3ZYJB

Netring1 in complex with ngl1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
330
structure length
326
Chain Sequence
YDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFESTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4C
total genus 63
structure length 326
sequence length 330
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyjB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyjB02
1WHFA 1CQEA 1KSNB 5L2YL 1PXXA 3KQEL 1FFMA 3N8WB 1COUA 2VVVL 2Y5HL 4RUTA 2J34B 4MMYB 2Y80B 3U7UG 1PTHA 2J94B 4Y6DB 2W2ME 2NPRA 1XDTR 4FM5A 4BTIA 1ATEA 3V65B 3Q3KB 1HAEA 4JZEL 1I0UA 2WFTA 1XKBA 2Y7ZB 4Z0KB 2RA0L 1HCGB 3FCSB 1UZPA 1U67A 1JV2B 1TOZA 2EI7B 4PLMA 1B9WA 4ISIL 5JVZA 5CKQA 2BMGA 2VH0B 3N8YA 3TZIA 2WPJE 3GCXE 2H9EL 5CKNA 1FF7A 2Y38A 3KRKA 1IJQA 2K2SB 1IQNL 3FBYA 1FE2A 5L2ZL 1EPHA 3QH0A 3CS7L 3IITB 5JVYA 2RNLA 1XKAL 5EGMB 2I9BA 4BXWA 2WFXB 3Q7DA 1NFUB 1IQKL 2TGFA 2WYGB 1HT8A 1IQHL 2GD4A 2BOHA 2P16L 1L5GB 2KB9A 1HJ7A 4X8TL 3PGHA 4Y71B 2W3KB 4MMZB 4JYVL 1IQJL 3LN0A 3P5BL 5IKRA 1NFWB 1F7EA 1AUTL 3M37L 3SOQA 4BTTA 3BT2A 5COXA 2FLBL 1EGFA 2PHBB 3N8ZA 2P3FL 5CKMA 4RS0A 4ZH8B 4BDWA 3QMOA 3HO4A 4BXSA 3MDLA 1C5MF 3SW2A 1NFXB 4COXA 2P3UA 2BOUA 2OYUP 3QCWA 3KL6B 2Q1JB 1DQBA 1APOA 1F0SB 4XBMA 3LIWB 3TBDA 2XBYL 4NG9L 4BDXA 1IQML 2MHPA 4LORA 1ATAA 1IQIL 1LQDA 5JBAE 3LC5B 4XLWA 2VJ3A 1M1XB 3U73A 1G1SA 4A7IA 2YGPA 3BPSE 3N8YB 1ATBA 1FSBA 3KQCL 1CVWL 1KLJL 2AYLA 3NTBA 2WPKE 5KIRA 2WG4B 1NQLB 1IGXA 3H5CB 1JBUL 3TK6B 2EI8B 2BO2A 2J4IB 2RHPA 3N8VA 1Z6EL 1N7DA 1TPGA 2F9BL 2FLRL 4M10A 5FDQA 3POYA 3NTGA 1PGEA 3R05A 4ZXXL 4JYUL 4URTA 1EBVA 3EGFA 5JBCE 1NZIA 4PLOA 2W2OE 1CVUA 2P95L 5I46L 1UZJA 1DX5I 4AQSA 2VVUL 4E1GA 4Y76B 4CSYA 1APQA 4Y79B 2UWOB 3KQDL 1L3YA 1YUKB 1EPIA 5IKTA 4Z0LA 2XBWL 1EAIC 2VWNL 4D0FA 2KL7A 3FFGL 4M11A 3F1SB 2G00L 1HZ8A 3HS7A 1LMJA 4RRWA 1P0SL 2CJIB 3LTFB 1EPJA 5K0HB 1IVOC 3SOVA 4PLNA 5CISA 3OLUA 1ADXA 3CENL 2BQWA 4RRZA 1LPZA 1ZAQA 1G2LB 4X8SL 4YT7L 1PRHA 2I9AA 3MQEA 4TGFA 5IKVA 1CCVA 1UZKA 4Y7AB 1DIYA 1FJSL 1Z6CA 1FAKL 3LC3B 2M74A 1BF9A 5JW1A 1IP0A 1W7XL 4ZXYL 3N8WA 4BTUA 2P94L 2PR3B 2DDUA 1IOXA 1EPGA 1CCFA 4JZDL 3IJEB 1K37A 1RFNB 1U8CB 4OTJA 3V64C 2P93L 1NT0A 2FLGA 3ASIA 3TK5B 1F7MA 3M36L 4YT6L 4CUEA 1UZQA 1A3PA 1YGCL 1HRFA 1ATDA 1DVAL 2UWPB 5JB9E 2BZ6L 1GK5A 3KQBL 1PFXL 1X7AL 4X8VL 2VWOL 1HT5A 4O1ZA 2W2QE 2Y82B 1YO8A 5E8DA 5F19A 1IQEL 1LPGA 2WPME 2J2UB 2Y5FL 2K2TA 2D1JB 2W26B 2W86A 2PUQL 2W2NE 1WHEA 3ZYGA 3RR3A 1KLOA 3GISX 1HX2A 5JB8E 3BT1A 1SZBA 1O5DL 4RRXA 1IGZA 1IQGL 4ZHAB 3ZYJB 1YUGA 4Y7BB 1V3XB 3C9AC 2B7DL 2VWLL 5JBBE 1G1RA 1MOXC 1OB1C 2J38B 2WPIE 3KCGL 2JKHL 1Q4GA 4YZUB 1G1TA 4OVEA 1URKA 3GCWE 2Y81B 4PH9A 1TLEA 5IKQA 2P3TA 1G1QA 2MGRA 3NJPC 5KN5C 3CA7A 1XFEA 1YUFA 2EI6B 1G2MB 2MGPA 2VH6B 1IQFL 3TGFA 1QFKL 5F1AA 3SOBB 3ELAL 2WPHE 4G1MB 2WPLE 2XBXL 2XC0L 1EZQB 3N8XA 4NA9L 4NGAL 1EMNA 1F0RB 1IOEL 4OTYA 4CUDA 2VWMK 1N1IA 6COXA 4C16A 4D0EA 1J9CL 3HO5A 2XC5L 2XBVL 4X8UL 4MMXB 4RRYA 2FD6A 4O02B 1MQ6L 2OYEP 1KLIL 2WG3C 3LTGD 3OLTA 2WYJB 2VVCK 1HAFA 1MQ5L 2P26A 3HO3A 3LAQA 3LN1A 4ISHL 5L30L 2BQ7A 1FAXL 2Y7XB 2Y5GL 1EQHA 4XL1A 2W3IB 4AQTA 4LMFA 2J95B 2XC4L 1P9JA 3HPTA 1DDXA 1IQLL 1W8BL 1NFYB 2P28B 2BOXA 3NT1A 1EQGA 2BQ6A 1JL9A 2UWLB 3DEMA 2W2PE 2ADXA 1K36A 1HREA 3ENSA 2BOKL 3ZYIB 1LPKA 2YGOA 3KK6A 1WU1B 3HS6A 4CUFA 1EMOA 1KIGL 1CX2A 3K9XA 4JZFL 1NPEB 4ZAEB 3TH3L 3HS5A 3CFWA 2P3FN 3F6UL 2FZZL 2KV4A 4D90A 4Z6AL 1CEJA
chains in the Genus database with same CATH superfamily
1BEV1 2CAUA 4WVZA 3DPRB 1HDKA 3M3IA 4IUGA 4QKBA 4B7EA 4DRRA 1I1EA 3DCQA 1L3JA 4RGAA 1IS6A 3JZVA 4D69A 2ZAAA 4D6QA 4MV2A 3VN4A 1PXXA 2HWC2 1N1TA 5CFDB 4QPIC 1RUC1 2WKKA 3J26N 5JWPA 1COUA 3ZYBA 3HN3A 3BVCA 2VVVL 3FHAA 4LHSA 3WNOA 5KXEA 5KXCA 4RUTA 2JENA 1EYBA 1UWWA 4MMYB 2Y80B 1ENXA 4OFGA 5BV6A 1PVC3 1VBA3 4QXBA 1PM7A 2UWCA 1W8UA 5LK5A 4CEYC 4BA6A 3TB0A 3OD4A 4A42A 3O0XA 2XUEA 3RNSA 1SG3A 2JDYA 3MPBA 2WSUA 5JVVA 1WBFA 1SDDB 1XPWA 4W6WA 1YQ6A 5I0RA 2XLAA 1TMF2 4IE7A 1H4GA 1V6NA 2XOMA 5F3CA 1RMU2 4XJAA 4JZEL 5JIUA 3O1OA 2PHTA 4JV4A 4X8PA 4YARA 4WVMB 2GP5A 2HWF2 2MEV1 1W6QB 2HLEA 4Z0KB 2RA0L 1CAWB 1U67A 1JV2B 1RHI1 1SHWB 2OPKA 5JSRA 1GLHA 5FZ7A 1S55A 4IESA 2WIIB 4FPYA 2QQLA 1TMF1 3H3UA 3N9QA 4PLMA 3E1F1 4Y20B 2XJTA 1B9WA 2XR4A 2ZX0A 1A78A 4DUVA 2FBEA 5CA6A 4JQTA 4RS5C 4CYDA 4WM8C 4CXXA 4O7XA 4NIDA 1QJU1 2A1XA 4HVOA 2PHLA 2K0GA 3TZIA 1SEFA 4IL7A 4X6RB 1B35B 1JXNA 2IVIB 4LO5B 4EROA 5IVCA 5FYMA 4OUSA 1FOD2 1Q8OA 2RG4A 4XF4A 3WNKA 1M06G 3SC7X 1FF7A 4HETA 5A7OA 3UL2A 4CU9A 5FZ8A 4C91A 5ACA2 1RUG2 4PDWA 3QLQA 1GNYA 1J84A 1AVBA 2GH2A 4R9DA 4GB32 4CA9A 1JOBA 4FPHA 3VBRC 2Y64A 1UXXX 4BDVB 4L0PA 3DYOA 1W8FA 4QX3A 5ISLA 4Q0PA 4PF5A 3A7QA 4R9CA 1BEV2 5FCCA 2RNLA 1POQA 4AQ6A 4GU3A 4TLGA 3TEZA 4R9AA 3Q7DA 5F5CA 4M4RA 1IQKL 2BUKA 2D5HA 3HT2A 3NNJA 1WUVA 5FP9A 5CNAA 2ADEA 2ZAHA 1QIUA 3J7NA 3K75B 3GM8A 3BTXA 4Q4V1 4XHXA 2P16L 1HRI3 3T09A 3I8TA 1PK6A 2Y6LA 1AX0A 4BLJA 2ZGTA 3ZPOA 4DO0A 2IXKA 1BVP1 3PGHA 1S0GA 4Y71B 4Q4V3 2VVEA 5K7PA 4D0QA 5ERLA 2P17A 3KSCA 3BPZA 4MMZB 2TUNA 4MHRA 3VL8A 4QM9A 1US2A 4M01A 4LLOA 1BKZA 3SNMA 4EN0A 1PHMA 1L7RA 5FLJA 5GLUA 3B00A 2WSVA 1V6LA 4BTTA 4XFBA 1ZZCA 2WR9A 4S2GA 5FOJB 5GZGA 5COXA 1RUI3 1ZM1A 5FXZA 3S7EA 1H30A 4CSWA 3FLTA 4CDWC 3C2UA 5DZFA 2HWE1 5FY9A 4QPGA 3ACGA 1G7YA 1RYYA 4RA0A 4BIFA 2IC1A 1LHVA 3PU8A 3N3HA 5FKBA 3HO4A 3FC0A 4Q4V2 1HXS2 1PMHX 2NZ9A 2E32A 3OCPA 4DNYA 4FXGB 5DZGA 1LOGA 3QCWA 2OYUP 2A5ZA 1IPSA 4TYSA 3KL6B 1JUIA 1EV11 3UJOA 1SQ4A 2PHDA 4B4PA 1UW8A 1O5LA 5HCHA 3MPPG 3RZJA 2ZGOA 2ZPXA 5LBBA 1OPMA 2ZHKA 3FL7A 1YQ8A 4CDQA 1CAUB 1XXNA 2JKXA 4D3WA 2VNOA 2DVDA 2RM22 5F39A 5K8SA 5A32A 4C90A 3M8LA 4BQ1A 1K45A 4GQ7A 3VBRB 1HXS3 4CP0A 5IVBA 4Y22A 1UIKA 1N3PA 5FZ4A 2DCYA 2DURA 1JBCA 3ITQA 3H1YA 3L9JT 4ONUA 5FRAA 4Z2AA 2FD8A 4QKDA 3LC5B 3NJZA 1HXS1 1Y43B 2H6CA 3RGBA 4ES9A 2VJ3A 2AH2A 1Z7S3 4N53C 4YG3A 4XBLA 3FBMA 5FXWA 1O3SA 4YFWA 2YGPA 4YM3A 1CAWA 3BTZA 3VBUC 5EYYA 1S0EA 5A3TA 1FSBA 2XWBB 4HG6B 4LO6B 5LATA 5BNOA 5J7MA 1DGWA 3K48A 5E6HA 5LY1A 2PN5A 1YJKA 1CVWL 1W6OB 2D98A 4R9BA 1XNKA 2ZX2A 1LOFC 2R16A 3LFMA 5KIRA 5AC93 3S6XA 3BU0A 1AR81 4JGZB 4A6OA 4R8HA 1X36A 5A7PA 4CUBA 3T2QA 1IGXA 3B7MA 2PA7A 4LIVA 3H5CB 1PGW2 3O1UA 1H0BA 2WZPP 2CNAA 5FZLA 4OI1A 2FMYA 1NOVA 2Y0OA 4L99A 5M0TA 4P9XA 5KC5A 1LULA 1V6JA 4NHXA 5T52A 1JOJA 4YZ3A 1NX9A 2XB6C 4MGSA 1XYNA 4FP2A 2Y8KA 5FYIA 4ZKTB 2ZBJA 1HV0A 5FDQA 1NCQC 1YI7A 5FREA 3IDEA 4MADA 3SHRA 1PGEA 1RUE3 3WP4A 5JIAA 4XTPA 4K9SA 2CV6A 2LRPA 1UX7A 2HWE3 4K21A 3KQRA 2XXZA 4IEOA 4BXFA 1AYM3 4PLOA 2W2OE 1IG3A 5A33B 1ONAA 2UWAA 1RUE2 2ERFA 4AL9A 3B69A 3PUHA 2VQAA 4FQZA 3UGGA 4NO4A 2I45A 2RMU3 3FFQA 3DN7A 4Y33A 3VLBB 2GMPA 3J8F3 1F4HA 1W9WA 2UY8A 2VO5A 2YMZA 4Y76B 3NQHA 4CSYA 4LHNA 2F4LA 4LOSA 3VV1A 3U11A 2G9FA 3ZMOA 3KQDL 1NA1B 4PT6A 2JX9A 4YW4A 1L3YA 1WCKA 1CPMA 1H8TC 5JI9A 4Z0LA 1K5MA 3U37A 2XBWL 5FP3A 3KLSA 4D8MA 3IPVB 2CGPA 1UKGA 1ODNA 2IFWA 2WYSA 2ZABA 3AC0A 3CZUA 5FYYA 3ZR5A 3O1MA 1XNAA 1WA4A 4LHKA 3VBFC 4M11A 2EAKA 2G00L 1HZ8A 1AHSA 2ZX4A 2EICA 3HS7A 4RRWA 1WCQA 4O61A 3PUIA 1LOBA 4GMP0 1LHOA 2RS31 2XBO1 1W06A 3J8F2 3M4FA 4RQPC 3RYPA 5JOYA 5K0HB 3RYRA 5JDBA 1K42A 4J1XA 3VBSA 1BK0A 1QNWA 1A8MA 1H2KA 2R042 2RJLA 3J4UH 1FMD3 4BQYA 1FPN1 4UFHA 4AFCA 1D2QA 1ZRRA 2C0ZA 1LRHA 2PHFA 3DXUA 3KGLA 4GAZA 4PI0A 4CEWA 2RM21 4YT7L 2BRTA 2I07B 3GZEA 5L73A 2EXHA 5IKVA 3K77A 2QVSB 2ZZQA 4Y7AB 5FIXA 1CX1A 2B45X 3J9SA 4HL0A 3PUSA 2RJ2A 4OI4A 1YFUA 1FAKL 2BBVA 5LEJA 4ASLA 1LNSA 3LC3B 1ZRFA 4AFBA 2M74A 1F9KA 2WRAA 4LBKA 3I2IA 2ET7A 1BF9A 1DP0A 3X29B 5H9QA 4NPLA 2E7TA 2PQSA 1OA2A 3ON7A 1W7XL 3LA2A 5FZKA 5T3NA 2Y0IA 5GJ6A 4BTUA 2P94L 2DDUA 4ZS3A 4IERA 5FY7A 4L97A 2ARAA 5FZGA 4MGYE 1S2BA 1A6CA 1OOPB 4R4XA 3VGIA 1QH6A 1W9TA 3IJEB 4INDA 1HX6A 3OBRA 1RTVA 1U8CB 1QJY3 2ZCWA 4LE4A 4Y1UA 4E27A 4E9KA 3FUOA 3HWJA 3V64C 4CP2A 1JW6A 4UW3A 1NZCA 4ZZ8A 3TN92 4FPLA 1LOCA 4XACA 4BQ5A 2LUWA 3CDZB 1QJY1 5FO7B 3GXUA 1UNBA 4CUEA 5KXDA 3JD71 1A3PA 1US3A 5EIYB 4TTGA 1UMIA 2XONA 1UMZA 1YQ2A 1ZZ6A 3ZDVA 3LSEA 2ORZA 1YGCL 2D6MA 2AR6A 3HAGA 5BPXA 4FPEA 3B9IA 4CCJA 4CPBA 5G05L 2VECA 4UFMA 3THDA 1Q3EA 4SLIA 5HI0A 5FZIA 5BNOC 1H8VA 5JB9E 3J7LA 1TE1B 1PK6C 4KWUA 1NQDA 2F4PA 2W1WA 2RR11 4UXAA 2JIGA 2PQQA 1PFXL 1OA3A 3E5QA 3I4IA 3JB8A 4HKWA 2NYYA 4DOUA 1NKGA 4O1ZA 4NRQA 2WINB 3MIHA 2X8KA 4IEUA 1CZTA 1ZBE1 2W2QE 2QBXA 2JB8A 3MF9A 4I09A 3ZN4A 1W90A 3ZN5A 3VBSC 5E8DA 1R64A 2J1SA 2R063 2LTNA 1PNGA 2WYFA 1FPN3 5FPLA 3W5NA 1IQEL 2WPME 1R1A3 5JXGA 2ZMNA 2ZEWA 5A32B 3FWEA 3IAQA 3MLLA 2J2UB 1CAXA 2J1UA 4XBQA 5IK7A 3ENRA 2VC9A 1GZTA 1H6YA 2BDRA 2BEOA 3IWZA 2W2NE 3MIDA 5C9AA 1A34A 3WHUA 1VE0A 1F8VA 4LBQA 3H7JA 5LY2A 3ZYGA 1KJLA 2JDUA 5JB8E 1K5MC 5T5PA 5FDBA 4XFGA 3ROUA 1AR62 4CPBD 4RRXA 1COV3 2R7EB 4I30A 3WF4A 1CIYA 3U4XA 1O91A 2VNVA 1JU3A 4CDWA 1XU1A 2ZX3A 4E8DA 5FYVA 3O1TA 4Y7BB 1RUH3 3C9AC 2B7DL 5JBBE 4AWDA 2W9XA 1MEC2 2RE9A 3N9NA 3SEEA 4WVVA 3FZ3A 1OB1C 1FX5A 2GC1A 2Q8OA 3GZTB 3WDXA 2J1VA 5JMCA 2ZTNA 1UN1A 3NWKA 3F2ZA 3POIA 5IFPA 2VBBA 1AZDA 2WQ8A 4YVSC 2R073 1VB2A 1RUD2 2GN3A 2X09A 2BW8A 2VMCA 3VDCA 1URKA 3BALA 2A3WA 3WDVA 5DXDA 2RS53 4XVHA 4IE4A 1TLEA 5IKQA 4META 1D4M2 4OHZA 2VY0A 5C8CB 4QDRA 3UJQA 4DRVA 5FWJA 4HBNA 4IE6A 1M4WA 2HWC1 3AMQA 4XJWA 4A7KA 4JVAA 1G2MB 2B9UA 2VBPA 3RMXA 2VH6B 1IPJA 1EPWA 3BU7A 4LO7A 5F3GA 4Z8BA 1QFKL 5EJ1B 3G7DA 3VZJA 2WS93 1HB4A 4G1MB 1RUJ1 2WPLE 1JMUB 1PNFA 1YNAA 3A21A 4JTOA 3GBWA 5F5IA 3C8XA 1VB4A 3WG2A 3URFA 4LBOA 4NA9L 4KBBA 3VBRA 3ZXKA 2PXJA 4K8RB 3MV01 5CYYA 4CDXC 2GAUA 2Y33A 3O5SA 2YC2A 2VWMK 2L9LA 1SLTA 5K9YA 4E8CA 1LCLA 3RZMA 1W0OA 2CGOA 2ZGSA 2Y34A 2W08A 3GHNA 5BNNC 4KH9A 1AYN1 5GLTA 2OX0A 1ENQA 3FMGA 5FO8B 1RUI2 1TNFA 5IAXA 3LD8A 2XBVL 4GXLA 4E2GA 1I5ZA 4MMXB 2X05A 5HPOA 1AXYA 2CDPA 1JU4A 3I3DA 2FD6A 4AAPA 2A6VA 1CZSA 3VKFC 4BISA 1ZRDA 2W0XA 3KF3A 1KLIL 1MPXA 1WBLA 1C1FA 1V6OA 2ZGKA 1G6NA 1GWKA 1QXPA 2XLGA 4UW6A 1LU2A 4XW3A 1GNHA 1W6NB 3LTGD 3NJYA 2WNUC 4YYOA 1E5SA 1TVGA 3HN1A 3LAQA 4JGZC 3ZSEA 3OGRA 1POV1 4OI0A 1DLCA 1O59A 1FAXL 1H9PA 2BNOA 3GF6A 1O8PA 4XURA 1EQHA 1P8JA 2BBAA 5E8AA 1YFXA 4LMFA 3WNNA 2FDFA 3U75A 3NVCA 5CBLA 4FFHA 3MFCA 3HPTA 4QHZA 4C1WA 1BLZA 1ZRCA 3GYDA 3SLIA 1W8BL 1NCQA 5LB6A 1ULEA 4FFGA 3K51A 3O0VA 2YY1A 5AFBA 2VCMA 1H1IA 3OUIA 4XABA 4XEZA 4XZUG 3UT0A 1EQGA 2BQ6A 1GOHA 3DEMA 2ENRA 2VD7A 1E5IA 4I3PA 4M3CB 3PJYA 5FXXA 5FZ1A 4HPKB 1TMF3 3Q8BA 3S5AA 1V1IA 1J58A 2WQZC 4LBJA 2IXCA 3HOBA 4P9WA 3VB9A 4A3ZA 5C3OA 5A33A 4LO8A 5IATA 1LESA 1UZVA 1WLWA 1YC61 2WN2A 3HMYA 2HOXA 2VMHA 3FJSA 2QQNA 2R32A 4LBQB 1OLMA 1WU1B 2WJSA 2GALA 5GLVA 5IVVA 3HS6A 3T3YA 1NLRA 1EMOA 1FI2A 4W6YA 3T1MA 3WNPA 4UFJA 3AZWA 2JDHA 2ADDA 3VDDA 1K5JA 2XVGA 4DUWA 5GZCA 2DVAA 1Q43A 5FMOS 5C3QA 3O1PA 3HNBM 1UY2A 1MZFA 2XJUA 4PI2A 4DEQA 3CF6E 1XU2A 2VL4A 1NPEB 1QJU3 1XE0A 4CCKA 5JXHA 2VRSA 1NCRC 2K9ZA 3VBFA 3F6UL 4BXSV 3USSA 4BCUA 2FZZL 2KV4A 4D90A 1GMMA 2R1DA 5BNNB 4Z6AL 1MS0A 1CEJA 2P3KA 1WMXA 5FJKA 5D8AB 4CCLA 4P14A 3TOJA 2R49A 1MS4A 2R1BA 1OF3A 1TG7A 5F8PA 2PLV3 2DV9A 1UOJA 2BFUS 2VUJA 2EIEA 3VBOB 1CQEA 4GKXA 4M0HA 4LEJA 1BXHA 4MX3A 5BNPB 2OQ6A 4K40A 2BSFA 1QJZA 2AC1A 2DCJA 2NMNA 4PBOA 4DINB 5FZEA 4V2WA 3WP5A 1XQNA 3VD5A 1JZ6A 2VW1A 2X5IC 4FBFA 3DECA 2J1AA 1ND3A 2J34B 1ZRIA 3H3ZA 2DYCA 5FY5A 4E4HA 1U5XA 2GNMA 3JBG3 5A80A 1LB2A 2B7YA 4GKYA 4DQAA 5FFOC 2P6CA 4LQRA 1OVPA 3KT1A 2Y6KA 5IK4A 1CONA 1OUSA 5CFDC 2PAEA 2WZR1 3WV6A 1HB1A 1SDWA 2NPRA 4YGEA 4AI3A 3Q3KB 4NMIA 2HBTA 4FPFA 1K3IA 2YC4A 3WW4A 2W91A 4HKOA 1XKBA 4JKMA 3FCSB 1UZPA 5EFUA 4HZFA 1TOZA 1CN1A 3I2HA 5F32A 1QDCA 3M70A 4Q4W1 4XETA 2VPVA 4JTNA 3VZKA 3HNYM 2ZEYA 3AYDA 3A4UA 1GQPA 2HJIA 4ISIL 2WFF1 5JVZA 1COV2 1W6PB 3E6CC 3I2FA 4I2OA 3J8F1 5JI7A 2JWPA 1ULFA 2VH0B 3N8YA 5FP8A 1HN1A 4XJ9A 2VG9A 5HBAA 5FZOA 3ILFA 4ITCA 3GCXE 1CIWA 2HWB3 2TBVA 4IGQA 1CX4A 4G4FA 3ACFA 4ZZ5A 4FPGA 5CIRA 2Y38A 4MXWB 1Y7BA 2K2SB 1IQNL 1AR93 2EIGA 4JDMA 3V0AA 3NV2A 1QHDA 2J22A 3BCWA 1W99A 3AMHA 1EPHA 3QH0A 1N1YA 2VCBA 1NXD1 4IGOA 5KHIA 4LITA 3IITB 1J83A 2VNRA 5T54A 3WNXA 1PMIA 4XQDA 1IQDC 4AOCA 5EGMB 2I9BA 3BODA 4Q4Y3 3I59B 1DQ6A 2WFXB 2DUOA 2XVKA 2DCTA 2PHUA 5A3LA 2IXJA 2FDIA 1S0BA 3AZZA 1DYPA 4CRQA 3UETA 1L7QA 1SFPA 1NFUB 2HORA 4JHTA 2E63A 2WYGB 3THCA 3WDWA 1X8EA 3N36A 1W6MB 2DCZA 4GWMA 3OJBA 3W20A 1RUG1 2GD4A 5FJHA 4YW3A 2BOHA 3HBKA 4BWOA 1DQ1A 5LW9A 4YGCA 2JG8A 2VVDA 2JKBA 1HJ7A 5ANNA 3AX4A 2Z42A 1QXRA 2PHRA 4NPMA 4ARXA 3U0ZA 3VHPA 1MZEA 4ISQA 1RUD1 4P9GA 1KS4A 1Z0HA 3MW4A 1D4M1 4A2UA 2W3KB 4I02A 3P3PA 3JBG1 4RS5A 4JYVL 4FTSA 3LN0A 1H6XA 5JSPA 4QPGC 3P5BL 1QMJA 4HKLA 4BPZA 4CUGA 1NFWB 1F7EA 1R1ZA 3D82A 1ZZ9A 1AUTL 1DGWX 2VTXA 1XJAA 2XMLA 3C7OA 5GLWA 1RHI3 1VJ2A 2VCCA 2FLBL 3HD8B 2HWD1 3MBWA 3BB6A 1EGFA 5DAXA 1VRH2 1VP6A 4JC1A 4BJ0A 1OHFA 4QT6A 3FX3A 4OHVA 4RS0A 4A45A 4ZH8B 4BDWA 1FNYA 2JXAA 3H3LA 2WFF2 1UY3A 3TAYA 3MDLA 4RR3A 4PHZA 1C5MF 4Q0QA 5IUQA 2A75A 4CVUA 1NY71 2VUCA 4Q4W2 3H7YA 5KC6A 4COXA 1VPHA 2Y6JA 2EF6A 2NM1A 1KRIA 4U36A 2P4EA 3LDRA 2Q1JB 1PM4A 4DXSA 5A7WB 1PIV2 3LPGA 4AZZA 1APOA 4JRLA 4BQ4A 4Q0SA 4PQQA 4Y22B 1F0SB 1NA1A 2RDQA 1ZZBA 1LOAA 3D5OA 4JCKA 4NWVA 3C7HA 3RMYA 1NAEA 2QE3A 4H7MA 4G9SB 2XBYL 4HFSA 4XFCA 3J7MA 1NCQB 1GP6A 4NG9L 5A3WA 4BDXA 5EWSA 2MHPA 3SISA 5C6CA 5FY4A 1S4CA 4GJYA 4GWJA 1ATAA 3RZZA 2V4AA 1LQDA 5JBAE 2G9ZA 4YW2A 1QJX1 3W9AA 1CWPA 4YW5A 3FUQA 4E4DX 2NQYA 5A1AA 2A6XA 2W47A 3U73A 2QKDA 3AP9A 2BTVC 4RGKA 3V65A 1UOBA 4AI0A 1Y9QA 3E5UA 3KCCA 4EQVA 2ET1A 4YLZA 2C9KA 2BERA 1KLJL 2DUPA 5KHHA 4BM8A 5J96B 2QQKA 2I74A 3NTBA 1H8TA 2W1SA 4BIOA 2UURA 4MGQA 4Q4X2 1VBD1 1JS9A 3CJIC 4FAGA 4BQ2A 3C3VA 4COZA 2YGMA 5TSWA 1N47A 2CYFA 1S1AA 3TK6B 2HWD3 3ZSMA 4UFKA 3U14A 2PAKA 2VTFA 1VBD3 3AYCA 3N9OA 3N8VA 1U5IA 1X33A 2Y6FA 2WNVB 1Z6EL 3PMSA 3ZYFA 1Q8SA 1A8DA 1N7DA 2ARBA 4Y5TA 5IW0A 1TPGA 1KDKA 1VBB1 4OQ9A 1JZ8A 3WF1A 2FLRL 4UW4A 2YYOA 1BVVA 4CDUA 3R05A 4ZXXL 4Q4X3 4Q27A 3NL1A 2A7AA 4NJ4A 3WG3A 2ES3A 3LF7A 4ZY9A 3ZM8A 1JHNA 2O0OA 3C7FA 2GNTA 2QZ2A 4AHXA 1BK1A 4AGGA 1FYUA 5JBCE 4NIAA 1XYPA 3LAGA 1VR3A 2JDKA 4NAOA 4XF3A 4XXPA 4B1LA 4E2QA 1IOAA 1CVUA 2P95L 5I46L 2OS2A 2C5DA 3KS7A 4LIUA 4ORFA 1SFNA 2IUWA 3AXEA 1UZJA 1DX5I 2X29A 4AQSA 4XCAA 1JI6A 4J1WA 4QX5A 4XJZA 1OC1A 5LA9A 3RDIA 3VKNA 4BZ4A 3JXSA 5A6ZA 1BBT3 2VMDA 4YZ2A 1ND2C 1V6KA 1RUJ2 4X8NA 1FXZA 2WWJA 1SLBA 3PVNA 2UWOB 1PO21 5FYUA 3VD7A 2P3JA 2VXJA 3RWNA 5IKTA 4B1MA 2W68A 4YVSA 4D7YA 2MHFA 3U78A 3IKWA 1EAIC 3MGUA 4LKDA 4IXLA 4HVQA 1HV1A 4YVWA 1RVF1 4H3WA 3CKHA 1L7LA 3I2DA 3AP7A 2ZGRA 3F1SB 2HYKA 5DUVA 3OY8B 1DYKA 4FOWA 2E31A 3VDDB 4P9IA 4YRDA 2G4IA 5JOZA 2CU5A 1OKOA 1W3VA 1ULDA 2NMOA 4LXLA 3SOVA 4MYEA 4OHWA 4PLNA 3WDYA 3OLUA 3WVJA 1DG6A 3CENL 3FLPA 1LPZA 5FK8A 1Z7S2 3B93A 1N3QA 5HCAA 1OA4A 3O1RA 4OHXA 1G2LB 4CP1A 5HV0A 1AYN3 3MQEA 4TGFA 1OT5A 1UZKA 1AXKA 5BUVA 1AR83 3ELNA 3POSA 2WA4A 4N9IA 1UXZA 5F9TA 2WNVC 1TQ5A 3R4DB 3OB8A 1F5FA 2V5YA 5GZEA 1RJ7A 5APAA 3ZLIA 2WNUA 1LHNA 5JW1A 5C4WB 1SLIA 2E26A 3KT7A 1GV9A 4J25A 5E88A 3AK0A 1W6QA 4LR4A 4RHV3 5FZ6A 4DXZA 1RUC2 3N8WA 1W39A 2PR3B 3D0SA 1POV3 3JQXA 2WA3A 2BFUL 2YU1A 1AJOA 2YGQA 1JHJA 4GALA 4JZDL 2OA2A 3MDPA 1TME1 5C9AC 4Q29A 5DG2A 1MS9A 4OYUA 3RI8A 4QDQA 3AFKA 3THPA 3WQBA 5JAXA 4N43C 2P34A 3QH7A 4AEDA 4OTJA 3RRDA 2P93L 3IM0A 1AR63 3ZVXA 5FZ9A 2FDJA 2P6HA 3MIGA 1EY2A 3M36L 2VVFA 3A22A 5IVFA 3LKJA 4D6SA 2ID4A 3ZFEA 3ME2A 4PDWB 4CU6A 3IDBB 2G9GA 3OD0A 1J3RA 3PTRB 3AFGA 4Q26A 3AZXA 1UY0A 4NIIA 1HRFA 2JDZA 3JD73 3HT1A 1UKRA 5HCFA 4JHZA 4HK9A 4XXAA 1DVAL 3ES4A 4ZU7A 2RDNA 3MEPA 3QD6A 3FE5A 5I0DA 2C9AA 2W52A 2JG8C 4MO3M 2BZ6L 4XUNA 1V1HA 1LR5A 3T4VA 3WP6A 5IVYA 3ZFFA 4CEYB 5A6QA 2OYZA 3B01A 1C8M1 1UPSA 3ACHA 2CDOA 1CPNA 2JG9C 2ZHNA 3KQBL 3AL5A 4UFIA 4XIKA 4AHYA 3AMNA 4XPVA 2WT2A 1X7AL 4I0AA 3OYWB 5ACA1 5DUUA 2VWOL 5JOWA 4D7TA 5L9VA 2UY9A 4I0WB 3TN91 1HT5A 1WD3A 2QQPA 3UV9A 5C71A 1MVQA 5CU1A 1LMMA 1V9U2 2YZ4A 3KVBA 1GR3A 1OSGA 2TNFA 2Y82B 4N53B 4B7KA 2CAVA 2Z5WA 1EAH1 3QOPA 5L36A 3T0DA 3R4UA 1WKYA 3I59A 1JZ7A 1LPGA 2G19A 2OZ6A 5D1IA 2VMGA 3TNPB 5A1LA 3GCWA 3NRUA 3P1IA 3H42B 4ZHNA 2K2TA 1R1A2 1EAH3 1WCUA 1DU3D 1ULOA 4QKNA 1LENA 4DS0A 4EE2A 2PUQL 2DVFA 4WZCA 1X8MA 5C4WC 2XLFA 1WHEA 3ZFGB 1JUHA 3VDAA 1W9SA 3NAPC 3WHTA 1S2EA 1KLOA 5DDJ2 1EV12 1Q8PA 3VDBA 4FAHA 3BT1A 2DBNA 5GZFA 4AVTA 3IDCB 4GH4B 2VR4A 5LBEA 4NIGA 3OY8A 3VBOA 1X7NA 1OOPC 3WNMA 3LEIA 5FMCA 4KQ7A 2Q8CA 5LCWL 5IK8A 4UWDA 4P02B 5ANQA 2D40A 2R071 1MOXC 1JZ5A 4A4AA 1LEMA 4Q0UA 3TEYA 4A3XA 1OQEA 4HK8A 4MG2A 1Y9MA 1GZWB 4NN0A 4W8JA 4TWTA 1G1TA 5I8YA 4OVEA 2EIDA 2MEV3 1SBFA 3E5XA 4NPRA 1GU3A 1XYOA 2HWD2 3LE0A 3Q8CA 5IAVA 3KGZA 3GCWE 1BBT1 3AB0A 4AFDA 4PH9A 1PMJX 5CFDA 1G1QA 1JODA 3NNFA 1UD1A 4COUA 1PO11 2EI6B 2MGPA 4FO9A 1G9BA 4XQWA 2FDHA 4IV3C 5CZKA 2XL9A 1JYCA 4IEXA 5FQ0B 3TN93 4GWIA 5CADA 3SOBB 3ELAL 2YPJA 4KGQA 5J09A 3BTYA 2W39A 4HT1T 4HSJA 4KL1A 4EN6B 5C8CA 4LLFA 4AVVA 2FCVA 5FV3A 2VM9A 1ZX5A 1HRI2 2XH6A 1GWMA 1ZBA1 2DFBA 2Y6HA 4HN0A 2YC0A 1HB2A 1CJPA 2EA7A 2GDFA 4UBGA 1D4VB 2H0BA 1IOEL 4JGZA 2D7FA 6COXA 5A6YA 2OUHA 3T0AA 4Q0VA 4XOGA 4DY5A 3D8CA 1XNCA 4YNIA 1OH4A 1J9CL 3WG1A 1H9WA 2RM23 3N9LA 5A7WA 4PBPA 1QJU2 3HO5A 3ZFEB 5LA0A 2XC5L 3T2PA 2YPDA 5C7GA 5FPBA 2RDRA 5FZFA 2JE9A 4QU1A 3RWKX 2KD7A 2GSYA 1KGYA 3CJIB 5DPNA 3VHRA 2FZ2A 3IT8A 4CU7A 2K46A 2XQRA 1H8TB 1C8M2 1C5HA 2WG3C 1JYTA 4V2VA 3QBQA 1MS1A 2WYJB 1FPN2 3PVOA 4IETA 4N43A 1MQ5L 3KWVA 1VBE2 5A6XA 4MLOA 1MQTC 3I7DA 5IYYA 3LN1A 1COV1 2YU2A 2Z2SB 4HOOA 2BOJA 5F3IA 2BQ7A 2Y5GL 4QGLA 3MV11 5AC92 2FHRA 1VRH1 4HN1A 5DN2A 1RUH1 2VCAA 3E6DA 3UKTA 3C7GA 3H8RA 3ZSKA 2CWSA 1RMU1 3SKJE 1ALYA 3RZHA 3MICA 1NFYB 1WCDJ 1YJLA 1HQLA 4D6RA 2P28B 1O3RA 5DUWA 1PZ8A 5F2SA 2UWLB 3HQRA 4BU2A 4CDQC 1SBEA 3RZKA 4OUEA 3U1XA 3ENSA 2E9QA 3IN9A 4QX8A 4RQPA 2WZR2 3OGJA 4B29A 1GBGA 1OXCA 2YB7A 1J1LA 1CZVA 2UYAA 2JJLA 4O65A 2J1TA 4LA2A 2YGOA 1ND2B 4QDSA 5DAWA 4ZU4A 3ACIA 1GOFA 3RG0A 3POWA 3JCIA 4F7ZA 3N7MA 1VLNA 5C9AB 1ZZ8A 3WLUA 1WW4A 1C1LA 1PO13 4B4RA 1JZ4A 2B5HA 4XDQA 1V9U3 3VHNA 1KIGL 2BZDA 2VU9A 3M3CA 5JOXA 4BE3A 2JE7A 2WNEA 2KR2A 1CX2A 2A3YA 3M3EA 4HMZA 2AZ5A 5DDJ3 3VBFB 1UZ0A 2GC2A 4PQ9A 3K9XA 5KHKA 5LRSA 1T6GC 3PJQA 4OHYA 3OGSA 3DF0A 1AL21 1DF0A 1FV3A 4M0NA 4NRPA 4P00B 3KZ4C 4XYXA 2P3FN 3CNAA 1S2KA 2RS11 3EJKA 2QDRA 1AR92 1QXJA 4ZONA 4SBVA 4OI2A 3RVHA 5BNPA 2HWB2 1A3KA 5EZWA 5F7UA 4MZUA 1BBT2 3H0OA 5D2AA 1EAH2 3VD3A 4AFAA 1CVNA 1QEXA 3KD4A 4AQ2A 4Q2FA 5G04L 1E5HA 1KSNB 2XKOA 5FY8A 1W6MA 4E2SA 2B39A 5L2YL 2OUJA 3KQEL 1HQNA 3WF2A 5LZ6A 3PHMA 1SFYA 2OT7A 3LIHA 1HKDA 1W05A 5FQ0A 1QOOA 1YIPA 5C8WA 1YXWA 2YG0A 3B9CA 1REDA 4XILA 1S0IA 1FMD2 3NNMA 4RS5B 3IAPA 2B4KA 4FP3A 2D97A 2JE8A 1VBC2 4FVVA 2O14A 3KM5A 4QQOA 5FZ0A 1XRUA 1XDTR 1UU6A 1OLQA 4YSFA 4N9HA 2WNOA 1BHGA 4FXKB 4AI9A 5BY5A 3K3OA 1I6XA 2YBPA 1GQGA 5GZDA 4CDQB 1I0UA 4L11A 2Y7ZB 4FOVA 1HCGB 2ZGMA 2F17A 2ZA9A 3NNLA 1QQP2 2EI7B 1V70A 1CR7A 1NUKA 3FN9A 3I2KA 4AVSA 3OTFA 3WG4A 5A3MA 4AGVA 2V73A 3CJIA 4W6XA 1W8OA 4YVWC 5C4WA 5SV8A 4GMP1 1QF3A 2ZHMA 3I3QA 2RMU1 4FI9A 3H8OA 1UCXA 5FPZA 3GBGA 5CKQA 4TN7A 1O3QA 3ETQA 4K7JA 3TYJA 4Q8KA 3KV5A 4RD7A 1UO9A 5I8SA 1GFF2 5FYTA 5I0SA 2H9EL 5F37A 5ABJA 1T6BX 2A6YA 3O12A 2W3JA 3LFIA 4AEJA 1IJQA 1ULGA 1SCSA 1GQHA 2HEYF 3FBYA 3SEPA 1AR71 1FE2A 3LOIA 1DQ0A 2R30A 1OURA 2Q1ZB 4Q1PA 4A94C 4YGBA 5JVYA 1C28A 1G9CA 5GKAC 2PHWA 2Z79A 2JG9A 1OVSA 3ZYPA 4BXWA 1IHMA 3OOXA 2CY6A 5DG1A 2XUMA 1QY4A 2GH8A 2WZEA 3UNPA 4LKEA 2VE1A 2HEWF 1MQTA 3OPTA 4AW7A 2CWMA 2TGFA 2WC2A 4AR2A 3AZYA 3EMRA 2VNGA 4NHLA 3T1LA 2KA3A 1WLDA 5JR2A 5GM0A 3I3MA 1WW6A 1B35C 5F5QA 2ATFA 2X5IB 3AVRA 3K3NA 3EB7A 2AEYA 2QCSB 3Q8EA 4FCAA 2WN3A 4CTEA 4JKKA 4EWEA 1UF2C 1WZXA 1CQ9A 2C26A 2PMWB 1RUC3 4X8TL 1WW5A 2PFWA 2WZR3 1CJDA 2AEZA 2MPFA 3AMMA 4FFFA 2W46A 1PVC2 1VBA2 2JECA 2ZGLA 5JSOA 4AVCA 2D43A 1AX1A 1AYM2 4OCTA 2YROA 1RXGA 2JICA 3S7IA 1J3PA 1OF4A 1VMHA 2ZGUA 4F83A 1RVF2 2V09A 3BOPA 1TZOA 1SLAA 1TME2 3NNGA 5IKRA 3KV6A 2FDGA 4J6GA 5F2WA 5H9RA 3QACA 4KG0A 1PO22 2YHJA 2EVXA 3PDQA 4UAPA 1RMU3 5FBZA 4MGKE 2RVAA 2OIIA 4P9JA 3ZSLA 4AYUA 1URXA 4BK5A 4YW6A 3N8ZA 1ZA4A 2P3FL 2QQMA 2VGDA 3KCXA 4COWA 1OI6A 3QMOA 4BXSA 3R4SA 1BZWA 1OQDA 3AKPA 2QNKA 2CL2A 3LGRA 3AJYA 5DUXA 3LEMA 5LBCA 1NFXB 2YBSA 2P3UA 2VW0A 3O1VA 2V4VA 2BOUA 4UW5A 1NXMA 5LRRA 1HRV2 2DTYA 1D7PM 3EHKA 1JYIA 3CQOA 1DGRN 5FYSA 2KXLA 2EXIA 3POJA 1BMV2 3BKZA 1EP0A 4GMP3 4U2AA 1ZNPA 5B4NA 4GU4A 1KFXL 5IT6A 1E5RA 1ND3C 2VQUA 3L2HA 3CIHA 3GZUC 1JTZX 4XFFA 2BVVA 2WLPA 3DL3A 3DPRC 4LHLA 4AXOA 4XF1A 4P5YA 1KQRA 5T5JA 1Q56A 3MW3A 4PCRA 4AE2A 5B2GB 3W5MA 2YGLA 1UU5A 3W21A 4CCDA 1IQIL 4Y1YA 4GULA 4KI5M 3MLKA 3ZFEC 5EYXA 2UWBA 3S57A 3SCGA 1NCRA 1VRBA 1EPZA 2ZGPA 1LOFA 2WAOA 3Q9OA 5T50A 3NKGA 3ETPA 5I0UA 2ZHLA 3G6JB 1VBD2 3OGVA 4QQ2A 4XQ4A 1UZWA 3BPSE 3SCHA 4KGGA 3THTA 4AVBA 5JUVA 4BQXA 1RJ8A 2UU8A 5I8TA 3KQCL 4IGPA 4YPJA 3POFA 4CCMA 4LTAA 2TEPA 4YZ4A 1W8TA 4FPKA 4XUQA 1I5PA 1UYXA 1ASJ2 4CDXA 2R061 4EZHA 3GZAA 1Z78A 4IV1B 2E6VA 3LB9A 2AREA 1HRI1 4XUTA 3EYPA 1NQLB 3CEWA 4WZFA 5EJ3A 1OFSA 1JBUL 1QJX2 1PVC1 1VBA1 2XJVA 3LSDA 3B02A 2EI8B 4AFMA 1REEA 4LNVA 5C70A 1RUD3 1HN0A 1RUF3 5FKCA 3W59A 2RR12 1LK9A 3Q8AA 4NVPA 2PHXA 1DIWA 2LALA 3T08A 4M10A 1IS4A 2ARCA 2D6LX 1PGW1 3POYA 4ES8A 1UOGA 4JYUL 3GJAA 4URTA 3MIBA 1AR82 5C3RA 5T55A 5DMYA 5KWRA 1PIV1 4QPWA 3DKQA 2XHKA 1YHFA 3EGFA 2C24A 1RC6A 4Q5OA 1MQTB 2EAAA 4EN8B 5E89A 4Q4X1 5FXVA 4RHV1 5KBFA 1MS5A 4PF1A 4FPCA 2XHNA 4Y5Z0 2OVUA 4YG0A 1X50A 2WFF3 5FZOB 3ZMNA 2JD4A 2X10A 4YM2A 4XUOA 3SXWA 4DPNA 3V0BA 3ZOIA 4E1GA 5BNOB 3ILRA 1C5IA 2D44A 4TLFA 4P5HA 3AZVA 1APQA 1PK6B 2XQXA 1PVXA 4Y79B 1BCXA 1QQP1 4IEVA 4YG6A 3VKLA 2W1UA 4IW3A 2WO3A 1YUKB 1EPIA 1UL9A 4MUVA 3WT3A 5C33A 3KMHA 3ZYHA 1R091 5L7OB 2ORXA 1HIXA 4FPOB 4C1XA 1FNZA 3WR0A 1F35A 2KL7A 4XTMA 1IS3A 1JYVA 3RZLA 1IKQA 1WLCA 2DF7A 1PX3A 1UU4A 3HNMA 4QQPA 1SMVA 3BI3A 3SITA 5F3EA 2BVBA 2UYBA 1ZBA3 1RVF3 2A73B 1C3HA 2CJIB 2GP3A 3LTFB 1ASJ1 1KFUL 4Y1VA 1IVOC 2XG3A 4IEZA 1ADXA 4RRZA 2D3RA 1HJGA 2E33A 3RI9A 2IXHA 5KR7A 1W28A 1ZAQA 1C8M3 4N7IA 4O9EA 1UY1A 3ZX7A 1LEDA 2JDMA 3NJXA 2PELA 4X8SL 1PRHA 1LU1A 2HWE2 2I9AA 2GN7A 1CCVA 3NSTA 1R082 3MFAA 4OMDA 5FLHA 2CHHA 3APBA 1QDOA 4JAAA 3WEZA 3WUCA 4DZGA 1DIYA 1Z6CA 1STMA 2BV4A 1RHI2 4JQRA 4ASKA 4TZDA 3OF1A 4YM1A 4QHBA 5FPVA 1NY72 5CG9A 1QOSA 4BQWA 4V1PA 2RS32 2XBO2 5LASA 3SH5A 3WXPA 5CG8A 1RUOA 2O1QA 2H9EC 1VMJA 1YQCA 4WM7C 3NMBA 5C3SA 1UZYA 5C5UA 1ZREA 4UBHA 3CO2A 2GU9A 1IKPA 1DDLA 4E4SA 3DKWA 3H1MA 5FOBB 1CD3G 3B5LB 4EV0A 3CU7A 1IOXA 5FUPA 1EPGA 4QX1A 4YM0A 1RUE1 4EYUA 1CCFA 3BIEA 1RGSA 1RFNB 2NPIA 1CAXB 3P6BA 2AUYA 1GOGA 4ET7A 1MS8A 5FZ3A 5K0UC 4P9LA 4MHUA 4NE9A 3S6PA 4W50A 4CXWA 2BT7A 2FLGA 2ILMA 4LBNA 1EUUA 3ASIA 5AFEA 1EV13 2ZGNA 2A6WA 1O5UA 2VUDA 1F7MA 4WM8A 5EPAA 1KD7A 3ZXDA 4DFSA 4FOYA 5L9RA 2K2SA 2RS52 2W1QA 1UZQA 2XL7A 1Y3TA 2Z69A 1JH5A 3IB3A 4AEDB 1SBDA 3RSJA 2WAAA 4N90A 4DY3A 2BGPA 1N1VA 2DVBA 1DQ2A 3P3NA 2VJXA 3A23A 1X9TA 3WDTA 1I9RA 4NOTA 2BJSA 1OBNA 1G8WA 4QAWA 1R093 4M3CE 4OLLA 4W4ZA 1W8HA 1QJX3 4S2DA 3GNEA 5FAXA 1RUH2 2SLIA 1S0JA 4UI9L 2LW8A 1XNBA 1Z7S1 1KJRA 4HLTA 4D7SA 4QU2A 3WQ7A 1WWYA 3UYJA 1JYXA 4LK6A 3R6SA 4XCBA 4Y1XA 3ZKYA 4YZ1A 2W92A 2JIJA 2WQ4A 4XIOA 1U5YA 2LROA 4MVTA 1YO8A 3PIGA 5K4LA 4KU8A 4NWWA 3IMMA 2JG9B 1N3OA 1TNRA 5AVAA 1ZBE3 1C8NA 4M00A 1PGL2 1MEC1 4NAMA 2JDNA 2FCUA 5DABA 2HBUA 3ZFGA 1YYNA 2D1JB 1IZ3A 3N7JA 4OZXA 5ABJC 5ABJB 3MYXA 1UIJA 2GMMA 2D6NA 2B8MA 3OPWA 4ZXKA 1I3HA 2KNIA 3ORJA 1UMHA 2VMIA 2P37A 3RR3A 3GISX 2DBIA 1NCRB 3VBSB 3D6EA 1H2MA 2JDPA 1SZBA 3EBRA 1O5DL 2OXBA 4GJZA 3UKNA 3PIJA 3N9PA 5FLIA 4CCNA 4BMEA 2BWAA 1IQGL 4ZHAB 2B9VA 4LK7A 5T5LA 1J1TA 2QZ3A 3ZYJB 1YUGA 2XJQA 2VWLL 3RJ2X 1H2NA 3MLJA 1W2OA 3POEA 1G1RA 4BK4A 1DYOA 3B3QE 4OUMA 5BNNA 1O3TA 1AYM1 1W2NA 4MGZE 1S0CA 2J38B 2WPIE 3BTAA 2P3YA 3AYAA 3HR9A 4GB31 4CUAA 1Q4GA 5JR7B 1XB9A 2F6BA 2BNMA 4A7ZA 1YCIA 5KXBA 1ZBA2 4H7LA 2VW2A 2E7QA 1W6NA 3O0WA 4GZ9A 2Y81B 1NA1C 5FZAA 3S5QA 1FAYA 2WO1A 3SCFA 4IEYA 3HQXA 2BT8A 5KN5C 3CA7A 2OPWA 1XFEA 3ZYRA 1VBC1 1E57A 1Y9GA 4QGNA 3WW1A 3DGTA 3JU9A 1GNZA 3D4KA 2YXSA 2KM2A 3H50A 5ACA3 5BXXA 3TGFA 5D8AA 4JDOA 1W8ZA 3LA7A 4QX0A 1XSRA 2HWC3 1LHUA 1WMEA 4Y24A 1WA6X 3B94A 4XHBA 5K0UB 1AR72 3AKRA 2DCKA 4QGMA 1N1SA 4Y3OA 1ZA7A 3KV4A 2EXJA 1IS5A 2JEMA 3DYPA 3VZMA 5FPUA 1EZQB 1WD4A 5GALA 5IFTA 4MSVA 1W3XA 1W9YA 1DZTA 1MEC3 3P5BA 1KS5A 4XE9A 1J3QA 2DU1A 2WT0A 4BLIA 4CUDA 1IPKA 1OOPA 2YFZA 3IMNA 4LA3A 2Q8EA 1GUIA 1AXZA 2GMEA 4CDWB 3O7OA 3WZ1A 3WY6A 2NLRA 5DDJ1 1FT9A 4H2AA 2GNDA 5FMOL 2QQVA 2WO7A 4QWNA 4IQPA 3AKQA 5EQUA 1SPPB 1OPOA 1Q8QA 4M3CF 1R1A1 4A41A 3DXTA 3IIAA 1DFQA 4RRYA 3TWIA 3WD5A 3VBHC 1QNYA 4QQLA 4L8QA 4N43B 2BOIA 3PLQA 3H8UA 1KDMA 3GGLA 3OLTA 5C3PA 5T5OA 2VVCK 3ZDSA 1HAFA 3PUQA 2BYVE 2R062 5LK7B 2HKXA 3ZO0B 1GP4A 4MGIE 1YLLA 3WF3A 1ZVFA 4P9YA 4IV1C 2W2IA 3AP6A 1GYKA 3U07A 1YIFA 2Y7XB 1CAVB 2VZTA 3ZN6B 3CJXA 4Z1VA 4AQTA 2W3IB 2VQTA 3N7LA 4DXTA 2J1RA 2J95B 1W6PA 2XC4L 1P9JA 3V56A 4D94A 1HLCA 1QKQA 3KHBA 3ZXGA 1IQLL 3INAA 2ETEA 4AEKA 5HV4A 4X6QB 5J36A 4Q8LA 5J1XA 1SLCA 4AVAA 3NT1A 2VOXA 2ADXA 3DV8A 2Q4SA 2ZXQA 1K36A 1WMFA 4QKFA 3RPQA 2BOKL 3CBNA 3SH3A 2DVGA 1RUJ3 1SCRA 3KV9A 2MEV2 1WMDA 3PVEA 4BYYA 3ZYIB 5EHDA 1LPKA 1O6UA 2Z4FA 2MNGA 5A3PA 3USUA 4CCCA 1FOD3 1APNA 2FCTA 1K12A 5EV7A 5H9SA 4QB6A 4COVA 1YI9A 3CLPA 1YFWA 2WO2A 3JBG2 4OULA 4CZSA 4MH0E 5F6LB 4L2NA 2D3SA 2BGOA 1F15A 1LECA 5DAVA 2QDNA 4XAEA 3VZOA 1T2XA 1DGLA 2VZ3A 4JZFL 3M1HA 4XF0A 5F6KA 5FUNA 3C7EA 4ZAEB 2WWSA 1LGNA 1O7FA 3E97A 3VKOA 3ABZA 3HS5A 5I91A 3CFWA 4KBZA 1LAJA 1RUF2 4A44A 3KCYA 4CXYA 2YDEA 2VOWA 1PZ7A 2R0HA 3DYMA 3MZHA 4JGYC 5AVPA 4ASMB 5SV5A 1X82A 1H1MA 4UYBA 5H9PA 2QQOA 2VXRA 3WQ1A 4CDXB 3WOGA 3ZIWA 4QHOA 1WHFA 1W0PA 3UESA 3AKSA 2LM3A 4BB3A 5A3NA 4FPJA 1ZBE2 4S2HA 5CFCA 3K4AA 3OSDA 4EJRA 5A7SA 1C4RA 3GDBA 5A3OA 1F5JA 3KHCA 1FFMA 3N8WB 1TEIA 3I49A 2Q0AA 3T4HB 1S0FA 2D6PA 2Y5HL 1VMFA 4M3CA 3AKTA 4QXKA 5L9BA 3MI8A 2W95A 2VMFA 1RB8G 3L2YA 4AGRA 3GCXA 3WCSA 1POV0 3U7UG 1QU0A 1PTHA 2HWF1 3PU3A 2VH9A 5E16A 1W0NA 2J94B 1U12A 4Y6DB 3IZOA 4GH4C 2W2ME 4K1YA 3BYWA 4PIYA 4FM5A 1O4YA 3KT4A 4P08A 1W9FA 4BTIA 1ATEA 3VD4A 3V65B 1HAEA 5FZMA 1ULPA 1JOPA 2VBDA 4NRMA 1AL0G 1MR5A 2ARXA 2P2KA 5C5TA 2W5FA 2WFTA 1R081 2AACA 3WQ0A 1QJFA 2QUOA 5EP9A 1G86A 2GNBA 4AF9A 5FK7A 2OZJA 5I0TA 1IQAA 3KB5A 3OG2A 2GZWA 5FMDA 4GWNA 4N8MA 4CUCA 2ZX1A 4K3UA 2D6KA 3ATGA 1UAIA 1HB3A 3F95A 3WW3A 4DMIA 3MHZA 2BMGA 2QQWA 2W94A 2WPJE 1AR73 1UY4A 5F5AA 3HPNA 3AXDA 4XZPA 3SMHA 5CKNA 4N7UA 4UF0B 5J98B 3WDUA 3KRKA 1XOYA 1RITA 3BOWA 3E6BA 5IVJA 4CP9A 1B35A 1JZ2A 5L2ZL 5EJZB 3CS7L 4FT8A 2DFCA 4R4ZA 4AG4A 1BEV3 4C0BA 3V0BB 1OKQA 2XJSA 2NP0A 1XKAL 1F4AA 2LS6A 2Q5TA 4JGYB 4LKSA 5CVRA 1V00A 2VZQA 1YRZA 4XFIA 4AAXA 1WW7A 2D93A 1QGLA 2E51A 4AK3A 4YFZA 2JB4A 4COYA 5JPMB 2VOKA 1GZ9A 4Y26A 1D0GA 5JXIA 1OD5A 1BQPA 3MO4A 5FP4A 5FYHA 4YW7A 4LBLA 1FMD1 1NG0A 1HT8A 5CB7A 2PLV1 2W87A 1IQHL 1O4ZA 2IVJA 2A6ZA 2ZACA 3T2OA 4CDUB 1L5GB 3I2JA 1OMIA 1W2UA 3HJRA 5E1RA 2KB9A 1XC6A 3VUOA 4YZ5A 4UFLA 2BU9A 2BGCA 1V6MA 1QH7A 4LBMA 4LUKA 4NIHA 3T30A 3RFRA 1VALA 3KQ4B 2OW4A 5FBJA 3IIIA 3WUDA 2AENA 2VUAA 3I54A 4QPIB 1RUI1 2AYHA 2DU0A 3W58A 4AI8A 1IQJL 3V64A 3AYEA 1OQ1A 2HWF3 1RUNA 4BH9A 1GZWA 3M37L 3SOQA 1D4M3 1FV2A 3FHIB 3BT2A 1UYYA 2CGNA 2J7MA 2ZKLA 3M7AA 4XJUA 5DAQA 5I93A 1JZ3A 3LOBA 3ACLA 1XBFA 1DQ4A 3AL6A 2C6SA 2PHBB 3OGGA 3T2TA 2R6QA 3HVDA 1PZ9A 5JXJA 5CKMA 4JDNA 1LJ7A 2XWJB 1GWLA 3ES1A 1D2SA 1YFYA 4WVWA 4CCEA 2CTVA 1WLTA 5A3UA 3V0AB 1JYWA 4QX7A 4K1ZA 2ZEZA 1GP5A 5FZDA 3BUCA 3SW2A 4YVWB 4QB1A 4F3JA 5CEHA 2H0VA 2VMEA 3NO8A 4RSUA 2RJKA 1FOD1 3NV4A 4JKLA 5JZGB 3BN6A 4I0BA 2BWCA 4IEQA 1DQBA 1Q5OA 5L19A 4XAAA 3LEKA 2WNUB 1QOTA 4XBMA 2XDVA 3LIWB 2B46X 4IV3B 3TBDA 3LZZA 4AHWA 3HIFA 4CE8A 5LWBA 2E7AA 3MW2A 1MZ5A 5FYZA 4Y4YA 5BNPC 4IE5A 4B4QA 1IQML 4LORA 1AL23 4QD2A 5LBFA 3JQWA 4A7YA 1AYN2 1PGSA 3S30A 3M3OA 2EIBA 3CL1A 3BPSA 4NR1A 4W65A 2RR13 4EZ4A 4ATFA 4XLWA 2E53A 4FFIA 1M1XB 2EALA 2N7GA 1G1SA 4A7IA 4Z92B 2IWGB 1BMV1 2RS12 3N35A 4KG8A 3N8YB 1ATBA 1VBE1 4Q4Y1 1VIWB 2FDKA 3ZXJA 4XFAA 4Y4RA 5AC91 3FHQA 4MXVA 1QWRA 3LPFA 2VZVA 4LBQD 2B42B 2XGXA 3EQEA 3GBFA 3MIFA 2AYLA 1SACA 4IDZA 4PIXA 4XJ8A 2WPKE 5IK5A 4G3YC 2EXKA 3PTYA 1ASJ3 3I2OA 3WW2A 2WG4B 1MACA 3NV3A 4DEVA 2ZKNA 1RUF1 1YUDA 4ISRA 3HEIA 3PL0A 5C8CC 2YBKA 1AJKA 4I3GA 4K8FA 1LTEA 1OH3A 2C4XA 3LEGA 2BO2A 2J4IB 2QQJA 4I01A 2RHPA 1XNDA 4LT5A 1NE6A 3VZLA 3ZR6A 2DTWA 3K2OA 1UX6A 1ZYBA 4OMCA 3RZGA 1WGPA 2JJ6A 3ZPYA 1W2TA 2F9BL 4DB5A 1RINA 5JMOA 3PUAA 5LA2A 2Y26A 3NTGA 4LKFA 4BMBA 2J42A 3MF6A 2WBKA 2Y60A 4MGTA 1EBVA 1R083 2VQ0A 4YWAA 5FTTC 3VL9A 1W04A 4K6BA 5JCTA 1ODMA 2FQPA 1NZIA 2P5BA 4RR3C 1VBB2 4Q4W3 5JLVA 3FLRA 4RYDA 2G1MA 3K4ZA 4KNCA 1F2NA 2Q1FA 4GB33 1HJFA 4H55A 3LCPA 1PO12 2PTMA 4GD4A 3N7KA 4ZXEA 3BIWE 2ZGQA 4R52A 5FY0A 3ZIXA 2VVUL 4O9GA 3EO6A 1GZCA 1LGBA 3D3AA 2XPJA 4XC9A 2JG8B 2H6BA 4RHV2 3VDDC 1YWKA 1CAUA 1NYWA 4QXCA 4TSVA 1AR61 1RL3A 3UK9A 3GHMA 4HONA 4NROA 3K4DA 3U10A 2VWNL 1HQWA 5JZGA 4D0FA 2RS33 2XBO3 1UZZA 2ZS6B 3PMEA 4WBBA 3FFGL 4OZOA 2VTXJ 1W8NA 3OBZA 2WZ8A 1LMJA 2BNNA 2WT1A 1QJEA 4RFRB 5FMBA 1XE8A 2FMDA 3FFZA 3ZSJA 1P0SL 1EPJA 4XBNA 1H4HA 1AUYA 1KEXA 3OBAA 5CISA 5JZGC 2R043 1R092 5D21A 2BQWA 4NHKA 1VBE3 4H14A 2DUQA 4WM7A 3T0BA 3N9MA 4M4PA 3PNAA 2VAUA 4JX0A 4E4ZA 4XMIA 4BHPA 4NHYA 4XMAA 1OUXA 5HCBA 5LEKA 2SBAA 5DAPA 4ARYA 2D3PA 2HH9A 5L7OC 1FJSL 4CEYA 2A3XA 3TEWA 3H1WA 1ST8A 3OBTA 4QPGB 3WCRA 4IV3A 3WX5A 3J7HA 4RFT0 2VZOA 2BQPA 1UYZA 1HW5A 1DLLA 3A0NA 3I3BA 4Y20A 5A7NA 4LPLA 3WP3A 4XDPA 1VAMA 3R0RA 3RQ0A 3ZXAC 1IP0A 3POGA 4L92A 1U5ZA 4XF9A 4ZXYL 1KITA 3JUUA 5IHRA 1CAVA 2C1FA 3ZN6A 5DQ0A 3VKMA 1Y4WA 2D5FA 4CDUC 5FPXA 3RJRA 4ZU5A 1ND3B 1JYNA 3CMGA 4FSJA 1DCSA 4LO4B 1ACCA 3ZFFB 5IWFA 1K37A 5EXOA 3EXUA 3I3EA 4WM8B 4LULA 5CFCB 4IEPA 5IJRA 1QQP3 1W2AX 1REFA 3VBUA 3ST7A 4KWLA 1NT0A 3H9AA 2D6OX 1O8SA 2OKXA 2WDBA 4QXHA 3TK5B 1DZQA 2JD9A 4YT6L 1G9AA 2XKPA 4Z82A 4BOWA 1HRV1 5FYCA 1CGPA 2RV9A 3QH6A 1PX4A 5J37A 3VHOA 1OFNA 3SKVA 2OQ7A 4Q1RA 1DBNA 2ZMLA 1NE4A 2VZ1A 1BJQA 4EN7B 3MUZ1 4QQHA 2WFPA 5FPAA 3TEXA 1AL22 1W03A 1UQXA 3DPRA 1ATDA 3O14A 5D8AC 5A1FA 2UWPB 3Q8FA 4NUBA 5FR3A 4FTBA 2VZSA 2WNVA 4RN5A 3OEBA 1GK5A 3POBA 1UPIA 4KMQA 4A6SA 2VZUA 3OUHA 1NLQA 4XDOA 2O8QA 4B8EA 2WABA 4IE0A 1JN2P 2ZMKA 4FTEA 1XE7A 1H1AA 4X8VL 4GH4A 1MS3A 1OLRA 3NJVA 4IEWA 1KXGA 3OEAA 4RGGA 4K20A 2GC0A 3LDBA 2R041 4KWJA 4Q4Y2 3ZFFC 1G9DA 2RS13 5JPNB 2AGSA 4LUMA 3ZXLA 3NAPB 4RQPB 5F19A 2WWUA 1NLSA 4UT5A 4TXWA 2P3IA 4XFHA 2Y5FL 1ZZ7A 4WV8A 4CU8A 2VOVA 1V6IA 2JDAA 1RXFA 1XNTA 2W26B 3LWCA 4UF0A 5FZCA 2W86A 1GICA 2CSGA 2WUHA 3U4SA 1KKEA 3VBHA 3VZNA 4CEWC 5KHGA 2YFUA 2HEVF 3AJZA 3RS6A 1HX2A 4YGDA 4JRAA 1B09A 3ECQA 1TME3 1VBB3 3NV1A 3N4MA 2VZRA 3OYWA 1IGZA 3LDKA 4QPYA 4L9BA 4YVSB 4PIZA 1LOEA 2NN8A 3CHXA 4OQ8A 4NHMA 1DQ5A 3O1SA 4LJHA 2WLQA 1V3XB 1PIV3 2QTWB 2R0FA 4HVRA 4N53A 4EWDA 3VBOC 4DXRA 5FZHA 5FWEA 1HRV3 3I97A 3UKVA 2ZZJA 4C8DA 5J3UA 2BPA2 1GSLA 3KCGL 4HSLA 2JKHL 2ZEXA 3KF5A 2RS51 3BGAA 3PURA 3DUIA 2P1BA 4DIQA 1LGCA 4YZUB 3M3QA 2IXLA 4F8AA 1VRH3 2J1EA 4EWAA 5J48A 1G9FA 1W8WA 1X9PA 4HANA 2P3TA 1UOFA 2MGRA 3NJPC 1C57A 2WS91 1PO23 4QPIA 3TRSB 3UGHA 1YUFA 3ZKUA 3D0JA 3USUB 2GC3A 2IZWA 5FZBA 1IQFL 2X53S 4JZRA 4HXCA 5F1AA 4QM8A 1DZRA 2QFEA 2QQIA 2WPHE 3IPVA 2Y6GA 4QB2A 5CFCC 3K46A 5FYBA 4ZPIA 3WINE 4AI1A 2XBXL 2XC0L 2PLV2 3N8XA 4NGAL 1EMNA 2VOTA 2XJPA 2XJRA 1F0RB 2HYXA 1VAVA 2XVLA 4JGYA 4IV1A 1W6OA 4OTYA 1YEWA 1SLLA 3I2GA 1N1IA 3JD72 3KVAA 4MXWA 5FY1A 3AP5A 3VBUB 1CESA 3NKTA 1GKBA 5K0UA 4C16A 1ENRA 1UYPA 4D0EA 4XUPA 4ATEA 2FZ1A 2Q1MA 3LIGA 4FOQA 4RL7A 3WSOA 3VD9A 3OPZA 3H8XA 5IVEA 3PVBB 4Z07A 4CEWB 1XSQA 4X8UL 4Z2WA 2IXIA 3LA3A 3AVSA 1IG0A 1LKNA 4EN9B 1OD3A 4DUXA 1F31A 4O02B 4GA9A 2PAMA 1LODA 1MQ6L 1RUG3 4QMAA 4C0HA 4GIQA 2OYEP 2R072 2RMU2 3NAPA 3A0KA 4AEMA 2QQUA 1Q8VA 3SH4A 3GALA 1J59A 1SPPA 1MVEA 1WCSA 2P26A 1AX2A 3HO3A 1LHWA 1ND2A 2I2SA 3GJBA 4WVMA 2VULA 3OUJA 2ZOEB 4ISHL 5L30L 1YQ5A 1DHKB 4MOAA 1DGRA 3VBHB 5BYNA 3HQUA 3NW4A 1K5MB 4KWKA 2DWRA 1MZ6A 4XL1A 4HPKA 4WM7B 2RDSA 5FO9B 1U0AA 5B4XA 3ZXFA 3WF0A 2WS92 4UOJA 2A71A 3M2MA 1DDXA 4ZS2A 5GLZA 1FATA 3HBZA 2BOXA 5HXVA 4PDWC 1JL9A 2W2PE 2BP6A 1S0DA 1HREA 1RIRA 2X5IA 2ZJCA 4LOTA 3IDAA 4Y1ZA 2YUEA 3UGFA 2PYTA 4AHZA 5L7OA 1H2LA 2A70A 1OLME 3S0MA 1PGL1 4LE3A 1V9U1 3LQCA 4S2FA 1GANA 2V5DA 3AP4A 3ILNA 3KK6A 2VZPA 3MUY1 4FQ4A 4RR3B 3RYKA 1VBC3 2V72A 5KHJA 3AMPA 5BNQA 1D0HA 2HWB1 4CUFA 2O8OA 1QIQA 1ULCA 3WNLA 5HXMA 3AM2A 4YW1A 5FP7A 1AR91 5A70A 1V0AA 2IFRA 3CZJA 3IBMA 1BYHA 1NQJA 1QJY2 3MIEA 5DZEA 5FUIA 2WL1A 4KU7A 2YV8A 2QJVA 4CP9B 5A7QA 2Q30A 3SQOA 4Y5SA 3ZFGC 4B3NA 3TH3L 3JB4C 1EUTA 4PJYA 2Q8DA 4QX2A 4AEDC 5LA1A 4CCOA 1VAKA 5CAZA 3ZXEA 1IGOA 3ALQA 1O4TA 4URAA 4BQ3A 3TNQA 1ENSA 5F1RA 1AF9A 4AI2A
chains in the Genus database with same CATH topology
1BEV1 2CAUA 4WVZA 3DPRB 1HDKA 3M3IA 4B7EA 4DRRA 1I1EA 1L3JA 4RGAA 1IS6A 3JZVA 4D69A 2ZAAA 4MV2A 3VN4A 1PXXA 2HWC2 1N1TA 5CFDB 4QPIC 1RUC1 2WKKA 3J26N 5JWPA 1COUA 5KXCA 2VVVL 5KXEA 4RUTA 2JENA 1EYBA 4OFGA 4MMYB 2Y80B 1ENXA 5BV6A 1PVC3 1VBA3 1PM7A 2UWCA 5LK5A 4CEYC 4BA6A 3TB0A 3OD4A 3O0XA 3RNSA 3MPBA 2WSUA 5JVVA 1WBFA 4W6WA 5I0RA 2XLAA 1TMF2 1H4GA 1V6NA 1RMU2 4XJAA 4JZEL 5JIUA 2PHTA 4JV4A 4X8PA 4YARA 4WVMB 2HWF2 2MEV1 1W6QB 4Z0KB 2RA0L 1CAWB 1U67A 1JV2B 1RHI1 2OPKA 5JSRA 1GLHA 1S55A 4IESA 2WIIB 4FPYA 1TMF1 3H3UA 4PLMA 4Y20B 2XJTA 1B9WA 2ZX0A 1A78A 2FBEA 5CA6A 4RS5C 4CYDA 4WM8C 1QJU1 4HVOA 2PHLA 2K0GA 3TZIA 1SEFA 4IL7A 4X6RB 1B35B 1JXNA 4LO5B 4EROA 4OUSA 1FOD2 1Q8OA 4XF4A 1M06G 5ACA2 1FF7A 4HETA 3UL2A 4C91A 1RUG2 4PDWA 3QLQA 4R9DA 1AVBA 2GH2A 4FPHA 3VBRC 4Q0PA 4PF5A 4R9CA 1BEV2 5FCCA 2RNLA 4AQ6A 4R9AA 3Q7DA 1IQKL 2BUKA 2D5HA 3HT2A 1WUVA 5CNAA 2ZAHA 4Q4V1 4XHXA 2P16L 1HRI3 3I8TA 1PK6A 1AX0A 4BLJA 2ZGTA 2IXKA 1BVP1 3PGHA 1S0GA 4Y71B 4Q4V3 2VVEA 5K7PA 2P17A 3KSCA 3BPZA 4MMZB 2TUNA 3VL8A 4QM9A 4M01A 4LLOA 1BKZA 3SNMA 4EN0A 1PHMA 5FLJA 5GLUA 3B00A 2WSVA 1V6LA 4BTTA 4XFBA 1ZZCA 4S2GA 5FOJB 5GZGA 5COXA 1RUI3 1ZM1A 3S7EA 1H30A 3FLTA 4CDWC 3C2UA 5DZFA 2HWE1 4QPGA 1G7YA 4RA0A 4BIFA 2IC1A 1LHVA 3N3HA 3HO4A 3FC0A 4Q4V2 1HXS2 2NZ9A 3OCPA 4DNYA 4FXGB 5DZGA 1LOGA 3QCWA 2OYUP 2A5ZA 4TYSA 3KL6B 1JUIA 1EV11 3UJOA 1SQ4A 2PHDA 4B4PA 1UW8A 1O5LA 3MPPG 2ZGOA 2ZPXA 1OPMA 2ZHKA 4CDQA 1CAUB 1XXNA 4D3WA 2VNOA 2DVDA 2RM22 5K8SA 5A32A 4C90A 3M8LA 4BQ1A 4GQ7A 4CP0A 3VBRB 1HXS3 4Y22A 1UIKA 1N3PA 2DCYA 2DURA 1JBCA 3H1YA 3L9JT 4ONUA 5FRAA 3LC5B 3NJZA 1HXS1 1Y43B 2H6CA 4ES9A 2VJ3A 2AH2A 1Z7S3 4N53C 4YG3A 4XBLA 3FBMA 1O3SA 4YFWA 2YGPA 4YM3A 1CAWA 3VBUC 5EYYA 1S0EA 5BNOA 1FSBA 2XWBB 4LO6B 5J7MA 1DGWA 3K48A 2PN5A 1YJKA 1CVWL 1W6OB 2D98A 4R9BA 1XNKA 2ZX2A 1LOFC 2R16A 5AC93 5KIRA 3S6XA 1AR81 4JGZB 4R8HA 1X36A 1IGXA 3B7MA 2PA7A 3H5CB 1PGW2 1H0BA 2WZPP 2CNAA 4OI1A 2FMYA 1NOVA 2Y0OA 4L99A 4P9XA 5KC5A 1LULA 1V6JA 5T52A 1JOJA 4YZ3A 2XB6C 1XYNA 4FP2A 4ZKTB 2ZBJA 1HV0A 5FDQA 1NCQC 1YI7A 5FREA 3IDEA 3SHRA 1PGEA 1RUE3 3WP4A 5JIAA 4XTPA 4K9SA 2CV6A 4K21A 2HWE3 3KQRA 4IEOA 1AYM3 4PLOA 2W2OE 5A33B 1ONAA 2UWAA 1RUE2 2ERFA 3B69A 2VQAA 4FQZA 4NO4A 2I45A 2RMU3 3FFQA 3DN7A 3VLBB 2GMPA 3J8F3 2YMZA 2UY8A 4LHNA 4Y76B 4CSYA 3VV1A 3U11A 2G9FA 3ZMOA 3KQDL 1NA1B 4YW4A 2JX9A 1L3YA 1WCKA 1CPMA 1H8TC 5JI9A 4Z0LA 1K5MA 2XBWL 3KLSA 3IPVB 2CGPA 1UKGA 2IFWA 2ZABA 3VBFC 1WA4A 4LHKA 4M11A 2EAKA 2G00L 1HZ8A 1AHSA 2ZX4A 3HS7A 4RRWA 1LOBA 4GMP0 1LHOA 2RS31 2XBO1 3J8F2 3M4FA 4RQPC 3RYPA 5JOYA 5K0HB 3RYRA 5JDBA 4J1XA 3VBSA 1QNWA 1A8MA 1H2KA 2R042 2RJLA 3J4UH 1FMD3 1FPN1 4AFCA 1D2QA 1ZRRA 2C0ZA 1LRHA 2PHFA 3KGLA 4CEWA 2RM21 4YT7L 2I07B 5L73A 2EXHA 5IKVA 2QVSB 2ZZQA 4Y7AB 2B45X 3J9SA 4HL0A 4OI4A 1YFUA 1FAKL 2BBVA 5LEJA 4ASLA 3LC3B 1ZRFA 4AFBA 2M74A 1F9KA 4LBKA 3X29B 2ET7A 1BF9A 5H9QA 2E7TA 1OA2A 5T3NA 1W7XL 3LA2A 2Y0IA 5GJ6A 4BTUA 2P94L 2DDUA 4IERA 4L97A 4MGYE 1S2BA 1A6CA 1OOPB 4R4XA 3VGIA 1QH6A 3IJEB 4INDA 1HX6A 3OBRA 1RTVA 1U8CB 1QJY3 2ZCWA 4LE4A 4Y1UA 4E27A 4E9KA 3FUOA 3HWJA 3V64C 4CP2A 1JW6A 4UW3A 1NZCA 3TN92 4FPLA 1LOCA 2LUWA 1QJY1 5FO7B 5KXDA 4CUEA 3JD71 1A3PA 1UMZA 1ZZ6A 3LSEA 3HAGA 1YGCL 2D6MA 2AR6A 5BPXA 4FPEA 3B9IA 2VECA 1Q3EA 4SLIA 5HI0A 5BNOC 1H8VA 5JB9E 1TE1B 1PK6C 1NQDA 2F4PA 2RR11 4UXAA 2PQQA 1PFXL 1OA3A 3E5QA 3I4IA 3JB8A 4HKWA 2NYYA 4DOUA 4O1ZA 2WINB 3MIHA 2X8KA 4IEUA 3ZN4A 1ZBE1 2W2QE 3MF9A 4I09A 3ZN5A 3VBSC 5E8DA 2R063 2LTNA 1PNGA 1FPN3 1IQEL 2WPME 1R1A3 2ZMNA 5A32B 3FWEA 3MLLA 2J2UB 1CAXA 4XBQA 5IK7A 3ENRA 3IWZA 2BEOA 3MIDA 2W2NE 3WHUA 1F8VA 4LBQA 3H7JA 3ZYGA 1KJLA 5T5PA 5JB8E 1K5MC 5FDBA 4XFGA 3ROUA 1AR62 4RRXA 1COV3 4I30A 3U4XA 1O91A 4CDWA 1XU1A 2ZX3A 4Y7BB 1RUH3 3C9AC 2B7DL 5JBBE 4AWDA 1MEC2 2RE9A 4WVVA 3FZ3A 1OB1C 1FX5A 2GC1A 2Q8OA 3GZTB 3WDXA 5JMCA 2ZTNA 1UN1A 3NWKA 1AZDA 4YVSC 2R073 1VB2A 1RUD2 2GN3A 2BW8A 1URKA 3BALA 2A3WA 3WDVA 5DXDA 2RS53 1TLEA 5IKQA 4META 1D4M2 4OHZA 2VY0A 5C8CB 3UJQA 4DRVA 4HBNA 4A7KA 1M4WA 2HWC1 3AMQA 4XJWA 4JVAA 1G2MB 2B9UA 3RMXA 2VH6B 1IPJA 1EPWA 3BU7A 4LO7A 4Z8BA 1QFKL 3G7DA 3VZJA 2WS93 4G1MB 1RUJ1 2WPLE 1PNFA 1YNAA 4JTOA 3GBWA 1VB4A 3WG2A 3URFA 4LBOA 4NA9L 4KBBA 3VBRA 3ZXKA 4CDXC 2GAUA 3O5SA 2VWMK 1SLTA 5K9YA 1LCLA 1W0OA 2CGOA 2ZGSA 3GHNA 2W08A 5BNNC 4KH9A 1AYN1 5GLTA 5FO8B 1ENQA 3FMGA 1RUI2 1TNFA 2XBVL 4GXLA 4E2GA 1I5ZA 4MMXB 1AXYA 2FD6A 2A6VA 3VKFC 1ZRDA 2W0XA 1KLIL 1WBLA 1C1FA 1V6OA 2ZGKA 1G6NA 1QXPA 2XLGA 4UW6A 1LU2A 4XW3A 1GNHA 1W6NB 3LTGD 2WNUC 4YYOA 3HN1A 3LAQA 4JGZC 3ZSEA 1POV1 4OI0A 3GF6A 1FAXL 2BNOA 1H9PA 1EQHA 5E8AA 1YFXA 4LMFA 3NVCA 5CBLA 1ZRCA 3MFCA 3HPTA 4C1WA 3GYDA 3SLIA 1W8BL 1NCQA 1ULEA 5AFBA 3K51A 3O0VA 2YY1A 1H1IA 4XEZA 1EQGA 2BQ6A 3DEMA 2ENRA 4I3PA 4M3CB 3PJYA 4HPKB 1TMF3 4LBJA 1J58A 2WQZC 2IXCA 4P9WA 5A33A 4LO8A 1LESA 1WLWA 3HMYA 3FJSA 2VMHA 4LBQB 2R32A 1WU1B 2WJSA 2GALA 5GLVA 3HS6A 1NLRA 1EMOA 1FI2A 4W6YA 3T1MA 3AZWA 3VDDA 2XVGA 5GZCA 2DVAA 1Q43A 5FMOS 1MZFA 2XJUA 3CF6E 1XU2A 1NPEB 1QJU3 1NCRC 2K9ZA 3VBFA 3F6UL 3USSA 4BCUA 2FZZL 2KV4A 4D90A 2R1DA 5BNNB 4Z6AL 1MS0A 1CEJA 2P3KA 5D8AB 4P14A 3TOJA 2R49A 1MS4A 2R1BA 2PLV3 2DV9A 2BFUS 2VUJA 3VBOB 1CQEA 4GKXA 4M0HA 4LEJA 1BXHA 4MX3A 5BNPB 4K40A 2DCJA 1QJZA 2NMNA 4PBOA 4DINB 3WP5A 1XQNA 2VW1A 2X5IC 4FBFA 1ND3A 2J34B 3H3ZA 2DYCA 1U5XA 2GNMA 3JBG3 1LB2A 2B7YA 4GKYA 4DQAA 5FFOC 3KT1A 5IK4A 1CONA 5CFDC 2PAEA 2WZR1 3WV6A 1SDWA 2NPRA 4YGEA 4AI3A 3Q3KB 4FPFA 3WW4A 4HKOA 1XKBA 3FCSB 1UZPA 5EFUA 4HZFA 1TOZA 1CN1A 1QDCA 3M70A 4Q4W1 4XETA 2VPVA 4JTNA 3VZKA 3AYDA 3A4UA 2HJIA 2WFF1 4ISIL 5JVZA 1COV2 1W6PB 3E6CC 4I2OA 3J8F1 5JI7A 1ULFA 2VH0B 3N8YA 5HBAA 4XJ9A 2VG9A 3ILFA 4ITCA 3GCXE 1CIWA 2HWB3 2TBVA 1CX4A 4G4FA 4FPGA 5CIRA 2Y38A 4MXWB 1Y7BA 2K2SB 1IQNL 1AR93 2EIGA 4JDMA 3V0AA 3NV2A 1QHDA 3BCWA 3AMHA 1EPHA 3QH0A 1N1YA 1NXD1 5KHIA 3IITB 2VNRA 5T54A 3WNXA 1PMIA 4XQDA 5EGMB 2I9BA 3BODA 4Q4Y3 3I59B 1DQ6A 2WFXB 2DUOA 2XVKA 2DCTA 2PHUA 5A3LA 2IXJA 1S0BA 3AZZA 1DYPA 4CRQA 1NFUB 2E63A 2WYGB 3WDWA 1X8EA 3N36A 1W6MB 2DCZA 4GWMA 3OJBA 1RUG1 2GD4A 4YW3A 4BWOA 2BOHA 1DQ1A 4YGCA 2JG8A 2VVDA 2JKBA 1HJ7A 3AX4A 2Z42A 1QXRA 2PHRA 3U0ZA 3VHPA 1MZEA 4ISQA 1RUD1 4P9GA 1KS4A 1Z0HA 3MW4A 1D4M1 4A2UA 2W3KB 4I02A 3P3PA 3JBG1 4RS5A 4JYVL 4FTSA 3LN0A 5JSPA 4QPGC 3P5BL 1QMJA 4HKLA 4BPZA 1NFWB 1F7EA 1R1ZA 3D82A 1ZZ9A 1AUTL 1DGWX 5GLWA 1RHI3 1VJ2A 2FLBL 3HD8B 2HWD1 3BB6A 1EGFA 1VRH2 1VP6A 4JC1A 1OHFA 4QT6A 3FX3A 4OHVA 4RS0A 4ZH8B 4BDWA 1FNYA 2JXAA 2WFF2 3TAYA 3MDLA 4RR3A 1C5MF 4Q0QA 5IUQA 2A75A 1NY71 5KC6A 4Q4W2 3H7YA 4COXA 2EF6A 2NM1A 1KRIA 4U36A 2Q1JB 1PIV2 1APOA 4JRLA 4Q0SA 4Y22B 1F0SB 1NA1A 3D5OA 1ZZBA 1LOAA 4JCKA 4NWVA 3RMYA 2QE3A 4H7MA 4G9SB 2XBYL 4HFSA 4XFCA 1NCQB 4NG9L 4BDXA 5EWSA 2MHPA 3SISA 5C6CA 1ATAA 3RZZA 1LQDA 5JBAE 4YW2A 1QJX1 3W9AA 4YW5A 3FUQA 4E4DX 2NQYA 2A6XA 3U73A 2QKDA 3AP9A 2BTVC 3V65A 4AI0A 1Y9QA 3E5UA 3KCCA 2ET1A 4YLZA 1KLJL 2DUPA 5KHHA 4BM8A 5J96B 2I74A 3NTBA 1H8TA 4BIOA 2UURA 4Q4X2 1VBD1 3CJIC 4FAGA 4COZA 3C3VA 2YGMA 5TSWA 1N47A 2CYFA 1S1AA 3TK6B 2HWD3 3ZSMA 2PAKA 1VBD3 3AYCA 3N8VA 1U5IA 1X33A 2WNVB 1Z6EL 3PMSA 1Q8SA 1A8DA 1N7DA 2ARBA 1TPGA 1KDKA 1VBB1 2FLRL 4UW4A 2YYOA 1BVVA 4CDUA 3R05A 4ZXXL 4Q4X3 4Q27A 3NL1A 2A7AA 3WG3A 4AG4A 2ES3A 1JHNA 2O0OA 2GNTA 2QZ2A 4AHXA 1BK1A 4AGGA 1FYUA 5JBCE 1XYPA 3LAGA 1VR3A 4XF3A 4XXPA 4E2QA 1IOAA 1CVUA 2P95L 5I46L 3KS7A 2C5DA 4ORFA 1SFNA 3AXEA 1UZJA 1DX5I 2X29A 4AQSA 4XJZA 4J1WA 4QX5A 3VKNA 3RDIA 4BZ4A 1BBT3 4YZ2A 1ND2C 1V6KA 1RUJ2 4X8NA 1FXZA 1SLBA 3PVNA 2UWOB 1PO21 2P3JA 3RWNA 5IKTA 2W68A 4YVSA 4D7YA 2MHFA 3IKWA 1EAIC 3MGUA 4HVQA 4IXLA 1HV1A 4YVWA 1RVF1 4H3WA 3I2DA 3AP7A 2ZGRA 3F1SB 2HYKA 5DUVA 3OY8B 1DYKA 4FOWA 3VDDB 4P9IA 4YRDA 2G4IA 5JOZA 1ULDA 2NMOA 3SOVA 4MYEA 4OHWA 4PLNA 3WDYA 3OLUA 3WVJA 1DG6A 3CENL 3FLPA 1LPZA 1Z7S2