 5LA2A 2BGOA 1MZEA 4MLOA 2WO7A 5FPAA 3C8XA 3MW4A 4XMAA 3ZXAC 3ZPOA 3AJZA 2BBAA 1DHKB 1DZTA 2AEYA 2VUCA 3I8TA 2WKKA 1RUG1 2TNFA 4FOWA 4QQPA 1F31A 3VBUA 1J1TA 1Y9QA 3PHMA 4YVWC 5FKCA 3BT1A 3VBOC 1WA4A 3QMOA 4RN5A 4XFFA 5DMYA 1ADXA 3SXWA 1BCXA 1C28A 2VMFA 2XKOA 4XVHA 2GNDA 1GOFA 1US3A 1G8WA 2WNVC 4NHYA 1JBUL 1AR82 3FX3A 2OPKA 4PIZA 3OBZA 2VAUA 2PHLA 3AZXA 4NRPA 2P95L 1PIV3 1TME3 3H8RA 4CEWB 1GBGA 1LU1A 1U12A 3BOWA 5I0RA 4CSWA 2BMGA 3I4IA 3NKGA 2JECA 2VTFA 3WG2A 5FYCA 4QDQA 1RMU1 2W3IB 1AUYA 1YEWA 1CAUB 2PFWA 1V6MA 1XBFA 4LITA 4LPLA 3VHOA 5FZOA 3OJBA 1OF3A 4QQLA 4D0EA 1XE8A 2YUEA 1EMOA 1H4GA 1T2XA 2CNAA 5KHIA 5FYSA 4BQ1A 3N9LA 4GJYA 1U5YA 4Y7BB 5L2ZL 1JHJA 1OC1A 2JWPA 2ZACA 4FPFA 4N7UA 4XTMA 3N8VA 1N7DA 4NG9L 3KF3A 1UCXA 2Y80B 4IGPA 4UOJA 5H9QA 4O7XA 3H3UA 4QKDA 4E8CA 1OFNA 4I2OA 5FO8B 5FP4A 4MH0E 5IKQA 4A7IA 1K45A 5FFOC 3H9AA 3N7KA 1SMVA 1V00A 3HN3A 1UZYA 3ZXGA 4F3JA 4S2GA 1W0OA 4HOOA 2GNTA 1DQ6A 3BB6A 1WBFA 4IV3A 5E16A 2FDIA 1ZZBA 4QX8A 3PL0A 4CDQA 4AGVA 4FT8A 4B7EA 5EQUA 5KR7A 1IQLL 1KFXL 3RQ0A 1RMU3 2HEVF 2VC9A 3PIJA 2E7AA 2W2QE 2WO3A 2XLFA 2YMZA 4LULA 5LBCA 1FYUA 5F32A 4ET7A 5ABJB 1QKQA 5F9TA 2W2OE 2WO2A 3UKNA 1DIYA 1PIV1 1TME1 1JZ3A 4W6XA 4DQAA 2XHKA 4FPKA 4EQVA 3AMHA 5FUPA 3S6PA 3ZFGA 1GZTA 2YZ4A 5HXMA 3FC0A 1AJOA 4Q0QA 1UIKA 2DBNA 1XE7A 2JD4A 5C71A 3R4UA 4GWJA 4BLIA 4KMQA 1JOJA 4DFSA 4I02A 3ZPYA 2W91A 3T1MA 2XVKA 3I7DA 3LIHA 1BBT2 1AX0A 3OOXA 3PUQA 3VBUB 1RUG3 2TGFA 4O9GA 4YYOA 4NGAL 2BJSA 2JG8C 1DX5I 1KLJL 5IK7A 5IUQA 4A6SA 5FCCA 4ZU7A 2EXIA 4NPLA 4GIQA 3PU8A 1G86A 2E9QA 4UFIA 1IPKA 1J58A 1X9TA 2YXSA 4TYSA 3ZFEA 4O02B 3MIBA 4UBHA 1G2MB 2ZAHA 3KL6B 2H9EC 1LHWA 2FHRA 4GH4C 1IQKL 5FYVA 4MUVA 4OI4A 4QGLA 1JBCA 1F5JA 2ZGMA 2ATFA 1W05A 2XH6A 2JDAA 5LB6A 1SLBA 2VJXA 1XNTA 3BTYA 2WZR3 1UY1A 1HAFA 5FLHA 4M0NA 3THPA 4BK5A 1UW8A 4CA9A 1CZSA 1G9BA 2TEPA 2G9GA 5FZOB 3B9IA 4LK7A 3MLJA 2G9ZA 1C1LA 2DUPA 3IAQA 4MHUA 2X5IA 4PLOA 1AR83 4QQOA 5LBBA 3WF0A 5J48A 1VJ2A 4IGOA 3O1TA 3NTBA 3D6EA 4QXKA 1STMA 5FYMA 2HKXA 5GLWA 4ISIL 1VBB3 2VUJA 3ZOIA 4M3CB 2BOIA 2FZZL 2VOTA 3CEWA 1QQP1 4BK4A 3NNFA 1DCSA 1URKA 4E1GA 2BVVA 2FLRL 4FTBA 3ROUA 2JEMA 1DQ5A 3N4MA 3DEMA 1F7EA 5IKVA 3LPGA 4XJ8A 3ZFFC 1XFEA 1REDA 5FWJA 4XFHA 3MW2A 4Q4V3 1XU2A 2XBVL 2DVFA 2ZGQA 4IV3B 2NZ9A 2P37A 3AP5A 3FLRA 1AYM3 4B3NA 4Q4W3 1W2UA 5DUWA 2YB7A 1ND2A 5GM0A 3RYKA 2VL4A 2JE8A 3BGAA 4KG0A 1T6GC 3OY8A 3SQOA 3PUSA 3AKRA 5ABJA 2P3JA 2RA0L 5APAA 1JZ8A 4INDA 2XQRA 3ZSJA 5JXIA 3JB8A 2FQPA 3VBRA 3HR9A 2JG9C 5BNOA 2VWLL 1DU3D 3CHXA 3GHMA 3VBSC 5FY9A 2RDRA 2RM23 5F1AA 1SCSA 1A6CA 1NLRA 4EYUA 1V6OA 2IVIB 1OKQA 3ALQA 3IWZA 3LOIA 3ITQA 3T0BA 1IOEL 1VMHA 5I8YA 1FT9A 3SCFA 4RRWA 1I0UA 2WG4B 5IKRA 2OZJA 2PA7A 3TN93 3BU7A 1IQJL 1CPMA 5I8TA 2XKPA 4RL7A 3CBNA 1EY2A 1W8WA 5FZGA 1F5FA 1PXXA 1ALYA 1MEC2 2QQJA 4IE6A 4ES8A 1HQNA 5CADA 4AVSA 1V9U1 1YNAA 4LO4B 1UY3A 1J59A 4XFIA 5A1FA 1SFNA 3OLUA 1S0FA 1OSGA 4E8DA 4UFMA 1IQHL 3U4XA 2W86A 4CDWA 3NMBA 1VBA2 4MX3A 2GMMA 4R8HA 4PIYA 5C3SA 3O0WA 1Q8OA 2MGRA 4MHRA 1NA1B 4PQ9A 4XBNA 4CXYA 4MSVA 2VWMK 2DV9A 1K42A 4P5HA 2PHXA 2R041 3IDBB 4NPRA 4WZCA 1APOA 3GHNA 4HVOA 2O8OA 1J3PA 3THTA 4RSUA 5IVCA 4QX3A 4UW6A 4GWMA 2D44A 2PMWB 4YRDA 2QQPA 5FBJA 4JHZA 3IDEA 3MQEA 1SPPB 4EWAA 2BNNA 1LMMA 2PXJA 2X5IB 1DGRA 2B4KA 4C16A 3R4DB 5FUIA 4CCDA 3IDCB 4BQ2A 3QCWA 1D2QA 1XOYA 4D7TA 3HJRA 2D97A 1CX4A 3DPRA 3H8XA 4LA2A 2BWAA 1H6YA 4M3CA 1CONA 1COUA 4PDWC 3ZN5A 4OULA 2OW4A 1ENSA 1IG3A 1VAMA 2NMOA 3I2IA 3BPSA 1GICA 3NNGA 4Y22A 1ZRDA 2RS52 3OBTA 2JDHA 5AFBA 2YC0A 2WS92 1DBNA 1FV3A 4Y76B 3H1YA 1CAVB 2ZX3A 3N9OA 3N8ZA 1PFXL 2QQVA 2C5DA 5E88A 2WS91 1O6UA 2ZGUA 1UU4A 3A4UA 3AYAA 5JZGC 4Q4X1 1O8PA 1YQ8A 4XCBA 1NY72 2ZS6B 2J4IB 1W7XL 3IITB 2WLQA 1YQCA 3KCCA 4A41A 4EE2A 4X8UL 1N3PA 1G1SA 5CG9A 4BM8A 2IWGB 2GC3A 2Y0OA 4LKSA 2RS33 4A94C 1WGPA 1BXHA 1VBE2 1PX3A 4JRAA 2EXHA 2A3XA 2HBUA 4MYEA 2I45A 1OQDA 1REFA 3AZVA 1BEV3 4ZXEA 3CZUA 5BNOB 1X82A 4WM7B 5HCHA 5A1LA 3THCA 4IDZA 5A3LA 1PNFA 2P3IA 3OUHA 5JB9E 4NJ4A 4Y3OA 3LSEA 5H9SA 3I2DA 3ZIXA 5BYNA 3S5AA 1SG3A 3CNAA 3GBWA 3LD8A 1QQP2 1RUD1 3WQ0A 3GDBA 2WT0A 4RRZA 5FZHA 5K4LA 2RR12 2Q8CA 2IFRA 5J98B 1CJPA 4Q1PA 2W94A 4OUSA 4UI9L 2NM1A 4Y24A 5LK7B 1L7QA 3MV01 4EN9B 1WCSA 2IXIA 4YZ1A 5IVYA 1V1HA 1L7RA 4IV3C 1MVQA 1UXXX 4K6BA 1RUD2 1FAYA 4IE0A 1FATA 5GZFA 4ZS3A 1FPN3 1QXRA 1XYPA 4OMDA 4WM8C 5FLJA 5DG1A 2MPFA 4BQ4A 3MHZA 5I8SA 3MO4A 1F7MA 4MXWB 3ZX7A 1J3RA 1G2LB 1DYPA 2D3RA 3N3HA 4LE3A 5F6KA 2J1SA 4K8FA 3WNLA 1H8VA 4FPLA 5L2YL 4U36A 5D21A 1MEC3 2YGPA 5CAZA 3E5UA 4D3WA 3J8F3 4C1XA 1G9DA 1NXD1 4X8VL 1LGBA 3VDDC 2O14A 2WUHA 3DN7A 2V5DA 3WD5A 1SPPA 3Q8BA 2YC2A 3VHRA 4ZY9A 3OYWA 5B4XA 4BZ4A 5CNAA 5CFCC 1NFUB 3WUDA 1COV3 2FDHA 1BBT1 1RINA 4KU8A 5CIRA 1AF9A 1YUGA 4HZFA 1Y3TA 5J09A 1H6XA 1W03A 5FDQA 4PT6A 1LULA 4Y4RA 4L92A 2WJSA 2AGSA 1BQPA 1PVC3 4I30A 3BTAA 2YU1A 4GJZA 1Z78A 3U37A 2D3SA 4I3PA 4IUGA 1HREA 4LR4A 4QHBA 2ZX4A 4XE9A 1EQHA 1CR7A 2X8KA 3ASIA 1O3QA 1EGFA 4GB33 4QHOA 2DUQA 3AC0A 3PNAA 4META 1V6KA 2X29A 3S57A 2BT8A 2RNLA 1ULDA 2J7MA 1ZRIA 3J7HA 4W6WA 2G1MA 2QUOA 2CY6A 3K51A 4OCTA 4Q0VA 5C5UA 2VULA 1IZ3A 3CLPA 2HWD3 3KGLA 1JZ6A 1HZ8A 5F2WA 4E2QA 1UMHA 4PDWA 3BIEA 1VBC2 2WFF3 2BU9A 2HLEA 4HBNA 5FOBB 2IZWA 1IPSA 5A3TA 4YARA 5FZ7A 5F6LB 3QH6A 5FYYA 2EALA 1NE4A 3NT1A 1HRV3 3KZ4C 4MZUA 4M11A 1CJDA 5AC91 2BQ6A 3LIWB 2ZGTA 4FQZA 3NO8A 4NN0A 2EAAA 2Y34A 2BOXA 4BQ3A 3FFGL 1R093 1W6MA 1K37A 4Y20B 3N8WB 4RYDA 1UKGA 3CDZB 2BDRA 4Y1YA 2XL9A 3N8YB 3N7MA 1K5MC 2BPA2 1ULCA 1MACA 3SLIA 3WV6A 1QOSA 4FPCA 1WW4A 4A45A 3TH3L 1F4HA 1VRH2 2XJUA 3E97A 4QPWA 3SOQA 4U2AA 2ILMA 1RUE3 3O14A 1AR62 4COVA 4LTAA 1RHI1 2VCBA 1SBEA 1SLIA 4BIFA 5FO9B 1QOOA 2CHHA 2BT7A 1N3QA 3SH4A 3ATGA 1Q8QA 2YPDA 3VBHB 2JG9B 5DPNA 2HWE1 3MFAA 1W6QB 1YC61 1QJX2 5EJ1B 4Z2WA 1BHGA 4Y1XA 5JVVA 3AXEA 1VAKA 2XQXA 3GCWA 4GAZA 2R071 2ZHMA 5IFPA 4BDXA 5DUXA 1UOJA 3ME2A 2ZPXA 1DIWA 2XBYL 1FOD3 3OPWA 1UOBA 5FY1A 2DVBA 1P8JA 5M0TA 5EFUA 2WC2A 4DRVA 1R092 3DXUA 2ADEA 4L11A 1RUNA 1YHFA 4D6SA 2WQ4A 4HKLA 2PHUA 5DAQA 1O8SA 4Y33A 5LY1A 4TSVA 3MIDA 1UZZA 1L3YA 4CUCA 4A6OA 2OPWA 1AUTL 4XDQA 3P5BA 1W2OA 2A6ZA 3PIGA 5JR7B 1R081 4AK3A 2Y6KA 1JV2B 3W9AA 2ZGOA 3GYDA 1QMJA 1NA1C 1UYZA 2JD9A 2P17A 3LEKA 3N9QA 4GH4A 2VH6B 1RVF2 4HMZA 1OLMA 2P6HA 4NMIA 3D4KA 3GISX 2VECA 2F6BA 3H3LA 1LECA 3MIGA 2DWRA 5FZLA 3BVCA 3I2HA 3LA2A 1XQNA 4MMZB 2P2KA 3AFKA 1IS5A 4JYUL 3BOPA 1KGYA 3OB8A 4WM7C 4AFAA 3JD73 2ZMLA 1NCQA 1UY4A 2H6CA 4DOUA 5C3OA 1YFYA 3I2FA 1N1VA 4XZPA 3AMPA 4RHV1 3VBOB 5EPAA 3NJPC 4HONA 1RUI3 3KS7A 3GM8A 5CKMA 4FPHA 2GC2A 2BW8A 4ONUA 1XKBA 1VBD1 3GXUA 3E6CC 2F4PA 5FPZA 4BXFA 2XONA 4XC9A 4AQ6A 1QJY3 5EHDA 3QOPA 1CEJA 1PM7A 2VBBA 1RUH3 1W2AX 2UWAA 1REEA 4I0BA 1CESA 1W39A 5FZKA 3R05A 1DGWX 1C5MF 4GB32 1ZZ7A 1F0SB 1DQBA 1Q4GA 1ZZ6A 1VBE3 2HWB1 1MQTA 3ZLIA 5IKTA 3B00A 5IK5A 2FCVA 3QACA 2PHBB 3M37L 1W6MB 2X09A 1QJU3 3T0DA 1RUOA 4Y20A 2HWC1 1BEV2 3ENSA 4FP3A 4IV1B 1DGWA 4QKNA 3N9NA 2B42B 3NAPA 3ST7A 3WP4A 3WQ1A 1BJQA 1W9TA 1Z7S1 4Z82A 1PGW1 2VCMA 1VBC3 3ECQA 3HWJA 3NL1A 2P3YA 5K0UB 4WM8A 3VD5A 5ABJC 1CAXA 5HPOA 1BK1A 4Y7AB 1OOPC 5EWSA 1VLNA 1KKEA 1F9KA 1YYNA 4NUBA 5ACA1 3LB9A 2C9AA 3SCGA 3UT0A 3O1UA 5EJZB 4AEJA 4C0HA 5CFCB 1DDLA 2V4AA 3IZOA 1H1AA 1ZRRA 3BODA 1SFYA 1S2BA 3KVAA 3VBSA 3VZOA 4A3XA 5AFEA 2G9FA 1UZJA 5IJRA 1W6QA 3NV3A 3RVHA 3ZDVA 2G19A 3EBRA 3WW3A 2LTNA 4NO4A 1COV2 1GK5A 4D69A 3OGSA 2W52A 3VBHC 5L7OC 1VB4A 4AHWA 4Q27A 2PHWA 2R30A 3AL6A 3W58A 1FSBA 2UYBA 2WQZC 4JGZA 4XF3A 3JU9A 2RE9A 3U14A 1MZ6A 2EIEA 1EPIA 2WWUA 2XC4L 2W26B 5F8PA 1G1QA 4NIIA 1U67A 4YW7A 2Z2SB 4DXZA 4GD4A 4YW3A 3MYXA 5JOWA 2VZSA 3POEA 2X10A 3H7JA 2EF6A 2C4XA 4KI5M 4WZFA 4MVTA 4BTTA 5GLUA 1ZAQA 2AUYA 2XOMA 3NV4A 2XBWL 3WHTA 1PO13 2WNEA 4BQ5A 4RS5A 3K46A 3TOJA 2AEZA 1D4M3 1KJLA 2ZHLA 5LEKA 1IVOC 1OOPB 3JBG3 4QX5A 3CJIC 2CAVA 1HN1A 2F4LA 3O0VA 1XKAL 4RR3C 1NFYB 4D7SA 2A75A 2NQYA 4IQPA 3ZYPA 1UU5A 5J3UA 3VBOA 2VRSA 5LBFA 1ND3A 5FAXA 2UY9A 5A32A 2H0VA 1LRHA 4XHXA 4Q4Y1 4V1PA 3RZLA 2P93L 3LEMA 1LEMA 1HV0A 1PTHA 1EV13 2P3FN 1WLTA 4LBLA 2PLV1 2R063 5C4WA 4HSJA 5J36A 2WPJE 5KXDA 3HO5A 1DQ0A 2P1BA 5J96B 4ISQA 3BKZA 2VMHA 2D98A 5I0DA 1SLAA 2NN8A 1NZIA 4QHZA 3ZR5A 4UYBA 2DBIA 3ACHA 1UXZA 1AYN2 1IQIL 2XHNA 3DYOA 3M70A 3R6SA 1V1IA 2WPLE 2PHDA 3VN4A 3PDQA 5D8AA 5LASA 3UGHA 3VL8A 1QJFA 1BK0A 2BWCA 2CDOA 2WNUC 1C5HA 4AEDC 3WEZA 3PVBB 2WNOA 3OLTA 1N1IA 3ILNA 4E4ZA 5C3QA 2UY8A 3HS7A 2E31A 4SLIA 4TLGA 2PAKA 4EN7B 5A33B 5C70A 1HT8A 4AAXA 5IHRA 4DUVA 2I07B 4AVAA 3NQHA 3O1SA 2XJVA 4Z0LA 1CAXB 5COXA 1SDWA 4KH9A 4L8QA 4CTEA 3PGHA 4DEVA 1AJKA 1R1A2 5EXOA 4YGCA 2K2TA 2I74A 2RS11 4N9IA 2VZVA 1PGEA 1Q8VA 5KHGA 1EAH1 4BLJA 2PTMA 2G00L 3BT2A 1WUVA 3A0KA 4NR1A 2RDSA 1W9YA 4JKLA 4XFCA 1QH7A 4ZXKA 4DIQA 1KRIA 5F3EA 1ULFA 4CUDA 1OURA 3CO2A 4IGQA 3KB5A 1U5IA 1UWWA 5IVVA 4XF0A 1LGNA 3M7AA 4LBQA 3RZGA 4Z6AL 1HXS1 1WCQA 3B69A 3IB3A 4V2VA 3WDTA 5I0SA 4PF5A 4JGZB 1R082 4IEVA 1W6OA 1W9FA 3MPPG 2J38B 5BNOC 4AQTA 1JZ2A 1EUUA 3RWKX 1BZWA 4AE2A 4QKFA 4JYVL 3KSCA 2XBO3 5L73A 5FPBA 3C7EA 5ANNA 2ZOEB 2P34A 2RR13 2PAEA 4D6RA 1S4CA 2K46A 1V9U2 3AKPA 2W2PE 2B9VA 4QD2A 5B2GB 5JMOA 1CGPA 3PU3A 2V09A 2V72A 4LBKA 1H8TA 1W3XA 1Z0HA 1B35A 2J1TA 4V2WA 2UYAA 4XBLA 2IXLA 2WYFA 2VNVA 2BSFA 1J84A 5FP8A 4YM3A 3X29B 5IVFA 5ANQA 5L9VA 2ZX2A 4Y79B 5F3GA 5BNPA 1LHNA 5AVPA 2YBSA 3VBFA 5K7PA 4DO0A 2WLPA 1YGCL 1FX5A 3CIHA 4OMCA 2XMLA 3BIWE 1NG0A 4E2SA 2ADXA 4EN6B 1VRH1 1Q43A 5HV0A 5FR3A 2QZ2A 4WVZA 1WMDA 1N47A 1LEDA 2I2SA 3ENRA 1QEXA 4P08A 1CVUA 5LY2A 2OYZA 4ATFA 4FOVA 1ULEA 1Y43B 4XUNA 3BU0A 3MDLA 1LQDA 2L9LA 4BQXA 3LTFB 4CUBA 1B09A 2JXAA 1H2NA 2VNRA 1YLLA 1LENA 4XIOA 3LDBA 4DMIA 5KBFA 2WINB 4CU6A 1L5GB 1UYPA 3IPVB 1BLZA 1GWMA 3NV2A 2LRPA 1XNDA 1CWPA 4BXSV 4NA9L 2WFXB 5CFDA 1JYVA 2RM22 2J42A 2AENA 1W28A 3POJA 4BB3A 4PCRA 4IEZA 2K9ZA 5T54A 1QFKL 4H7MA 5FPLA 4ZKTB 1GZ9A 1MS1A 2EICA 4CEWC 5FPUA 1F4AA 1EAH2 1WZXA 2BTVC 2ZHKA 5FZDA 3W20A 3WW2A 2JB4A 1AYN3 4EROA 4LE4A 1GSLA 1UZ0A 4JZRA 5FZFA 3BTZA 3RZJA 3SEPA 2C24A 5KC5A 4FXKB 4XFGA 1RUF3 1QDCA 2MEV2 4W4ZA 4CEWA 4UF0B 4N53B 3BI3A 4YZUB 1WBLA 1BF9A 3PUHA 3J26N 1GQHA 3HPTA 1SLLA 1RUC2 3CKHA 2LUWA 2WFF2 1BMV2 4FVVA 4GALA 4Y5Z0 1AZDA 3OUJA 1YFWA 4LBQB 2AR6A 4UBGA 4KG8A 5FZ4A 2IUWA 2BO2A 3Q7DA 4IEUA 3O1VA 1QJZA 2B39A 5T55A 1ENRA 4IXLA 1RIRA 3UK9A 2JDKA 3AP7A 1GZWA 2YU2A 1IP0A 1HRFA 1HDKA 1UYYA 5FYZA 2R1DA 4QPGC 3ZFFA 1PGW2 2VZQA 1TPGA 1L3JA 1NUKA 5JXHA 3RGBA 3HPNA 2A6WA 2TBVA 2ARBA 1NCRC 1X7NA 1AR63 1KDMA 4JX0A 4QX0A 1GOGA 2YY1A 1MS0A 4QPIC 4Z0KB 1H8TB 3TWIA 2E32A 4Q4W2 4PBOA 3OF1A 5FP9A 1G6NA 4CDUA 3IMNA 1CAWB 1ATBA 3AP9A 3PMEA 4IEYA 3WG1A 3Q3KB 1LODA 2H0BA 1XYNA 2XWBB 3AKTA 3CJIB 1S0EA 4Z07A 3T4VA 1QJX1 2GNMA 3UV9A 2HYXA 3TYJA 5EV7A 2OYUP 5FTTC 4OFGA 3TAYA 3H7YA 4S2DA 1RL3A 3FWEA 4BOWA 4H3WA 1RC6A 3B94A 2Y81B 4E27A 4GMP1 1FAXL 4IE7A 3LN0A 4ZZ8A 1X33A 4YW4A 2C0ZA 4UT5A 3H5CB 1QNYA 3U4SA 4DZGA 4IW3A 3BALA 1B35C 4K1ZA 1AR72 2E51A 5LA9A 1JYXA 3KWVA 4X6RB 2WWJA 2ZBJA 1W8OA 1H30A 2IXCA 2R1BA 2B45X 2ZX0A 4ZHAB 1W0PA 3AXDA 2DCTA 4COXA 1AR91 1EPJA 2WNUB 2FMDA 4GQ7A 1CVWL 2RDQA 5GLZA 3WDVA 4GA9A 1TMF1 2VXJA 3E5XA 4R9DA 3S7EA 4QQ2A 3LOBA 2WPHE 2JIGA 4XHBA 4CU8A 1D7PM 1PVC2 4M00A 4XJWA 2VQ0A 1DYKA 2XDVA 4TLFA 5FZ9A 5GLVA 1V0AA 2WDBA 2ES3A 1PVXA 2FMYA 2J1EA 4EWDA 5DQ0A 4DB5A 1LPKA 2VVUL 1NKGA 1HIXA 2VQTA 1W8NA 3ZR6A 3EJKA 1ZA4A 4ISHL 2DURA 1HJGA 4N53A 2XBO2 4UF0A 3VBUC 1OI6A 4CYDA 4E4HA 2ZGRA 5FY0A 3WCSA 1OVPA 1HRI3 4LKEA 2A3WA 2CSGA 1ULOA 1MS3A 1RB8G 1WA6X 4M4RA 5FREA 1UMIA 1JH5A 2JDYA 1UZVA 1XSRA 3RR3A 4EN0A 3IIIA 4P9WA 4CCMA 2GC0A 4AGGA 1MPXA 2KL7A 1ASJ3 2AC1A 4FP2A 3PLQA 4XF4A 1GWKA 3C7GA 5LRRA 4JV4A 3O12A 1IOXA 2NLRA 1GZWB 2I9BA 3HS6A 2QE3A 2VR4A 3KD4A 3KT4A 4K7JA 1RXFA 2WN3A 2RG4A 4IE5A 1H8TC 4PBPA 3ZFFB 2D93A 4P9LA 4COWA 2RS53 2AYHA 2TUNA 1UZQA 3APBA 2QBXA 1CIWA 4IETA 4JQTA 5FO7B 1H2KA 2D6PA 1PO22 3CENL 4YVSB 1W8UA 1FOD2 2IXHA 4R9AA 4K3UA 3EMRA 4AAPA 4ISRA 1H0BA 1LCLA 2HYKA 3H42B 5IAVA 2JKXA 3WW1A 3OCPA 2K2SB 2YV8A 4B1LA 4P9GA 1QGLA 1AL23 1CAWA 5DDJ2 2P26A 1I6XA 3JQXA 1K3IA 2R062 3JXSA 3ZYBA 3AP6A 2WT2A 1AXKA 2ZHNA 2RS32 5FZBA 1GP4A 5FY5A 1LNSA 2A73B 3OY8B 3U11A 1EYBA 3T30A 4C0BA 1JZ5A 4CP1A 2QKDA 2WR9A 5BNNA 1EPGA 1JN2P 1YIPA 4LKFA 2VWOL 3S5QA 1R1A1 1TG7A 3C7HA 1C8M1 1W0NA 1GYKA 4D8MA 4ZHNA 4LOTA 4BE3A 1ZREA 3D5OA 3OGGA 2Q1JB 3RJ2X 3GBFA 3V56A 1U8CB 4LBJA 5CBLA 1JZ7A 2EI8B 1HX6A 2ZKNA 2KV4A 5DUVA 4Q5OA 1VBA3 4CDQC 3QBQA 5GLTA 5FZ0A 4EN8B 1S2EA 4AVBA 2Y6GA 1MS5A 4D90A 2WAOA 1VMFA 2W46A 4IERA 1OT5A 2GAUA 1TNRA 3TBDA 2NPIA 1FFMA 3ZDSA 4YZ5A 4TZDA 1VPHA 1WCKA 1QJY2 5LCWL 3VV1A 3ZKYA 4RRXA 2HH9A 2Y5GL 5I0UA 1PZ9A 1UZWA 4K9SA 3VL9A 3H0OA 3O1MA 3DCQA 5C7GA 2B5HA 3KQRA 4P9JA 1F35A 1ACCA 2JE9A 3TB0A 5LA1A 4QAWA 3VDBA 3V0AA 1JODA 1UAIA 4Q29A 4ZZ5A 5KHJA 1HLCA 1NA1A 1ZBA3 4XETA 2DYCA 4CCEA 1IQEL 1P9JA 2BFUS 4WVMA 4JAAA 3TEZA 4MGSA 4Y1UA 3SH5A 3HT2A 3OGJA 4CU9A 1UOGA 2BOJA 1UY0A 2MEV3 4JZFL 3F6UL 1D4VB 5I93A 3E6DA 2R072 1IQNL 4D0FA 4Q0SA 1QIQA 3CS7L 1OA4A 4FQ4A 5FK7A 3ZXFA 4CXWA 1RUC1 2XLGA 3C2UA 3WNPA 4JGYA 3V65B 2IXKA 5FMDA 3G6JB 5FLIA 3M3IA 1O5UA 2ZJCA 3VZNA 3R4SA 1ZZCA 4XF9A 3M3CA 4FBFA 2NPRA 2Y38A 4A44A 4PJYA 1QDOA 2XJPA 1QF3A 4I3GA 5CZKA 2J1VA 5FZ8A 3T1LA 3M3EA 1UOFA 5FZEA 5IYYA 2PUQL 4HK9A 2W5FA 3TEYA 3J4UH 2P3TA 3POSA 2ZCWA 3MF9A 4UFHA 2JIJA 3HIFA 2YGQA 4G3YC 3ETPA 4Y22B 3ZXJA 2WSUA 5JOYA 3Q8AA 2Y5HL 3H1WA 3AKQA 2Q5TA 4Y1VA 1V3XB 1RVF1 2RVAA 1E5HA 1O59A 3B9CA 3I3MA 1XJAA 2ID4A 2JX9A 2K2SA 3PVEA 4IEWA 1OKOA 1W90A 5CKQA 3ON7A 3T2TA 5C3RA 1CIYA 4Y5SA 3AX4A 1MOXC 1VR3A 1AR73 4EV0A 1FMD1 5F19A 1FNYA 2QQWA 4FCAA 4XJUA 4X6QB 4K1YA 3A21A 1NY71 5L7OA 1LHVA 3LIGA 2XUMA 5A7SA 4AI8A 3KQ4B 5BNNB 4A7KA 3VHPA 3LQCA 4CZSA 3RMYA 4LHNA 1ZZ9A 4RS0A 4MXVA 1POV3 4WM7A 2Y26A 3ZXEA 3MZHA 3CL1A 4K21A 4FPGA 2ZZQA 4AI3A 3WDXA 1UQXA 2WL1A 4AZZA 2ARXA 5GKAC 2HWF3 1LOBA 2Q4SA 2RMU1 1W8HA 3OPZA 1IPJA 4N8MA 2EIGA 3PVNA 4M0HA 2WRAA 3M4FA 4A7YA 4HPKA 1CPNA 1EV12 4P00B 5FIXA 1FXZA 2CWSA 1ZBE3 2VOWA 1XB9A 4R4ZA 1BVVA 1RUF2 4XFBA 4P9XA 4OTYA 2UU8A 3WCRA 4DXSA 5CISA 5A3OA 3RYPA 1ZA7A 4QB6A 3I2OA 3GJAA 2DTWA 4XYXA 4MGIE 4BXWA 3GBGA 2P16L 4OHVA 3ZYFA 1C57A 4COUA 4DPNA 4LHLA 5DDJ1 3V0AB 1GANA 4ZU5A 5GJ6A 3LDRA 5HCAA 4KNCA 3WOGA 1ENXA 3MF6A 4WVVA 3K3OA 2C1FA 3HQUA 5L9RA 4WVMB 4IL7A 2ZABA 5EZWA 3UYJA 5C5TA 5JVZA 1LGCA 1SEFA 4YVSC 1GLHA 1PO21 1O7FA 2VMGA 5FXZA 3H1MA 3WF4A 5A3UA 3L2HA 2OKXA 3ZSLA 5SV8A 2P3FL 1DG6A 3TGFA 4CP9B 4CCOA 2BQPA 3LTGD 2G4IA 4JGYB 2FLGA 2BEOA 4K40A 3V65A 4B7KA 2ZAAA 3OYWB 1H1IA 1NCRB 1PGL1 4Y71B 2ET1A 4H7LA 5FRAA 5A6YA 4D7YA 4Y4YA 3MLKA 1LR5A 3AZZA 2JDZA 4YM0A 1Z6CA 1PHMA 1QY4A 3M1HA 3RI8A 2EI6B 3ZM8A 3NNJA 3JQWA 1S0GA 4XBQA 4GKXA 2Y6LA 1XYOA 2VO5A 5E8AA 2H9EL 3KCXA 2DVGA 2VQAA 2B7YA 3MDPA 2ZGLA 4HVRA 5BNQA 4OYUA 4XILA 2YGOA 1WLCA 4Q4X2 1HX2A 4Y6DB 2P4EA 4AHXA 3H50A 2MHFA 3NAPC 1RUJ1 2JDMA 2YFZA 1PZ8A 1YJKA 3LA7A 4OUMA 4OHZA 4CUGA 1CVNA 4LBNA 5T3NA 1E5SA 1PO12 5L19A 4UAPA 3ZVXA 1FPN2 2E7QA 1EPZA 3SKVA 4YSFA 1UO9A 4LIVA 3UL2A 1MQTC 3ZIWA 3POIA 4Y5TA 1NQDA 2QQKA 4PDWB 1SACA 1HV1A 2P28B 3KCYA 5DXDA 3LAQA 3LN1A 1UMZA 2UWOB 4XBMA 2NYYA 2WBKA 4FM5A 2ARCA 1GOHA 1HB1A 3KF5A 4AG4A 4CP2A 4BTIA 2B9UA 1YRZA 1JI6A 1OBNA 1WW7A 2PHTA 1KFUL 3EHKA 4LKDA 1E5RA 2CGPA 3N8WA 4XF1A 4AFDA 2GD4A 5F3IA 5IVBA 2VQUA 2MHPA 3N8YA 4Q1RA 2Q0AA 1HKDA 1WCDJ 1C3HA 1ULGA 1YQ6A 2WFTA 3M2MA 1UX6A 1JUHA 5DG2A 1APQA 2J1RA 1D2SA 1RUJ3 3D82A 5KXCA 5LZ6A 4YW5A 5I46L 2WA4A 2GH2A 1GP5A 1DQ4A 2XL7A 2D40A 3FL7A 4JRLA 4MGZE 3TEXA 3ACIA 5FYBA 4YM1A 3VBHA 4N43B 2VMEA 4FOYA 1BVP1 2GMEA 3ABZA 2K0GA 4XJZA 4AL9A 1SFPA 1T6BX 3KT7A 3N36A 1EBVA 2VCCA 4PI2A 4L9BA 4BMBA 3DV8A 4YM2A 4BIOA 1LESA 2ORZA 5SV5A 1YUDA 5JMCA 3WHUA 1NAEA 2LALA 2NMNA 3TEWA 1CD3G 4BJ0A 3AJYA 4K20A 3VB9A 1CZTA 3CJXA 3CU7A 4Y1ZA 4AWDA 1Y4WA 3MI8A 4CP9A 2JJLA 3AVRA 1IS4A 3DL3A 2VVEA 4BYYA 3OGVA 5IWFA 1A34A 3JD72 4NAOA 2OXBA 1SLTA 1NYWA 3IT8A 1X7AL 2W2NE 2FCUA 4OHWA 1YIFA 4PF1A 1PO23 1NCRA 4YLZA 4F7ZA 4HVQA 4NHXA 2B7DL 2E63A 1YXWA 4LO6B 1QH6A 5LEJA 1O3SA 1GMMA 4PHZA 3ZYRA 3AYDA 4O9EA 1F2NA 1W9SA 3OPTA 1RTVA 5DDJ3 2VOKA 3Q8CA 1KQRA 3VHNA 3TZIA 4QKBA 1FMD2 4R4XA 4NWWA 3MUZ1 3RZHA 3Q8EA 4PQQA 1SDDB 3KM5A 1NCQB 2UWCA 1YUFA 4S2FA 3J9SA 1UYXA 3WQ7A 1LOFC 1ZBE1 3DYMA 4OI2A 2ZMNA 1ZRCA 1PIV2 1OLME 1TME2 1O91A 1H2MA 5I0TA 4AEMA 5GZDA 3MIFA 3FHQA 2VVDA 3LAGA 5JI7A 1HRI2 4DUXA 3WNOA 3GCXE 2CJIB 2RMU3 2Q8DA 2BFUL 3ES4A 2BYVE 4JTNA 2HWF1 5J7MA 5JPNB 2W47A 5GALA 4LA3A 1X8EA 4QXCA 1TOZA 5FYIA 3JB4C 1POV1 4XTPA 1NQLB 3V64C 1S2KA 2ZX1A 3AYEA 3VUOA 1RXGA 5FZCA 1K5MA 4FPEA 2W1UA 2R042 3BN6A 4RFRB 3V0BB 1MQTB 1QU0A 2JE7A 4Q26A 3EXUA 1IGZA 4BXSA 1JU4A 2HWD2 2JENA 1WHEA 2QTWB 3HVDA 4RHV2 4XURA 5JSRA 2ZEWA 4GWNA 3ELAL 3OD4A 3TNQA 2KA3A 2ZEZA 4IV1A 4A3ZA 4B4QA 3UETA 2PQQA 5KN5C 3I2JA 3K4AA 2ZEYA 1FMD3 4LJHA 1AR71 1W8BL 4LIUA 5FPXA 4AYUA 4RS5C 4OQ9A 2GZWA 5FMCA 4WM8B 2WPKE 4YNIA 4NE9A 2WG3C 3MV11 1RVF3 4JVAA 4ASLA 1QJEA 2GSYA 2Q1MA 3EB7A 4NIGA 2VH9A 1KSNB 1OPMA 2DFCA 4FFFA 1DZQA 1GFF2 4N43A 4CDXC 3S6XA 1WWYA 4XUPA 2HEWF 3IJEB 1LMJA 3U73A 2BOKL 1YQ2A 4JQRA 4P9YA 1NE6A 4XAEA 3VKOA 3WNMA 3U7UG 3AVSA 4L0PA 4BWOA 2DTYA 1J1LA 2CL2A 4LLFA 4YWAA 5F5CA 3INAA 5A3MA 1PK6B 4TGFA 5K0UC 3A7QA 3FCSB 5C9AB 1XE0A 1ZNPA 5A6ZA 5BNPC 1GNZA 5L36A 1UL9A 1Z6EL 5K0HB 2ET7A 2VVFA 2GP5A 3DKWA 3E5QA 3HO4A 2PHRA 4B4RA 1LPGA 1RUC3 2Y60A 3VZKA 3FLTA 4IESA 3M36L 2Q8EA 2VJ3A 1DP0A 3S30A 3WNKA 2MEV1 4LXLA 3ZKUA 4AOCA 4OI0A 2W1WA 1RFNB 2BZ6L 2A6VA 1XPWA 2X53S 2V4VA 2AYLA 4HFSA 1ZBA1 3C7OA 5H9RA 2C6SA 2FDJA 3VD7A 2VMCA 2UWBA 2VWNL 3ZO0B 1Y9MA 1NX9A 4RS5B 1IKPA 3QH0A 4GKYA 4COZA 3ORJA 4AF9A 5BUVA 4N90A 2JJ6A 4OUEA 2KNIA 2VCAA 1TLEA 2D6MA 4NHMA 2WO1A 5JIAA 3D0SA 1G9FA 1ZBA2 2D5FA 2ZZJA 3FUOA 2A71A 4UW4A 2RJLA 3MBWA 4XMIA 1ND3B 1MQ5L 4KWJA 2DFBA 3SISA 5KHKA 1GZCA 4PLNA 3BYWA 5JOXA 4AEKA 1MQ6L 2QNKA 1W3VA 1XNKA 2BQ7A 4DXTA 2E53A 3M3QA 3RPQA 2Z4FA 2WZR2 2YGLA 4QX7A 4WV8A 3SKJE 1VBA1 1CQEA 3T4HB 4UW5A 3WVJA 1IS3A 3FHIB 5FZMA 5EGMB 4CUFA 2BGPA 1ULPA 2QQIA 5E8DA 1URXA 4RQPC 4XJ9A 4AEDB 2A70A 2CGNA 4CDXA 1UKRA 1K5MB 3KVBA 1O3TA 1C8M3 4BQWA 1R1A3 5D8AB 3LEGA 5FMOS 1UNBA 3GZEA 4N9HA 4OZOA 2BUKA 1JOPA 3ELNA 3URFA 5FP7A 4CDWC 2WNVA 2VZ1A 1GKBA 2EAKA 1OLRA 1JMUB 2YC4A 3USUB 5FY4A 2PLV2 4YW6A 3AKSA 4NRMA 3K4ZA 4AHZA 1W8TA 2BVBA 3DF0A 1AL21 5G05L 2LW8A 4Q8KA 1AX1A 1OVSA 3LDKA 2AREA 1DQ1A 3VKLA 5KWRA 1QJU2 4LO7A 3WQBA 2B8MA 3LZZA 2FLBL 4QM9A 4XXAA 5ERLA 5F5QA 5GZEA 3KGZA 3THDA 1AYM2 1RJ7A 1YO8A 1IKQA 2CU5A 2YFUA 3N7JA 5GZCA 1X9PA 3C7FA 4QT6A 3UGGA 4BDVB 1AL22 2VOXA 3POBA 5FZAA 2RS51 3P3NA 3RI9A 3PUAA 2XJTA 1RUH2 4J1WA 4Y26A 2JKHL 3WDWA 1IOAA 5FK8A 1PMHX 2DCJA 3P3PA 1PK6A 2NP0A 1SBDA 1ASJ1 2A6XA 2Q1FA 2VNOA 4NRQA 4XUTA 4YZ2A 5C9AA 3ILFA 4M01A 3AL5A 1Q8PA 2W2ME 4QQHA 4KU7A 3KCGL 5JOZA 4PIXA 4QDSA 4CCKA 3RFRA 2Q8OA 4ARXA 3CQOA 1W04A 1EAIC 5F5AA 1Y9GA 1HRI1 4N43C 3OUIA 2D6OX 3BUCA 1QHDA 3TN92 3SNMA 1SCRA 3K4DA 1MZFA 5CU1A 1KLOA 4N53C 5A3PA 2FDGA 2R0HA 2YPJA 1E5IA 4A42A 5IK8A 2WFPA 1QIUA 1WW6A 3KT1A 1DF0A 5GZGA 5FXVA 1MS4A 4LEJA 2BOUA 4CU7A 3K2OA 4TXWA 3AYCA 3HS5A 2WIIB 4MADA 3VZJA 3OBAA 4G4FA 3B3QE 1IGXA 3B7MA 3WNXA 4KWLA 3ZYJB 5FYTA 5IAXA 1JYTA 2V73A 1TMF3 3HT1A 1O5DL 1M4WA 3AB0A 4Z92B 3LA3A 1GR3A 3VBFB 4FTSA 3B01A 4MMYB 1AR93 3LC3B 5LK5A 4YW2A 1OF4A 5ISLA 5F2SA 3VKNA 4KGQA 3JBG2 3ZXDA 1E57A 1LTEA 1FV2A 3USSA 4KWKA 1GU3A 5FYHA 1R1ZA 4RRYA 5JW1A 1PZ7A 4IV1C 1XRUA 1JTZX 4QB1A 4GMP3 2W95A 2EXKA 4GWIA 4CDXB 4BH9A 1OPOA 4Z1VA 4OQ8A 2FZ2A 4ZXYL 3DECA 1YI7A 3PTRB 2VY0A 3IPVA 1UZPA 4HL0A 4CPBA 1W8ZA 3O1PA 4LLOA 1CCVA 1HJ7A 1RUJ2 1CZVA 1CX2A 5FMOL 3BPZA 4AVVA 3H8OA 5HCFA 5CFDB 1QJX3 1Q56A 1CAUA 5FV3A 1I5ZA 3ZSKA 2VBPA 4IEPA 1OMIA 3USUA 1JS9A 3HEIA 3NJVA 3FFZA 4XPVA 2AZ5A 4FOQA 4OHXA 1TMF2 3UKTA 4XJAA 3D0JA 5FZ3A 1ZX5A 2DU1A 3WP6A 1GNYA 1MVEA 4RFT0 4BPZA 4HT1T 3ZN4A 3HBKA 5FQ0A 2ERFA 1MZ5A 3WDUA 1LHOA 1C5IA 1AR61 1O5LA 3MLLA 2ZGPA 1HXS2 2YBKA 1UU6A 2R16A 2HBTA 4Q4V2 3WP5A 2CYFA 1UIJA 4AI9A 1WHFA 3JUUA 2J95B 4OTJA 1IJQA 3KQDL 3R0RA 3N9PA 2LM3A 2R49A 4ITCA 4X8PA 1VB2A 2ZGNA 4KL1A 3RMXA 1LB2A 4QM8A 3RSJA 1NZCA 1W6PA 1QXPA 3F1SB 3NJZA 4UFKA 4CVUA 2J2UB 2IXJA 2XGXA 1Y7BA 4AXOA 4FPYA 5H9PA 3FFQA 4P5YA 3UJOA 5LWBA 4AW7A 2R7EB 1ENQA 1POV0 1JOBA 4CDQB 4ZAEB 2KR2A 2VOVA 2VUDA 3IAPA 3KV4A 4YVWB 3T3YA 2VMDA 2YROA 3B93A 3VDCA 4QX2A 4XLWA 5LA0A 3PMSA 4DXRA 2DUOA 4LQRA 4MMXB 1DLLA 3J7NA 5T52A 1FJSL 1XNCA 4NWVA 2VG9A 4MGKE 2ZTNA 1RUF1 3KV5A 5DAXA 1ND2C 5E89A 3V64A 3AMNA 4XQ4A 1S1AA 3U0ZA 2WPIE 1VBB2 1EPWA 3K75B 1AYN1 2FCTA 2H6BA 3NV1A 4LHSA 1A78A 1PGSA 1SQ4A 2RV9A 2E7TA 5FXWA 4CDUB 1CX1A 3W59A 3GNEA 1N1TA 5JSOA 1AHSA 4LNVA 4B8EA 4J25A 4MGTA 3HNMA 1YFXA 4FAGA 3CJIA 5FBZA 3EYPA 3G7DA 2BQWA 1C8M2 2R0FA 1ATEA 3SCHA 3SH3A 1OA2A 2HWB2 2P6CA 3B5LB 2OYEP 2XJRA 3L2YA 1A3PA 4BA6A 5IK4A 5IVEA 4AFMA 1I1EA 2MNGA 3CF6E 5JWPA 1RGSA 1GV9A 3NWKA 3WT3A 5JXJA 2WYSA 3I97A 4XZUG 1HQWA 4XAAA 3ZFEB 5JI9A 2QFEA 4BU2A 4RA0A 2XJSA 4CXXA 4LT5A 1WMFA 1KITA 1VRH3 2J1AA 5AC92 1TVGA 1XSQA 4RQPA 1MR5A 4HETA 1JYIA 1TQ5A 2WNUA 3NNMA 2E33A 5J37A 3ZYGA 2WPME 3HNBM 4P14A 3HD8B 3T0AA 3SOBB 1TE1B 1RITA 3VLBB 4YGDA 2VGDA 2VMIA 2BGCA 3AFGA 5AVAA 4G1MB 2HWF2 5FDBA 4CPBD 4FAHA 4WVWA 3ZMNA 1JXNA 2W9XA 5JZGA 5G04L 4LBMA 4LBOA 4WBBA 2PR3B 1EUTA 5FQ0B 1NOVA 2QQOA 3FUQA 1VBD2 1ZBE2 3PTYA 5KIRA 4QX1A 4D94A 1ZZ8A 4DRRA 2X05A 3P5BL 3POWA 2QJVA 4FTEA 1FE2A 2XC0L 2OUHA 4Z8BA 1IHMA 4XABA 5A7OA 1B9WA 4NROA 2RR11 4LOSA 4C8DA 1PMIA 4YT7L 3B02A 1M1XB 2D43A 1GQGA 3H3ZA 2XBO1 4YG3A 4MG2A 1U0AA 1W6PB 2P3UA 1SBFA 4BDWA 3IBMA 1HRV2 2C26A 3ILRA 3TK6B 3NKTA 2QQMA 2QDNA 4EZ4A 1PX4A 2OX0A 3MW3A 4YGEA 3O1RA 3I49A 3K3NA 4RUTA 3E6BA 1EZQB 5A70A 2ZGKA 1OHFA 5F37A 1P0SL 1KD7A 1ND2B 1HXS3 3EO6A 1W06A 2WN2A 4EZHA 2SBAA 4HN1A 4CUEA 2HWE2 3A23A 4I0AA 5DAVA 3GGLA 1Z7S2 2OS2A 4HANA 5FJHA 4CDUC 3RZZA 3AZWA 3DUIA 1LOAA 4FFGA 1QXJA 2GN3A 3I59A 3T08A 3CA7A 4DNYA 1EAH3 2QQLA 1Q3EA 5BV6A 4YVSA 1RUE2 2RS13 4YZ4A 1IQAA 2N7GA 1O4ZA 3VBRB 2VZRA 3SMHA 3WY6A 3FZ3A 3HNYM 4AGRA 1S0JA 5L30L 2PHFA 2X5IC 4YPJA 5JIUA 4QDRA 4ZU4A 1EPHA 4YVWA 1WU1B 4MOAA 5C6CA 1H9WA 1AXYA 4SBVA 3WG4A 1JU3A 3WLUA 4E4DX 2AACA 3UGFA 1KEXA 1WLDA 3IN9A 2OUJA 4HKWA 4XDPA 4IEQA 3ZSEA 2Y6JA 4CP0A 2RHPA 4O61A 3ETQA 4URTA 1ONAA 5D1IA 4XFAA 1K12A 3HN1A 1RUG2 2GP3A 2ZXQA 3M3OA 1XNAA 1V6NA 3WF3A 4KWUA 4CDWB 3KV9A 1I5PA 2VH0B 4H55A 4YZ3A 1JYWA 4YGBA 5JBAE 1CCFA 3HBZA 1EQGA 2JDUA 4KBZA 5FP3A 1A8MA 4HK8A 3ZMOA 1OXCA 2PLV3 2R061 4GULA 1EV11 5KXBA 4Q4Y3 2W68A 4RQPB 5L9BA 1ASJ2 2W0XA 2VW2A 4KBBA 2JICA 3T2QA 1K36A 3VZLA 3PUIA 3WX5A 3WNNA 4DS0A 3NTGA 2Y33A 2XR4A 5I91A 1W99A 3I3DA 1HB4A 2GDFA 2UWPB 1KS4A 4FFHA 3JBG1 1D4M1 1OLQA 4MGYE 1G9AA 4S2HA 5KHHA 2RJ2A 3POGA 3T09A 4DY5A 1PO11 5A1AA 5JZGB 5T5OA 5EYXA 4Z2AA 2VZTA 3DPRB 1PRHA 4CEYC 1LOEA 4JC1A 3FBYA 2RJKA 4AQSA 1LK9A 4FXGB 2F17A 3OEAA 1EP0A 2GU9A 3WINE 3I3BA 4HXCA 4NIDA 4XDOA 4M10A 1YQ5A 4OVEA 1DGLA 2GALA 1SHWB 3LFIA 5LRSA 1G1TA 3ZXLA 2BV4A 3WW4A 2IFWA 4N7IA 4ZXXL 1HW5A 3CFWA 3KQCL 2ZKLA 1VE0A 2P3KA 3VD9A 1CAVA 2GH8A 2XWJB 5D8AC 2HORA 1HB3A 4Q4Y2 4D6QA 3VDDA 2FDFA 4ASMB 5C8CB 1OFSA 1ODNA 2EVXA 4MO3M 4QWNA 3VD3A 1WW5A 3KHCA 1LU2A 3GCXA 1UX7A 3P1IA 2AH2A 3RWNA 3N9MA 4FI9A 4EJRA 4MGQA 4J1XA 5A7QA 3I59B 1JYNA 3RG0A 2VW0A 3IM0A 1ZM1A 2V5YA 3OG2A 3RNSA 1MS9A 3KRKA 1QNWA 5ACA3 2XC5L 2EA7A 3PURA 4Q8LA 3LF7A 3ZXKA 4AHYA 1HB2A 3K48A 4TN7A 4E2GA 5JCTA 2VVVL 3N8XA 1VBC1 2VPVA 1IQGL 1ATDA 4LO5B 2WZPP 1ODMA 2W92A 2YYOA 4RR3A 5T5JA 4MV2A 1UZKA 4GU3A 1Z7S3 2ZMKA 4J6GA 4COYA 4RGKA 1J83A 3ZYHA 5JDBA 2M74A 3VGIA 1L7LA 2ZA9A 2HWC3 3FLPA 5L7OB 1QJU1 3ACFA 5D2AA 4M3CF 3D8CA 5JSPA 2Q30A 1W2NA 1DQ2A 1ZRFA 3SOVA 2B46X 2W08A 5T50A 3ZN6B 1G9CA 1NFWB 4W65A 2IC1A 2HWB3 2PQSA 1VBE1 5EYYA 4OI1A 1ZYBA 4ORFA 4XEZA 1FAKL 4JTOA 3GF6A 5HXVA 1HT5A 5IFTA 2QDRA 4P9IA 1RMU2 1PMJX 2Z69A 2A7AA 1APNA 1RUH1 2YGMA 2RDNA 2W2IA 4AVTA 4MXWA 5F1RA 5F7UA 2P94L 2W3KB 3LE0A 1QJY1 2GC1A 4FPJA 4NIAA 1J3QA 5BXXA 1TEIA 4ARYA 2D3PA 5A6XA 1UY2A 1VBD3 1DZRA 4QXHA 4JGZC 4NAMA 1KDKA 5A7WB 1S0DA 4A7ZA 4HPKB 1RUI1 4JGYC 1DYOA 1UF2C 5A6QA 1X50A 4RHV3 2QQNA 3JCIA 2Q1ZB 4XW3A 2PN5A 3OGRA 2W87A 3JD71 3HQXA 3LC5B 2GN7A 4XACA 3F95A 3SITA 5JAXA 4CRQA 3I2KA 4XCAA 3LWCA 4F8AA 2SLIA 3E1F1 1QOTA 2C9KA 2CV6A 4RGAA 1RHI2 2XVGA 5C9AC 5DAPA 4BTUA 1D0HA 1GUIA 5F5IA 3QH7A 2FD8A 4BCUA 5FZ6A 1R083 5A3WA 2VZ3A 4B4PA 1H1MA 2XG3A 2HOXA 4FPOB 3AMQA 4H2AA 4PH9A 4HG6B 5F39A 1LOFA 2Y64A 2DVDA 2JDPA 3POFA 1GQPA 5CB7A 3UKVA 5BPXA 5CG8A 3OBRA 1VAVA 1WMEA 3Q8FA 3U07A 5DZGA 2ARAA 3VZMA 2FDKA 4QGNA 4JKMA 5CA6A 5DAWA 4NPMA 1G7YA 1VMJA 2KXLA 1FOD1 4JHTA 3VDDB 1MS8A 2W3JA 4B29A 3A0NA 4Q2FA 5C8CA 2R073 1V6LA 1NXMA 2QCSB 5CKNA 1DGRN 1IGOA 3J7LA 2WZ8A 4QPIA 1OH4A 4IEXA 3WR0A 3K9XA 1YCIA 1JW6A 4LO8A 3WSOA 5FKBA 4FFIA 4ATEA 4QGMA 3ZYIB 1LOCA 3OTFA 4XQDA 2HWE3 2Y8KA 4BISA 5ACA2 4YT6L 1AL0G 5C8CC 2EXJA 3W5MA 3PJYA 5FXXA 4QU1A 4CCCA 3I3EA 1RHI3 3MUY1 1YI9A 4JKKA 1HN0A 5FZIA 1RUE1 3OEBA 5CYYA 2VE1A 2WSVA 1OQ1A 2RMU2 4AVCA 1NCQC 2BBVA 1IQFL 2GNBA 4RR3B 1NT0A 2Y7XB 3U78A 1WD4A 1UN1A 2KD7A 3I2GA 4EWEA 3L9JT 2MGPA 1XU1A 3ACGA 3VBFC 4HKOA 4AR2A 2PAMA 4F83A 1WD3A 1R091 3GCWE 1A8DA 3HMYA 1QWRA 3ZN6A 4CCJA 5FY7A 2CWMA 4L2NA 2VNGA 4A4AA 5AC93 1HRV1 2FBEA 4DEQA 5LW9A 4JDNA 1KIGL 3DYPA 2JG9A 3GJBA 1IG0A 2ORXA 2WFF1 1BMV1 5T5LA 4JZEL 4LK6A 2F9BL 3W5NA 1LKNA 3AMMA 2HWD1 2ZEXA 3MIHA 4UFJA 4A2UA 1DFQA 1U5ZA 3WP3A 5DABA 5A7WA 2VZUA 1F15A 1D0GA 2A5ZA 2R6QA 3NJYA 5CFDC 2OQ6A 2OVUA 1PGL2 5F3CA 1US2A 2XXZA 2BERA 3WZ1A 5T5PA 4GB31 1NPEB 3CMGA 5A7PA 5HBAA 1KLIL 1FI2A 3IDAA 3PVOA 4I01A 5A80A 3WG3A 3WF2A 1JZ4A 1RJ8A 3AZYA 4AI2A 1N3OA 4W8JA 4HSLA 1VIWB 1PVC1 4LHKA 1D4M2 3EQEA 4LUKA 2R32A 5DZEA 5JPMB 1WLWA 3RS6A 4GH4B 4R52A 1NLSA 4ZH8B 5C3PA 3KQBL 1BBT3 5IVJA 1COV1 2J22A 4YG6A 1AR92 2Z5WA 4CEYA 3HO3A 1VALA 2BP6A 2EIDA 3LFMA 3U1XA 2Y5FL 1VRBA 3FE5A 1OUXA 3RYRA 3LPFA 4JDMA 5JBCE 1AVBA 2CTVA 4W6YA 3WXPA 1UPSA 3DKQA 3N7LA 5B4NA 3NJXA 1I3HA 1CQ9A 4GMP0 3I3QA 3J8F1 4NOTA 4G9SB 2IVJA 3AP4A 5FZ1A 4BQYA 5JUVA 4YFWA 3VD4A 2BRTA 4XUOA 3F2ZA 1MEC1 2XUEA 2Y7ZB 1AX2A 2OA2A 4K8RB 1KS5A 4URAA 4LMFA 4CUAA 4GZ9A 4L97A 4QPIB 3GALA 2JKBA 5EP9A 1V6JA 1HJFA 2PELA 1PNGA 2BZDA 1WKYA 1U5XA 2JDNA 4PI0A 4W50A 1FPN1 1A3KA 4OHYA 2A6YA 3C3VA 3NNLA 3WUCA 2DDUA 3TK5B 2E6VA 3KHBA 1H2LA 1VP6A 2WYGB 2OQ7A 4Q0UA 2J34B 2DCYA 3PJQA 2JG8A 1NQJA 3NAPB 4ZONA 3M8LA 3U75A 1RUD3 2ADDA 1JUIA 4I09A 3QLQA 2XPJA 3FN9A 1YFUA 4P02B 1C1FA 2Y6FA 4FSJA 4LORA 3KLSA 5K0UA 3MGUA 4KGGA 1Q5OA 3NVCA 4CCNA 3I54A 4DY3A 1V6IA 4CSYA 3SW2A 1IS6A 1BEV1 1SLCA 2JB8A 3J7MA 1DLCA 3KV6A 4BMEA 5J1XA 3GZTB 4NIHA 5CFCA 3V0BA 4KQ7A 4Q0PA 1IQML 3MIEA 3RJRA 2VTXJ 3SEEA 3VBSB 3AM2A 1S0IA 2I9AA 4XL1A 3J8F2 2VXRA 1OD5A 3K77A 2DVAA 4XUQA 2RS31 4ZPIA 1FF7A 2D7FA 3FHAA 1X36A 4ASKA 5EJ3A 3TNPB 3FJSA 5JLVA 3C9AC 2Z79A 1C4RA 5K8SA 1POQA 1OUSA 2Y6HA 3UNPA 4Q4X3 2J1UA 4AFCA 1H9PA 5BNNC 2WS93 5LBEA 1ST8A 2DF7A 3WDYA 1Q8SA 2WT1A 2QZ3A 1GNHA 2OT7A 1W9WA 2A3YA 5A7NA 2VVCK 3IMMA 2OIIA 3WF1A 1KJRA 5C8WA 4TTGA 1KXGA 4BHPA 4AI1A 1C8NA 1LPZA 1DDXA 2KB9A 3ZFEC 2Z42A 3HQRA 3O0XA 2W1SA 1GWLA 5BY5A 1BKZA 4I0WB 4UFLA 4NHKA 2D1JB 2YDEA 4FO9A 3S0MA 1F0RB 2FD6A 1W6NB 1W8FA 3DGTA 4QPGB 4ES9A 3DPRC 3GZAA 4CEYB 5HV4A 3MEPA 1H4HA 1EMNA 5E6HA 1G1RA 4H14A 4UW3A 4X8NA 4XXPA 1ND3C 1OOPA 2UURA 1X8MA 2XJQA 2VU9A 2J94B 3KK6A 2A1XA 3MPBA 4NVPA 4R9CA 3TN91 1HAEA 4QU2A 2HEYF 1RYYA 4PLMA 3RDIA 4B1MA 1I9RA 3ES1A 2EIBA 4XIKA 5FOJB 5A32B 4JZDL 5JR2A 2YHJA 4NHLA 2R043 1JHNA 1RUI2 1BYHA
chains in the Genus database with same CATH topology
3NW4A 3MFCA 2DCKA 5C4WB 2EI7B 3KMHA 4AFBA 1YUKB 4AQ2A 1XDTR 5DUUA 3RRDA 4DINB 2XLAA 3FMGA 4RD7A 3MICA 4YFZA 4RGGA 3LSDA 2OZ6A 2XB6C 3FBMA 5IT6A 1S0CA 5DZFA 1V9U3 3POYA 2WA3A 6COXA 2PYTA 2VW1A 5KXEA 3VKMA 4H14A 1SZBA 1JL9A 1JYCA 2ETEA 2HJIA 2JG8B 2O8QA 3N35A 3BCWA 3HAGA 4GXLA 5A33A 3TN91 4IEOA 2VUAA 4LUMA 3S7IA 1PK6C 2BNOA 1LOGA 4QMAA 4C1WA 3JZVA 3QD6A 3Q9OA 4QPYA 4XQWA 5HCBA 5TSWA 3IKWA 2RM21 2RS12 4E4SA 5JBBE 2ZGSA 4AEDA 1CN1A 2O0OA 4OZXA 3VBRC 4UXAA 2BNMA 4E9KA 3SHRA 4L99A 3O5SA 4M3CE 2ENRA 5E1RA 5KC6A 3ZSMA 4HLTA 3GZUC 1O3RA 1O4TA 4R9BA 4C91A 2WNVB 5JB8E 1TNFA 3BPSE 1S55A 4JDOA 1FNZA 1LHUA 2D6KA 1OB1C 5C33A 4Q4W1 1S0BA 1AYM1 2CGOA 5C4WC 4JCKA 3NSTA 2XVLA 2O1QA 4AI0A 1N1SA 1W6OB 3AK0A 4Q4V1 3LKJA 2XBXL 1UPIA 4TWTA 4HN0A 3OD0A 1N1YA 1YJLA 4X8SL 5CVRA 2D6NA 3KQEL 2DU0A 1DVAL 3H8UA 4XOGA 3U10A 2Y0IA 3LCPA 1XNBA 3LGRA 2HWC2 3ACLA 2CAUA 2DCZA 2FZ1A 1QQP3 1ZVFA 4YG0A 1V70A 3ZFGC 1VBB1 4LBQD 2KM2A 2Y82B 3VKFC 1W6NA 4QPGA 3TRSB 1ATAA 1B35B 1HQLA 2QVSB 3UJQA 1AR81 4OLLA 3O7OA 4YW1A 1O4YA 1UD1A 1F8VA 5BNPB 2D6LX 4X8TL 2WZR1 1YWKA 2GMPA 1HCGB 4C90A 2D5HA 5K9YA 4O1ZA 2BOHA 1LJ7A 2UWLB 1J9CL 2WYJB 3EGFA 5JVYA 1NFXB 1M06G 1OA3A 3IIAA 2W39A 2WWSA 3ZFGB 1XXNA 5HI0A 1OQEA 1AXZA 4MLOA 1MZEA 3MW4A 4XMAA 3ZXAC 3AJZA 1DHKB 1DZTA 3I8TA 2WKKA 1RUG1 2TNFA 4FOWA 4QQPA 1F31A 3VBUA 1J1TA 1Y9QA 3PHMA 4YVWC 3BT1A 3VBOC 1WA4A 3QMOA 4XFFA 1ADXA 3SXWA 1BCXA 1C28A 2XKOA 2GNDA 1G8WA 2WNVC 1JBUL 1AR82 3FX3A 2OPKA 4PIZA 2PHLA 3AZXA 2P95L 1PIV3 1TME3 4CEWB 1GBGA 1LU1A 1U12A 3BOWA 5I0RA 2BMGA 3I4IA 3NKGA 2JECA 3WG2A 1RMU1 2W3IB 1AUYA 2PFWA 1CAUB 1V6MA 3VHOA 3OJBA 4D0EA 1XE8A 2YUEA 1EMOA 1H4GA 5KHIA 2CNAA 4BQ1A 1U5YA 4Y7BB 5L2ZL 5ACA2 2ZACA 4FPFA 4N7UA 4XTMA 3N8VA 1N7DA 4NG9L 4AEDC 1UCXA 2Y80B 4AW7A 5H9QA 3H3UA 1OFNA 4I2OA 5FO8B 4MH0E 5IKQA 4A7IA 5FFOC 3H9AA 3N7KA 1SMVA 1V00A 1UZYA 3ZXGA 4F3JA 4S2GA 1W0OA 2GNTA 1DQ6A 3BB6A 1WBFA 4IV3A 5E16A 1ZZBA 4CDQA 4AGVA 4FT8A 4B7EA 1IQLL 1KFXL 3RQ0A 1RMU3 2HEVF 2E7AA 2W2QE 2XLFA 4LULA 2YMZA 1FYUA 5ABJB 1QKQA 5F9TA 2W2OE 3UKNA 1DIYA 1PIV1 1TME1 4W6XA 4DQAA 2XHKA 4FPKA 3AMHA 3S6PA 3ZFGA 2YZ4A 3FC0A 1AJOA 4Q0QA 1UIKA 2JD4A 1XE7A 3R4UA 4BLIA 1JOJA 4DFSA 4I02A 3ZPYA 3T1MA 2XVKA 3I7DA 1BBT2 1AX0A 3VBUB 1RUG3 2TGFA 4O9GA 4YYOA 4NGAL 2JG8C 1DX5I 1KLJL 5IK7A 5IUQA 5FCCA 4ZU7A 2EXIA 4GIQA 1G86A 2E9QA 1IPKA 1J58A 2YXSA 4TYSA 3ZFEA 4O02B 3MIBA 4UBHA 1G2MB 2ZAHA 3KL6B 2H9EC 1LHWA 2FHRA 4GH4C 1IQKL 4MUVA 4OI4A 4QGLA 1JBCA 1F5JA 2ZGMA 2ATFA 2XH6A 1SLBA 2WZR3 3THPA 1HAFA 5FLHA 4M0NA 1UW8A 1G9BA 2TEPA 2G9GA 3B9IA 3MLJA 1C1LA 2DUPA 4PLOA 4QQOA 2X5IA 1AR83 5J48A 1VJ2A 3NTBA 3D6EA 4QXKA 2HKXA 5GLWA 4ISIL 1VBB3 2VUJA 4M3CB 2FZZL 3CEWA 1QQP1 1URKA 4E1GA 2BVVA 2FLRL 4FTBA 3ROUA 2JEMA 1DQ5A 3N4MA 3DEMA 1F7EA 5IKVA 4XJ8A 3ZFFC 1XFEA 1REDA 4XFHA 3MW2A 4Q4V3 1XU2A 2XBVL 2DVFA 2ZGQA 4IV3B 2NZ9A 2P37A 3AP5A 3FLRA 1AYM3 4B3NA 4Q4W3 1W2UA 5DUWA 1ND2A 5GM0A 3RYKA 4KG0A 1T6GC 3OY8A 3AKRA 5ABJA 2P3JA 2RA0L 4INDA 3ZSJA 3JB8A 2FQPA 3VBRA 3HR9A 2JG9C 5BNOA 2VWLL 1DU3D 3GHMA 3VBSC 2RM23 5F1AA 1SCSA 1A6CA 1NLRA 1V6OA 1OKQA 3ALQA 3IWZA 3LOIA 1IOEL 5I8YA 1FT9A 3SCFA 4RRWA 1I0UA 2WG4B 5IKRA 2OZJA 2PA7A 3TN93 3BU7A 1IQJL 1CPMA 5I8TA 2XKPA 4RL7A 1EY2A 1F5FA 1PXXA 1ALYA 1MEC2 4ES8A 5CADA 1HQNA 4AVSA 1V9U1 1YNAA 4LO4B 1J59A 4XFIA 1SFNA 3OLUA 1S0FA 1OSGA 1IQHL 3U4XA 2W86A 4CDWA 1VBA2 4MX3A 2GMMA 4R8HA 4PIYA 3O0WA 1Q8OA 2MGRA 1NA1B 4PQ9A 4XBNA 4MSVA 2VWMK 2DV9A 4P5HA 2PHXA 2R041 3IDBB 4NPRA 4WZCA 1APOA 3GHNA 4HVOA 2O8OA 1J3PA 3THTA 4RSUA 4UW6A 4GWMA 2D44A 4YRDA 2QQPA 3IDEA 3MQEA 4EWAA 2BNNA 1LMMA 2X5IB 1DGRA 4C16A 3R4DB 3IDCB 3QCWA 1D2QA 4D7TA 2D97A 1CX4A 3DPRA 4LA2A 2BWAA 4M3CA 1CONA 1COUA 4PDWC 3ZN5A 4OULA 2OW4A 1ENSA 1VAMA 2NMOA 1GICA 4Y22A 1ZRDA 2RS52 3OBTA 5AFBA 2YC0A 2WS92 1DBNA 1FV3A 4Y76B 3H1YA 1CAVB 2ZX3A 5E88A 3N8ZA 1PFXL 2C5DA 2WS91 2ZGUA 3A4UA 1UU4A 5JZGC 3AYAA 4Q4X1 1NY72 2ZS6B 2J4IB 1W7XL 3IITB 2WLQA 3KCCA 4X8UL 1N3PA 1G1SA 5CG9A 4BM8A 2IWGB 2GC3A 2Y0OA 2RS33 4A94C 1WGPA 1BXHA 1VBE2 4JRAA 2EXHA 2A3XA 4MYEA 2I45A 1OQDA 1REFA 3AZVA 1BEV3 5BNOB 1X82A 4WM7B 5A3LA 1PNFA 2P3IA 5JB9E 5H9SA 3LSEA 3ZIXA 3I2DA 5BYNA 3CNAA 3GBWA 1QQP2 1RUD1 3WQ0A 2WT0A 4RRZA 2RR12 2IFRA 5J98B 1CJPA 4Q1PA 4OUSA 2NM1A 4Y24A 5LK7B 4EN9B 1WCSA 2IXIA 4YZ1A 4IV3C 1MVQA 4K6BA 1RUD2 1FAYA 5GZFA 1FATA 1FPN3 1QXRA 1XYPA 4WM8C 5FLJA 5DG1A 2MPFA 5I8SA 3ZX7A 1F7MA 4MXWB 1J3RA 1G2LB 1DYPA 2D3RA 3N3HA 4LE3A 5F6KA 4K8FA 1H8VA 4FPLA 5L2YL 4U36A 1MEC3 2YGPA 5CAZA 3E5UA 4D3WA 3J8F3 4C1XA 1G9DA 1NXD1 4X8VL 1LGBA 3VDDC 3DN7A 3WD5A 3VHRA 3OYWA 4BZ4A 5CNAA 5CFCC 1NFUB 3WUDA 1COV3 1BBT1 1RINA 4KU8A 5CIRA 1AF9A 1YUGA 4HZFA 1Y3TA 5J09A 5FDQA 1LULA 4L92A 2WJSA 2AGSA 1BQPA 1PVC3 4I30A 3BTAA 1Z78A 2D3SA 4I3PA 1HREA 4LR4A 4QHBA 2ZX4A 4XE9A 1EQHA 1CR7A 2X8KA 3ASIA 1O3QA 1EGFA 4GB33 2DUQA 3PNAA 4META 1V6KA 2X29A 2RNLA 1ULDA 4W6WA 2QUOA 2CY6A 3K51A 4Q0VA 2VULA 1IZ3A 3CLPA 2HWD3 3KGLA 1HZ8A 4E2QA 4PDWA 1VBC2 2WFF3 4HBNA 5FOBB 2IZWA 4YARA 5F6LB 3QH6A 2EALA 1NE4A 3NT1A 1HRV3 3KZ4C 4MZUA 4M11A 1CJDA 5AC91 2BQ6A 3LIWB 2ZGTA 4FQZA 3NO8A 4NN0A 2EAAA 2BOXA 3FFGL 1R093 1W6MA 1K37A 4Y20B 3N8WB 1UKGA 4Y1YA 2XL9A 3N8YB 3N7MA 1K5MC 1ULCA 1MACA 3SLIA 3WV6A 1QOSA 4FPCA 1WW4A 3TH3L 1VRH2 2XJUA 3E97A 3SOQA 4U2AA 2ILMA 1RUE3 3O14A 1AR62 4COVA 4LTAA 1RHI1 1SBEA 1SLIA 4BIFA 5FO9B 1QOOA 3SH4A 1N3QA 3ATGA 1Q8QA 3VBHB 2JG9B 2HWE1 3MFAA 1W6QB 1QJX2 4Z2WA 4Y1XA 5JVVA 3AXEA 1VAKA 2R071 2ZHMA 4BDXA 5DUXA 3ME2A 2ZPXA 1DIWA 2XBYL 1FOD3 2DVBA 5EFUA 2WC2A 4DRVA 1R092 1RUNA 4L11A 1YHFA 2WQ4A 4HKLA 2PHUA 4TSVA 3MIDA 1UZZA 1L3YA 1AUTL 4XDQA 2A6ZA 5JR7B 1R081 4AK3A 1JV2B 3W9AA 2ZGOA 3GYDA 1QMJA 1NA1C 2P17A 4QQLA 4GH4A 4HMZA 2VH6B 1RVF2 3D4KA 3GISX 2VECA 2F6BA 1LECA 3MIGA 2DWRA 3LA2A 1XQNA 4MMZB 2P2KA 3AFKA 1IS5A 4JYUL 3BOPA 4WM7C 4AFAA 4DOUA 5JSRA 3JD73 2ZMLA 1NCQA 2H6CA 1YFYA 1N1VA 4XZPA 3AMPA 4RHV1 3VBOB 3NJPC 1RUI3 3KS7A 5CKMA 4FPHA 2GC2A 2BW8A 4ONUA 1XKBA 1VBD1 3E6CC 2F4PA 5FPZA 4AQ6A 1QJY3 3QOPA 1CEJA 1PM7A 1RUH3 2UWAA 4I0BA 1REEA 1CESA 1W39A 3R05A 1DGWX 1C5MF 4GB32 1ZZ7A 1F0SB 1DQBA 1Q4GA 1ZZ6A 1VBE3 2HWB1 1MQTA 5IKTA 3B00A 5IK5A 3QACA 2PHBB 3M37L 1W6MB 1RUOA 1QJU3 2BPA2 4Y20A 2HWC1 1BEV2 3ENSA 4FP3A 4IV1B 1DGWA 3ST7A 3WP4A 2B42B 3NAPA 3WQ1A 1BJQA 1Z7S1 4Z82A 1PGW1 3ECQA 1VBC3 3HWJA 3NL1A 5K0UB 4WM8A 5ABJC 1CAXA 1BK1A 4Y7AB 1OOPC 5EWSA 1VLNA 1F9KA 1YYNA 5ACA1 3LB9A 2C9AA 3SCGA 4AEJA 4C0HA 5CFCB 1DDLA 3VZOA 1H1AA 1ZRRA 3BODA 1SFYA 1S2BA 3VBSA 5AFEA 4A3XA 2G9FA 1UZJA 1W6QA 3NV3A 3EBRA 3WW3A 2LTNA 4NO4A 1COV2 1GK5A 4D69A 2W52A 3VBHC 5L7OC 1VB4A 4AHWA 4Q27A 2PHWA 2R30A 3W58A 1FSBA 2UYBA 2WQZC 4JGZA 4XF3A 3JU9A 2RE9A 1MZ6A 1EPIA 2XC4L 2W26B 1G1QA 1U67A 2Z2SB 4DXZA 4YW3A 3MYXA 5JOWA 3H7JA 2EF6A 4WZFA 4MVTA 4BTTA 5GLUA 1ZAQA 2AUYA 3NV4A 2XBWL 3WHTA 1PO13 2WNEA 4RS5A 3TOJA 1D4M3 1KJLA 2ZHLA 5LEKA 1IVOC 1OOPB 3JBG3 4QX5A 3CJIC 2CAVA 3O0VA 4RR3C 4D7SA 1XKAL 1NFYB 2A75A 2NQYA 4IQPA 3ZYPA 1UU5A 5J3UA 3VBOA 1ND3A 5FAXA 2UY9A 5A32A 2H0VA 1LRHA 4XHXA 4Q4Y1 4V1PA 2P93L 1LEMA 1HV0A 1PTHA 1EV13 2P3FN 1WLTA 4LBLA 2PLV1 2R063 5C4WA 4HSJA 5J36A 2WPJE 5KXDA 3HO5A 1DQ0A 5J96B 4ISQA 2VMHA 2D98A 1SLAA 2NN8A 1NZIA 1AYN2 1IQIL 3M70A 3R6SA 2WPLE 2PHDA 3VN4A 3VL8A 5D8AA 2BWCA 2WNUC 1C5HA 3PVBB 3OLTA 1N1IA 3ILNA 4E4ZA 2UY8A 3HS7A 4SLIA 4EN7B 5A33B 2PAKA 1HT8A 2I07B 4AVAA 2XJVA 4Z0LA 1CAXB 5COXA 1SDWA 4KH9A 4L8QA 4CTEA 3PGHA 1AJKA 1R1A2 5EXOA 4YGCA 2K2TA 2I74A 2RS11 4N9IA 5KHGA 1PGEA 1Q8VA 1EAH1 4BLJA 2PTMA 2G00L 3BT2A 1WUVA 3A0KA 4NR1A 4ZXKA 4XFCA 1KRIA 1QH7A 1ULFA 4CUDA 3CO2A 3KB5A 1U5IA 4XF0A 1LGNA 3M7AA 4LBQA 4Z6AL 1HXS1 3B69A 3WDTA 5I0SA 4PF5A 4JGZB 1R082 4IEVA 1W6OA 3MPPG 5BNOC 2J38B 4AQTA 1BZWA 4AE2A 4JYVL 3KSCA 2XBO3 5L73A 2ZOEB 2P34A 2RR13 2PAEA 1V9U2 3AKPA 2W2PE 4QD2A 5B2GB 1CGPA 2V09A 4LBKA 1H8TA 1Z0HA 1B35A 2UYAA