3ZYJB

Netring1 in complex with ngl1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
330
structure length
326
Chain Sequence
b'YDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFESTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4C
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 63
structure length 326
sequence length 330
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyjB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyjB02
1A3PA 4JZDL 3N8XA 4X8UL 1JL9A 4PLNA 4OTJA 3BPSE 4JYVL 5EGMB 1J9CL 3K9XA 2BQWA 3ZYGA 5IKQA 4Z0LA 4RRXA 2Y82B 2P3FL 1OB1C 2P93L 2ADXA 4AQSA 2RA0L 4XL1A 1UZPA 2K2TA 2MGRA 4ZXYL 1IVOC 2Y80B 3N8ZA 1LQDA 1O5DL 2OYUP 1ATDA 3SOBB 1LMJA 4C16A 2OYEP 1XKBA 1MQ6L 1PXXA 1TLEA 1TPGA 2PR3B 3NTBA 4BTTA 5JB9E 3QCWA 2YGOA 1FSBA 1AUTL 1EPGA 3N8WB 2EI8B 5JBCE 4ISIL 1ZAQA 6COXA 1EZQB 1FJSL 4XBMA 1HAFA 3GCXE 1G1SA 3N8WA 2JKHL 4D0EA 2WPLE 4LMFA 1YO8A 5I46L 5KIRA 2GD4A 1DIYA 1EQHA 2Y38A 3V65B 5CISA 2FLRL 2KV4A 1EAIC 3M37L 2FZZL 3KK6A 2P3FN 2XBXL 1DQBA 1NFXB 2Q1JB 3KRKA 1EPHA 1XFEA 4A7IA 1BF9A 2RNLA 2VWNL 2VH0B 3MDLA 1COUA 3HPTA 1U67A 1MQ5L 2BOXA 4M11A 1FAXL 2F9BL 1CX2A 1HJ7A 2B7DL 2NPRA 3ENSA 2BOUA 1EMOA 3OLTA 3DEMA 4BDXA 4X8VL 1UZKA 4PLMA 3QH0A 1XDTR 2W2PE 3BT1A 1TOZA 2WPIE 4MMXB 2J4IB 2WFXB 1N1IA 3LN1A 2J94B 2BZ6L 2XBWL 3IITB 4ZXXL 1ATEA 2RHPA 3GCWE 2J34B 3LN0A 2J38B 4M10A 1F7EA 5IKRA 2W2QE 1W8BL 3N8VA 1EGFA 2Y5GL 1G1QA 2UWLB 1I0UA 3BT2A 5F19A 1NZIA 2MHPA 2J95B 4Z6AL 4BXWA 4OTYA 4BTIA 5JBAE 3CENL 2XC4L 3FFGL 2W2NE 1ADXA 4JZFL 1WU1B 1EBVA 2D1JB 2BOKL 2P3TA 2P3UA 3F1SB 5JVZA 5KN5C 5K0HB 4OVEA 3KL6B 1CEJA 2Y81B 2UWPB 2W2ME 4CUEA 3FCSB 1IOXA 2PHBB 1HT5A 1N7DA 5IKVA 1NQLB 4Y7AB 3LTFB 2FLGA 1KIGL 3RR3A 2WPKE 4X8SL 4D0FA 3N8YB 1KSNB 1IQHL 1IQIL 2Y5HL 2M74A 3LAQA 1F0SB 3NTGA 2BOHA 2W86A 3N8YA 2XC0L 5E8DA 1L3YA 2P95L 1IQNL 5COXA 4FM5A 2KB9A 1M1XB 3TBDA 4YT7L 2MGPA 3FBYA 1IQLL 1G2MB 4ZAEB 2W26B 4CSYA 1HAEA 1QFKL 1U8CB 4Y7BB 2W3IB 3R05A 1WHEA 4BTUA 3LTGD 2J2UB 2WFTA 5FDQA 2Y5FL 1PGEA 4E1GA 2KL7A 1EPJA 3EGFA 1W7XL 2VWLL 1PRHA 4XLWA 3NT1A 1FAKL 1YGCL 2I9AA 1CQEA 2XBYL 4MMYB 1F7MA 4URTA 1ATAA 3TK5B 1LPZA 2XC5L 2WYGB 2G00L 3LIWB 1LPKA 1UZJA 1V3XB 1APQA 4CUFA 1Z6EL 3SOQA 4ISHL 1K36A 1G2LB 4AQTA 2UWOB 2P26A 1APOA 4NA9L 1G1TA 2BMGA 4JZEL 4YT6L 2VWOL 1K37A 4RRZA 4RUTA 2P94L 3QMOA 3TGFA 1XKAL 3POYA 1IQKL 3GISX 1HCGB 1WHFA 3P5BL 3CS7L 2VVCK 1FFMA 2CJIB 4ZHAB 4Y79B 1CCFA 1IGZA 1HREA 1URKA 1IGXA 2BO2A 1G1RA 2FLBL 1EPIA 1KLJL 4BDWA 1HX2A 3TK6B 1YUGA 2I9BA 1LPGA 1X7AL 5CKMA 1NFUB 1KLOA 1F0RB 4ZH8B 1FF7A 1IP0A 1Q4GA 2YGPA 1FE2A 3ELAL 2Y7XB 3KCGL 3NJPC 3HO5A 1L5GB 1IQEL 1NT0A 1JBUL 3F6UL 1CCVA 1ATBA 4X8TL 1P9JA 4MMZB 3MQEA 3HO4A 2WYJB 1YUFA 3H5CB 3ZYIB 2AYLA 5L30L 4Y71B 2TGFA 1GK5A 5IKTA 5L2YL 1DX5I 4LORA 3Q7DA 2WPJE 4Y6DB 2BQ6A 2XBVL 2P28B 2W2OE 5JB8E 3LC3B 2EI6B 4O02B 3TZIA 3Q3KB 2K2SB 5CKNA 3HO3A 4PH9A 2Y7ZB 3C9AC 4RRYA 1NFYB 1P0SL 3KQEL 4O1ZA 3LC5B 3PGHA 4BXSA 2WPHE 3IJEB 3KQDL 1IQFL 2VVUL 3HS6A 5JBBE 1DVAL 1IJQA 2DDUA 4RRWA 4JYUL 2WG4B 3ZYJB 5JVYA 5CKQA 1RFNB 1KLIL 2PUQL 1CVUA 3M36L 4Z0KB 3KQCL 5F1AA 3HS7A 3SOVA 2VJ3A 1IQML 4PLOA 3CFWA 4TGFA 4COXA 1MOXC 2WPME 5L2ZL 1IQJL 1B9WA 2VH6B 1NFWB 1HZ8A 1C5MF 1NPEB 1EMNA 2P16L 1SZBA 2VWMK 3KQBL 1PFXL 1CVWL 5JW1A 1PTHA 3CA7A 4NGAL 2H9EL 1IOEL 3U73A 3U7UG 3ASIA 2WG3C 2VVVL 1JV2B 4YZUB 1HRFA 2EI7B 3OLUA 3HS5A 1HT8A 4NG9L 2FD6A 4D90A 1EQGA 2BQ7A 3V64C 3SW2A 4RS0A 4CUDA 4G1MB 1UZQA 1IQGL 3TH3L 1Z6CA 4Y76B 2W3KB 1DDXA 1YUKB
chains in the Genus database with same CATH superfamily
1NUKA 5D2AA 1SBDA 2WRAA 2YZ4A 5DN2A 2MHFA 3QBQA 1ACCA 4IV3A 5EGMB 3K9XA 2BGOA 4KMQA 1S0BA 5FZAA 5GLZA 1VBB3 5FY5A 1EAH2 4DEQA 1EAH1 2ETEA 3O5SA 4AFCA 2DU0A 4Z0LA 4RRXA 3PMSA 3QLQA 2CDPA 1GWLA 2Y82B 3ZXLA 5KC6A 4RGAA 3J26N 3KF5A 2P3FL 3TB0A 1CQ9A 2MEV3 1OF4A 3POSA 3BYWA 5FZ1A 2BFUL 3D4KA 4LJHA 2QQIA 4XL1A 3UKTA 3I2OA 2E31A 1I6XA 2BVBA 2H9EC 2RDQA 4YW2A 5EIYB 3HEIA 3WOGA 1Y4WA 1OT5A 1LQDA 4OZOA 3L2YA 4IEQA 2VO5A 1N3QA 1NQDA 1O3TA 1LHNA 1LKNA 3SOBB 4C16A 1FPN2 1FPN1 1RUG2 1XKBA 1RUG1 2GU9A 4RR3C 5I0UA 3TEZA 3Q8AA 2PR3B 1PGSA 2PA7A 3NTBA 5BXXA 2Q1MA 3WW3A 2YC4A 1V0AA 5L9VA 2QFEA 4RSUA 1KXGA 1LOEA 1FSBA 2BUKA 1AUTL 1AVBA 4K7JA 4E4ZA 3BPZA 1UYYA 1W8WA 1S0GA 4ATEA 1B09A 1W03A 3DKWA 5GLUA 5JLVA 3VZJA 5A6ZA 4KWLA 5JXGA 1GQPA 1CAUB 6COXA 4YLZA 3V64A 1D2SA 4LK7A 4XBMA 3PUQA 1S2BA 3WUCA 1J58A 1UQXA 2XMLA 1TEIA 1NA1C 1XSQA 3LFMA 2D5FA 5JZGC 1O3SA 1QXJA 5LBBA 1ULDA 4LMFA 1GP6A 4GU4A 2GZWA 2ZCWA 3FFQA 5FMOL 1BEV3 2D6OX 2Y38A 5FBJA 3VKOA 3N7KA 3WDVA 4MH0E 4FSJA 2AR6A 3APBA 4QX2A 2R49A 1PZ9A 2Z5WA 3PUAA 3IPVA 2JDNA 2KV4A 1G7YA 1ND3B 2EIDA 4JVAA 2FZZL 4P5YA 4UW5A 5T52A 2HWC3 4ASMB 1JHNA 2JG8C 5FZBA 3WW2A 2W08A 4LUMA 5GALA 3V65A 4I01A 2WA3A 3PJQA 2Q8OA 4YYOA 4A7IA 1DQ6A 2VZ1A 1ULFA 3ZSKA 1BF9A 3ZXJA 3DGTA 4EN0A 3BIEA 2ARCA 1EV12 1EV11 4UF0B 3MDLA 2GN3A 3HPTA 1U67A 2A3WA 1MQ5L 4OI4A 4BDVB 3HD8B 5EJ1B 1DF0A 4GXLA 2BOXA 3GJAA 2VQ0A 1FAXL 3JD72 3JD71 2K46A 3CU7A 4J1XA 3U07A 2VUAA 1XE7A 4EN9B 4CCLA 4AAPA 5A6YA 4LPLA 2WSUA 4YG6A 2R0FA 5C4WA 2HWE2 1EMOA 2HWE1 4WZFA 2RS32 2RS31 3OLTA 2V4VA 3WEZA 4M00A 1BXHA 4CEYB 4JDOA 2UYAA 4FFFA 4LK6A 5LA2A 4RR3A 4LOSA 1R64A 4A44A 3AL6A 4BQ1A 3BT1A 1TOZA 1TME2 3WDYA 1TME1 2Z4FA 2J4IB 1D4M2 1PNFA 1SLTA 1D4M1 2GN7A 3WT3A 4YFWA 2PHLA 4KG8A 2DVGA 4AOCA 1JZ6A 2D6KA 2I45A 1HIXA 1KGYA 4CUBA 2P34A 3WP3A 1RUJ3 2ZKNA 1J3QA 4A7YA 3POIA 3U4SA 1C3HA 2QQOA 4NHLA 4Z2AA 5JZGA 3GCWE 1NA1A 1C28A 1OVPA 3BVCA 3DYOA 3NV4A 5FWEA 3PJYA 3N9OA 4KH9A 5J37A 1GR3A 1QJY2 4KU8A 1QJY1 1T6GC 4IEWA 4PJYA 4R9AA 3NNGA 4RHV3 4XQ4A 4YW6A 1JU4A 5FZGA 3IDCB 4QPIC 3WDXA 4NN0A 3E97A 4CUCA 2OW4A 3HBKA 3ILRA 3OJBA 2CDOA 3NAPB 1G9FA 4KG0A 2W2QE 1HB1A 4ZONA 1RC6A 4MGZE 4SLIA 5IHRA 2A1XA 2PQQA 5FDBA 1QJFA 3O7OA 4JKMA 3JB8A 2Q4SA 3ATGA 3I3DA 4E4SA 3MW3A 2X09A 2AYHA 4FXKB 5FUIA 5KHGA 4Y1ZA 2FDGA 2XJVA 3A21A 4ZKTB 1S0FA 2JD9A 3R4UA 1YC61 1ND2C 5FV3A 2MHPA 4BHPA 1APNA 4WM7C 4PBOA 3OEBA 4BXWA 2ET1A 4B8EA 3V0AA 3D0SA 2HWF3 5GLVA 1LENA 4CCKA 4CCMA 4GWIA 1LOCA 1X9PA 3G7DA 1CX4A 2W1QA 3PHMA 5FRAA 3CENL 1HW5A 1KITA 3UL2A 2XC4L 4FPGA 3VL9A 3AFKA 3K4DA 1UAIA 4N43B 1WU1B 3E5QA 5EXOA 1UU4A 4ISQA 2GAUA 4JGYA 4XJ8A 1AL0G 2PAEA 3EHKA 3ILFA 1YUDA 5FZOA 5FZIA 2YC0A 4GMP3 3LEIA 2P3TA 4HT1T 5C3RA 2X29A 1SPPB 2D7FA 2ZABA 4RS5C 4W65A 3TEXA 1PZ7A 3VKFC 3ZXDA 1QH7A 4FOQA 2D44A 4RGKA 4XEZA 1V6OA 2NMOA 2ZZJA 3AP5A 2QBXA 2YB7A 1Q5OA 4MGYE 4OVEA 3THCA 3ZPYA 2VBPA 3MGUA 2UWPB 2W2ME 3S0MA 4IE6A 3ZFFB 3RNSA 1DU3D 5IVVA 5IKVA 4Y7AB 2O14A 2WKKA 5K0UC 2IXLA 3N4MA 1OH3A 3JU9A 2F4PA 2QCSB 4XFAA 2P2KA 4GWJA 2FLGA 2ORZA 1W6PB 2WNVC 3RVHA 4CDQB 4D0FA 1QXRA 5FZ0A 4QPIA 3LA7A 1R083 1NX9A 2RS13 3WG4A 1KDMA 1IQHL 5FTTC 3E6BA 2YGQA 4AQ2A 5ABJB 2XWJB 1US2A 1BKZA 2E7AA 1KS4A 2WAAA 1ZBE3 2D6LX 1AR63 1W3VA 2W86A 4FPLA 3RZGA 1LU1A 3KT7A 4XIOA 1A78A 1ULOA 2R7EB 3SKVA 1XJAA 1ND2A 3MLJA 3TAYA 2VZQA 3TBDA 1DYOA 3R0RA 1AR92 3FBYA 4WM7A 1AR91 5CAZA 1IQLL 1CIYA 3NJVA 3PIJA 4EN8B 1G2MB 2JE8A 4QQPA 5FK8A 1JYNA 2W26B 4CSYA 3E1F1 4MXWB 3IKWA 1WGPA 4R4ZA 2RJLA 1W28A 1YQ5A 1U8CB 5FPXA 4Y7BB 2OZJA 4BE3A 2W3IB 2VJXA 1WHEA 1S2EA 4BTUA 4S2DA 2D40A 2P3YA 2R062 3BPSA 1VMHA 2R061 3ENRA 5C8WA 2Z79A 2XQRA 4RS5A 1U5IA 1SLAA 5A33B 2B9VA 4AYUA 5LA1A 2FDIA 2XLFA 5A32B 4Z07A 3MV01 2VWLL 4L9BA 4XLWA 1OA2A 5T3NA 3NT1A 5FZKA 2H6CA 3K77A 4NHXA 4JKKA 4QPGC 5FP3A 1Q56A 5LBEA 4P9XA 2I9AA 2CHHA 3URFA 2ET7A 2IFWA 1OKOA 3B94A 2VZOA 2OYZA 4YW1A 4N8MA 2XBYL 4MMYB 2BNMA 2XH6A 3RMYA 5KC5A 1YQ8A 2WNVA 1ATAA 4ONUA 4LHSA 5HV0A 2BPA2 4UW4A 2ADDA 4AXOA 3H3ZA 1A34A 3BCWA 2XC5L 4GU3A 2A6YA 2G00L 4BMBA 4DUXA 1XYOA 2RS53 3DF0A 2AGSA 3AKQA 1IG0A 2BFUS 1PX3A 4N53C 4L0PA 4XDQA 1SLBA 5HPOA 4ZZ8A 1DQ5A 1YQ2A 1POV0 2HWB2 2VVEA 3H1WA 2HWB1 3QH7A 4XTMA 4D69A 4DO0A 3SOQA 4B1MA 4GA9A 5A3PA 5DUXA 1OHFA 4IEVA 1HLCA 2P26A 2F6BA 5F2WA 5KHJA 2FDKA 1LCLA 1UY1A 2QDNA 1W6MB 2H0BA 3I7DA 2E63A 3LB9A 2OPWA 3ZYPA 4AI0A 4XMAA 3CLPA 1AYN1 1OI6A 4ZU5A 3P3PA 1O3RA 3R4SA 3K48A 1WWYA 5DDJ2 5DDJ1 3LCPA 3M7AA 5IT6A 2ZEXA 5T5JA 4NIIA 4C8DA 2P94L 1K5MB 3M70A 3QMOA 2ZGUA 1KRIA 1GQGA 4Y1VA 1QJU3 4K9SA 4UFKA 4ZXEA 5DAQA 4LXLA 3ZPOA 2GDFA 3GZTB 2ZGLA 1HCGB 5DZEA 3WZ1A 5C8CC 1QGLA 1R092 2HEWF 1R091 5FYMA 1ZRCA 1LHUA 1RUH2 2P6CA 1RUH1 4KL1A 3ZXKA 1FFMA 3CDZB 4HVOA 4RFT0 4OQ8A 2CJIB 1Y9QA 1XNTA 4P14A 5FP7A 2RG4A 2J42A 2ZX0A 2G19A 3KGZA 4LO4B 4QX1A 4LKDA 2PXJA 3AKSA 5FMOS 4DINB 3U4XA 4MHUA 2HYXA 1CCFA 1LHWA 2A6ZA 4AEKA 1HREA 1PO13 2VZVA 4JHZA 1H1MA 1H4HA 4QPGA 4DFSA 5L7OA 1IGXA 1ALYA 2RV9A 3GDBA 1WMFA 1RUE3 3HNYM 3F95A 3WQ1A 4YZ3A 1PO23 1SFNA 2QE3A 5DZGA 5GZCA 5A7SA 4QXBA 3WNLA 1F0RB 2BYVE 4FOYA 2A6VA 2GMEA 5A7WB 4BYYA 4ZH8B 1OLMA 4XF0A 5JOWA 4L11A 4NVPA 4XFGA 2ILMA 4YGEA 4XE9A 3HQRA 5FLIA 4XZUG 4U2AA 5C3QA 4XMIA 3ELAL 2VUDA 3J7MA 1CX1A 1SACA 4D3WA 4N53A 2WFF2 2WFF1 1I5ZA 3E5XA 3PLQA 5KXBA 1W8NA 1Y43B 4AVCA 4XAEA 3O1MA 3HO5A 2D98A 5I0TA 3I2HA 1UOGA 4OUSA 4RL7A 1UOFA 5LK7B 5LW9A 4FPFA 4OYUA 2XOMA 1OURA 1NT0A 2BWAA 2JX9A 2VW2A 3HNMA 1AYM3 1HRI2 2UWBA 1HRI1 3QACA 4LIUA 1O8PA 3USSA 4BQYA 4DXTA 4D0QA 4NOTA 5FZ8A 1YFUA 4I02A 3I54A 4AVVA 4Z1VA 5I8TA 1SCRA 3NNFA 5LEKA 3ZYIB 1J3PA 1OPOA 4Y71B 1BVVA 1REEA 3IDBB 2EIEA 4IQPA 4WVMA 2HKXA 1VBB2 3ZYRA 1VBB1 2GC1A 2WIIB 3WG1A 4A7ZA 1DX5I 4LR4A 4OHXA 4XW3A 2VTXJ 1VRH3 3HBZA 4FPOB 2WA4A 5LASA 2MEV2 2VVFA 3KZ4C 2MEV1 3ORJA 4CUAA 3LC3B 4IESA 2VZ3A 2VU9A 5D21A 4RFRB 3VD7A 4O02B 1WCDJ 2RMU3 1HRV3 3CJIC 3TZIA 3WNMA 2EF6A 2RJ2A 4V2VA 5BPXA 2YU1A 1N1YA 2Y7ZB 1NLRA 1RUF3 3HJRA 4HOOA 1UKGA 3RDIA 1U5XA 1NFYB 5LRRA 1X50A 1ZRDA 1S0DA 1WW6A 4TXWA 5CIRA 4NRQA 3NW4A 4O1ZA 2WNUC 3LC5B 3ETPA 2DBIA 1XNDA 4IDZA 3AMHA 4Q26A 2K2SA 3WDWA 3IJEB 3ACGA 4J25A 4COUA 3PTYA 3VBUB 1IQFL 3VD5A 2R042 2R041 4PF1A 2QZ3A 2BGPA 2YC2A 4IE0A 1UOJA 2Y60A 2XB6C 2W5FA 4OUMA 4RRWA 2RDNA 5CADA 3LDRA 1T6BX 4IV1B 3T30A 4AEJA 3ZYJB 4AEMA 3RZKA 5CKQA 3EO6A 1WW4A 4XDOA 4QHOA 3VBRB 2WZR2 4AVAA 2NQYA 1W9FA 2D6MA 2CL2A 2WZR1 3M36L 4QXHA 4AGGA 1XU2A 4QWNA 1PMHX 1Z7S2 2VJ3A 3LIGA 1PK6C 1Z7S1 4E8DA 3CFWA 4TGFA 4COXA 1OOPC 1MOXC 3AMNA 4HANA 3SKJE 3U37A 1B9WA 4AHZA 4ZPIA 1OF3A 1VLNA 4GZ9A 1RHI3 2ZJCA 3W5NA 1I3HA 5EJZB 3ZIXA 1K12A 2ZGMA 3DPRB 3W59A 1MACA 1SZBA 1DYKA 3RZHA 3RWKX 1KKEA 1PFXL 2WN2A 3N9LA 3OBZA 1CVWL 3MYXA 3NV3A 4QM9A 3LE0A 3TYJA 4QHZA 1Y7BA 4GB32 1MQTC 1CZVA 3BTAA 4GB31 5G04L 3ASIA 2QNKA 5BNNB 1JV2B 2TBVA 3THTA 3ZFGC 1US3A 4Y4YA 5FBZA 3CJIA 4HMZA 4QQLA 2EI7B 3VKLA 4XUQA 2GP5A 1D0GA 3OLUA 3X29B 2ZAHA 1W2UA 4GQ7A 2GH2A 2KM2A 3CKHA 1H8VA 1AL23 2ZTNA 2WNUA 4CDWC 2J1SA 4FP3A 1OC1A 1JS9A 4Q4V2 4Q4V1 4MGIE 4CXWA 1GLHA 1VBD2 2WFPA 1VBD1 2UU8A 2ZBJA 4O9EA 1VMFA 4CUDA 1EY2A 1QKQA 3PU3A 1POQA 1UZQA 5FXWA 1CESA 2YPJA 2PAMA 1COV2 1S0JA 1COV1 2CAVA 3ZXGA 2W3KB 1G9CA 4E1GA 1DDXA 1YUKB 2CWSA 4IUGA 2E53A 5FZ6A 1A3PA 4Q4Y3 5B4XA 4JZDL 2WINB 1LEDA 4Q0VA 4IEYA 1MS5A 3UJOA 3INAA 4PLNA 4JCKA 4NAOA 1ENRA 3V0BB 3BPSE 4OCTA 3VBOC 4UFMA 4TLGA 2X8KA 1LODA 2WDBA 4N7UA 3ZN6A 2QJVA 2V09A 3RJ2X 2JENA 1JYVA 3ZYGA 4R9CA 4CCCA 1YIFA 5DABA 3ZXFA 3FHAA 5CVRA 1PK6A 1W39A 4KWUA 1C8M2 1J3RA 2VMDA 1C8M1 3NMBA 5FIXA 5IW0A 4AFAA 5T5LA 1OOPA 3O1SA 5EP9A 2Y0OA 4JKLA 5BYNA 1TQ5A 4OMDA 4XBLA 1IKQA 1GZCA 4AQSA 4XILA 2UYBA 3NVCA 1CAWA 1DQ2A 3HQXA 2MGRA 1W2TA 5GKAC 4XC9A 4XACA 3KV6A 4Z2WA 1URXA 1IVOC 2DWRA 2Y80B 2BNNA 2QQNA 1Q8OA 3VKMA 3OUHA 1O5DL 3ZKYA 5IVCA 1W8HA 4BIOA 2OYUP 2OUHA 1ATDA 4IEPA 2F4LA 1IHMA 4ORFA 5EHDA 1BMV2 1LMJA 1BMV1 2OYEP 2XHKA 1RTVA 5JI7A 5GZGA 1LB2A 3ZFGA 1PXXA 4BTTA 5JB9E 4ZS2A 5H9SA 2YGOA 1V9U2 4CDXA 1V9U1 1RVF3 1YEWA 2P3JA 3OSDA 1EPGA 3MO4A 3LIHA 4ZU4A 3FHQA 2EI8B 1HXS3 1IS6A 3UKNA 2V5YA 2FCVA 4UAPA 4YVWA 5FZLA 1EZQB 3TNPB 4WM8A 4DNYA 3MI8A 4GMP1 5FPVA 5FKCA 3AP4A 3LEKA 3POWA 3IPVB 2XONA 3N8WA 1JYIA 2R16A 3WNNA 1UNBA 4QAWA 2DUOA 5KIRA 4CP0A 4PDWC 4XQWA 4EWDA 1DIYA 1EQHA 3V65B 3AXDA 2W87A 4MV2A 4AAXA 5LY1A 2XVGA 4XXAA 2EXHA 4QMAA 3RZZA 4CPBA 5CISA 5HXVA 3MLLA 1ULGA 5JPNB 3M37L 1EAIC 2JDZA 4YM2A 3VBOA 1G9DA 4Y5SA 2P3FN 4C91A 2FCUA 2NN8A 5JPMB 4HSJA 4GKYA 4OI1A 3I2FA 3KRKA 2PLV2 2VTFA 1WCQA 1EPHA 1XFEA 2E7TA 2PLV1 4HSLA 5FJHA 3TOJA 3VZKA 3O14A 3ZMNA 2JKXA 1R082 2RS12 2O8QA 1R081 2RS11 2XVLA 5A1LA 5AC93 5C4WB 2X5IC 2RM23 3I3BA 3GZUC 3FUQA 3K3NA 4AEDC 3KMHA 2A6WA 2BGCA 2QTWB 2RDRA 2Z2SB 5A6QA 2Q8EA 1UY4A 1AR62 4XETA 5APAA 1AR61 1U12A 2OT7A 2P5BA 4QB1A 3WSOA 1HJ7A 1J1TA 4LT5A 1ZA4A 1OLME 3ENSA 3UGGA 4CUGA 3TWIA 3ZXEA 5C9AC 1GZTA 3D6EA 4JTNA 4PLMA 1GWKA 3QH0A 3UK9A 3FX3A 1XDTR 3U1XA 4I0AA 2NP0A 1DGLA 1FV3A 2W91A 1UO9A 1OD3A 1N1IA 1NA1B 3MIDA 3IDAA 3MF6A 4Y20A 4XJUA 2BZ6L 4GALA 1AX1A 3IITB 4GIQA 4ZXXL 4QB6A 2L9LA 2WNEA 1PIV3 4Q5OA 5J1XA 3NO8A 1HJFA 2D43A 4IE5A 2ZGTA 1OUSA 5B4NA 1UIJA 5BNOA 4FFIA 1QDOA 1NCQC 4MYEA 3KLSA 3U10A 3MW2A 4C90A 1LOGA 4PDWA 2VE1A 3VHNA 3M2MA 1ZZ7A 2XVKA 3TEYA 1PX4A 2VMFA 3VZMA 4X8NA 5IKRA 4HZFA 4LBNA 4S2GA 5DAWA 3R4DB 4XZPA 3PUSA 3GCXA 5F37A 3WF1A 4DPNA 1GQHA 2XKPA 4Y5TA 5ACA3 1W8BL 1BK1A 2O1QA 4U36A 3N8VA 1EGFA 2Y5GL 1OQDA 1UXXX 4XHBA 1LHOA 3T08A 3V0AB 4CEWC 4HK8A 3BT2A 4IGQA 5F19A 2OUJA 3HPNA 3M3QA 2UWCA 4FI9A 1CN1A 3O1RA 2PHFA 1NZIA 1AZDA 4R9BA 2ZGNA 2RS52 1OQEA 2ERFA 2RS51 2WYSA 2X5IA 3C7HA 4H55A 4P08A 4YVSA 2OKXA 4C0BA 1IPSA 3MFAA 4GULA 4OTYA 4JGYB 4AEDA 4L2NA 4E27A 1IPJA 5FZOB 3DUIA 3WF0A 4BTIA 1UYPA 4IEUA 2W39A 4WVWA 5IATA 2ZA9A 4W4ZA 3P6BA 5LA9A 2JEMA 2JJ6A 2W0XA 4QDQA 4YM3A 1XNCA 4AFDA 4KWKA 5C9AA 3QD6A 5E16A 2CGOA 1POV3 3CZUA 2P3UA 3DXUA 3I3QA 4P9LA 3BTYA 4XF3A 1YWKA 5KN5C 1O6UA 3ALQA 2ARAA 2J1TA 5K0HB 2PHDA 4DIQA 5AVAA 4LLFA 1J1LA 3OY8A 2EALA 5JI9A 1YLLA 4CUEA 3FCSB 1O4ZA 1JZ8A 4FTBA 3WXPA 3DKQA 1N7DA 2LUWA 2GALA 2P3KA 4Q4X3 2B8MA 3B9IA 4XF9A 2C4XA 5JXHA 1G8WA 4M01A 5FFOC 1NCQA 3TN93 2IFRA 1ODMA 1RMU2 1UOBA 3W20A 1RMU1 3IIIA 3LOBA 1S4CA 1FXZA 3LF7A 5IK7A 4YGDA 3S6PA 4YFZA 1UU5A 2ZX1A 1PO12 1PO11 4XUTA 3AJYA 2EIBA 3OBTA 2AUYA 4FPJA 1YHFA 4IEZA 1YJLA 1KQRA 5G05L 3LAQA 1AR73 3T4VA 1PO22 4UW3A 1F0SB 1PO21 4GH4C 1VMJA 3N8YA 2XC0L 1L3YA 1A8MA 4FP2A 3VBSA 4CEWA 1EUTA 2QQPA 4A3XA 5COXA 2YY1A 3VBFC 4LHKA 1IZ3A 4FM5A 2KB9A 1XYNA 5HV4A 4J6GA 2ZGSA 1F15A 3WP5A 2NZ9A 3KVAA 2JIGA 4KBZA 4YSFA 1N3OA 2JIJA 2CGPA 3ZSJA 2F17A 3FL7A 1N47A 5A3NA 2Q1FA 1F9KA 5JMCA 1H2KA 2WO1A 1N3PA 1CAVA 1MVQA 3RRDA 3ZLIA 1GOHA 1HAEA 4RS5B 1QFKL 4LLOA 1I5PA 1UCXA 5HI0A 4O7XA 1CGPA 3ZFEC 3RI9A 3AMPA 3KHCA 2XJQA 3AP6A 2IXCA 2VQTA 1B35B 3LTGD 2FQPA 4R9DA 1AYM2 2Q5TA 1AYM1 4TTGA 5FDQA 1PGW2 4AI8A 1PGW1 2IXKA 4P5HA 4CCNA 2FMDA 4UFJA 4AR2A 4C0HA 4EZ4A 1EPJA 5FZFA 1W6QA 2JE7A 2WBKA 3KCXA 2XJPA 5A7PA 1PRHA 3ZYFA 3GM8A 4YG0A 1SFYA 1W6NB 4C1XA 2WNVB 4FOVA 1ZZ8A 1ULPA 3HOBA 3O0VA 4OULA 1DBNA 5FOBB 4G9SB 1X82A 5D8AC 2YGMA 3KT1A 3WQ0A 1VRH2 4OI2A 4XHXA 1VRH1 4IW3A 4BOWA 5IK5A 4TZDA 1NCRB 3H8XA 2LM3A 5FLJA 1JW6A 5FKBA 3OOXA 4URTA 2VCMA 4IEOA 4Y22B 1A8DA 3HMYA 3TK5B 2CGNA 4M3CA 5FQ0A 4L99A 3OBAA 1WLWA 2W1WA 3AM2A 3AC0A 2RMU1 4XBQA 4IE4A 4PF5A 1HRV1 2PTMA 2E9QA 2H0VA 4LE4A 4QM8A 2NYYA 4ZZ5A 1LPKA 1HJGA 1GMMA 1Y3TA 1O5UA 5JR2A 4QDSA 2BQPA 1APQA 3I59B 5FZEA 1CJDA 5IVFA 1NLQA 4AQTA 1DLLA 2IVJA 3VBFA 3SQOA 2WQZC 4HXCA 3IN9A 2D6PA 1TNFA 4BB3A 1HB4A 3ZM8A 1QH6A 1HKDA 2HWD3 2XHNA 4K6BA 4MHRA 1ZZ6A 2W9XA 3MLKA 3C7EA 5ISLA 5E88A 2WO3A 4JZEL 1AJKA 3NNJA 4DUWA 1JHJA 2JG8A 3NQHA 1K37A 1V6KA 1E57A 3AZZA 1TVGA 1NY72 1NY71 2O0OA 4W6YA 2VBBA 4ZY9A 1HV1A 2Q8DA 3RWNA 3ZFEA 3TGFA 2NPIA 3SHRA 3POYA 2ZOEB 1JH5A 4XFHA 3N7LA 2SLIA 4P00B 3VBHB 3OUJA 1XNBA 1QJX3 2E32A 1W99A 2VXJA 5FP4A 1VB4A 5B2GB 2EXJA 1JN2P 1UZVA 5L7OB 3WW1A 3A4UA 4E9KA 4YG3A 4D94A 2XGXA 4META 1E5IA 2VW1A 3KV9A 3VDAA 1GBGA 4COZA 5CYYA 2CNAA 1EUUA 1RUD2 4Y79B 3MIBA 1RUD1 3VV1A 2B4KA 5IVBA 4Z82A 4OHYA 3KD4A 1VAVA 1YIPA 1PVC2 1RUI3 1PVC1 1W0NA 4I2OA 1W06A 5D8AA 1EPIA 1WW7A 1VR3A 1KLJL 1LESA 1YUGA 2I9BA 2CYFA 1DHKB 3LAGA 1RUNA 1H9PA 1GSLA 4N53B 2Q30A 1BK0A 1DZRA 2XBO3 4IL7A 3VZLA 5F3CA 5T5PA 1XE8A 4M0HA 1OVSA 2VQUA 4LBMA 1BVP1 1LU2A 2JWPA 5KXCA 3VUOA 1YRZA 3ZX7A 4MOAA 1ND3C 3GBGA 4TN7A 3I2KA 2JKBA 3RS6A 4Y1XA 2ZEYA 2CU5A 3NJPC 3AFGA 3O1PA 4E4HA 2E51A 3OGRA 3VB9A 1REDA 1UW8A 4BK4A 1IQEL 2R072 2BBAA 1RUOA 2R071 3T4HB 1CCVA 1AUYA 1ATBA 2B39A 4Q4Y2 3ZOIA 4Q4Y1 2ZMLA 4MMZB 2P3IA 3MQEA 2PHTA 4LBQB 3HO4A 1UX7A 2WYJB 1W9WA 4BQ2A 1YUFA 4NIAA 2VULA 2QUOA 5L30L 2C9KA 3CJXA 4YNIA 5FPUA 1WBLA 5JAXA 1JZ4A 4WVVA 1WD4A 5L2YL 1GANA 2AREA 3W58A 2WPJE 3JQXA 4Y6DB 2C26A 2BQ6A 1GZWA 2UURA 4O65A 4CEYC 3BOPA 4D8MA 3KHBA 1X8MA 1RYYA 1XB9A 5FYYA 3PL0A 3POEA 3SH3A 3PVOA 1X36A 1ZM1A 1QQP3 4R8HA 4DRVA 2J22A 4BK5A 2K2SB 5F7UA 3KF3A 3WDTA 5AFEA 4JGZB 1ZZBA 2VVDA 2JDMA 4J1WA 4JRLA 4LUKA 4RRYA 3AVSA 4QKNA 4CCJA 5BNPC 2A75A 2HEYF 3I49A 2Y6HA 1P0SL 3GZEA 5IFTA 3PGHA 4MO3M 4BXSA 4AI3A 2VZPA 2WPHE 1DQ0A 1L7LA 1KFXL 4XF4A 4B7EA 2VD7A 3RYKA 2XDVA 4NPLA 5GZDA 3GXUA 5IVEA 2QVSB 2HBTA 1RVF2 2C5DA 3WQ7A 1RVF1 4XF1A 5K0UA 4I0BA 2XPJA 1IJQA 3NAPC 1GKBA 3ZYHA 1ND3A 4XVHA 3VN4A 2YBPA 2E26A 2ZMNA 2TNFA 4JYUL 1YXWA 5EYYA 5FYCA 2WG4B 5FY9A 1IS5A 5JVYA 2LW8A 2DVBA 1GYKA 4BU2A 4BQ3A 4TWTA 5FXXA 2PHXA 1RFNB 1LR5A 1NE6A 2VCBA 3AZXA 3T3YA 1KLIL 4COYA 3N9PA 2RVAA 4QXCA 1H8TB 4CU9A 1ZBA3 4Z0KB 3KQCL 3AP7A 4X6RB 1IOAA 1TMF3 1RUC2 1RUC1 4UF0A 2KD7A 3JBG2 1SMVA 2WS93 3JBG1 3U0ZA 1NOVA 5CNAA 2ES3A 1MEC2 4Q4W3 5LK5A 1MEC1 3WG2A 1RJ7A 3LPFA 4AVTA 1LOAA 1HDKA 1WCSA 3NKGA 3EXUA 1IQJL 5FY1A 2E7QA 3GYDA 2HOXA 5DXDA 3VZNA 3AKPA 5DUVA 5LWBA 1NFWB 5IVYA 2P4EA 4CCEA 5FYZA 1NPEB 4N43C 1EMNA 3M8LA 2HJIA 2WWSA 2CTVA 1QJEA 4LBOA 2VWMK 1E5RA 4RQPB 3K4ZA 1AYN2 3VDCA 4CEYA 2ZGKA 1JODA 1SLLA 3CA7A 4LBQD 2VR4A 2RM22 3FLRA 5HCAA 2RM21 2JD4A 2G9ZA 5EJ3A 2XQXA 2GC3A 3EQEA 3GGLA 3M3IA 1SBEA 5CB7A 4YZUB 2WNUB 1HRFA 1IGOA 1VALA 3SCHA 4GJZA 4PI0A 5C70A 3GZAA 2Z69A 4NWVA 4XFCA 5JXIA 1C1FA 1CD3G 1YFWA 2WAOA 3ZFFC 1UMHA 1JZ3A 4BQXA 2G9FA 5BNPA 2EXKA 4D90A 2BTVC 3J8F3 5CA6A 5J7MA 5JOXA 1UPIA 1VPHA 2RDSA 3HQUA 3WCRA 5KHIA 3TEWA 5I0RA 5DG2A 4CU6A 4YPJA 1QHDA 2BT7A 1UIKA 1Z78A 2Y33A 3I8TA 1JYXA 2P17A 4G1MB 2V5DA 2DVDA 3OBRA 4CDQC 3SITA 1ASJ3 4DQAA 3LSDA 3ZN6B 3MEPA 4Q0UA 2EAKA 5DG1A 1QOSA 5ABJC 1BHGA 1WA6X 3LZZA 3N8XA 3MUZ1 3VD9A 4X8UL 1JL9A 1PIV1 4QPWA 3AYAA 2FHRA 5EYXA 4OTJA 1RUG3 2XLGA 1OOPB 1J9CL 2OS2A 4HBNA 1UZZA 2A70A 2BQWA 1JYWA 4XJWA 2ARXA 3U75A 4HPKA 3WD5A 3LEMA 4UBHA 5C71A 4PCRA 3BKZA 5C3OA 5LBFA 2DCJA 3TNQA 3I97A 1ZRFA 1QY4A 3HT1A 5FUNA 1OB1C 2B7YA 4DXRA 2P93L 5LZ6A 3CQOA 2ADXA 3WNPA 2J1RA 2YBSA 5F5CA 5ACA1 3VDBA 4N9HA 1UX6A 4ZXYL 2B5HA 5KR7A 4AW7A 4N43A 4V1PA 3OPZA 2ZZQA 1OSGA 4XOGA 4Y1YA 5A1AA 4M3CE 4G3YC 4B4RA 2YMZA 4OMCA 3B00A 4CDXB 3PNAA 5EPAA 2YPDA 3MICA 4W8JA 4YARA 3ILNA 1C5IA 3IZOA 2JG9C 4FAHA 5AC92 1P8JA 5AC91 2E6VA 4FPKA 1TPGA 4YVWB 4MXVA 4OLLA 4XJ9A 4WM8B 2JDPA 4H2AA 1V6MA 4IGOA 3QCWA 3SH5A 4XJAA 3SEPA 5L9RA 1OLQA 1QMJA 5C8CA 1H1IA 3ZFFA 3N8WB 1LULA 2GNBA 5FY7A 1OA4A 2R6QA 1EV13 1VBC3 4UBGA 5DPNA 2DV9A 1UZ0A 2R30A 3UJQA 4AGVA 4Q0PA 4O9GA 1FJSL 4YZ5A 2OXBA 4K20A 4CDQA 1BBT3 5EWSA 1I9RA 1LHVA 2PQSA 2JKHL 2VOTA 1U5ZA 4AVBA 1JZ7A 2X05A 4NIHA 2WPLE 4CU8A 3ITQA 2DCZA 2HEVF 5E6HA 1YO8A 5I46L 2BBVA 3M1HA 4IERA 4HN0A 2HWE3 1FMD3 4AHYA 3USUB 3KQ4B 1L7RA 1M4WA 1ODNA 4JX0A 4LKFA 5FK7A 1H2MA 5HXMA 2YYOA 4HETA 4NPRA 4LTAA 2VUJA 5K4LA 4Q4X2 1OBNA 4Q4X1 3FWEA 3LQCA 1GOGA 1UD1A 1O7FA 3BODA 1TME3 3TN92 3TN91 2XBXL 3O0XA 1DQBA 1D4M3 4OHZA 2WJSA 2Q1JB 1SDWA 4UFHA 4AGRA 3VD4A 3C7OA 1FOD3 5IVJA 4A94C 2VOVA 3OPTA 3IAQA 4YRDA 2C0ZA 4QD2A 1UMZA 2RNLA 3CMGA 1VAKA 2PAKA 4JTOA 3DYMA 2D3PA 4ES9A 1CVNA 2XJRA 4MXWA 1W6OB 2GC2A 5TSWA 4LO7A 4YZ1A 3OGJA 5CFCB 2PELA 3JUUA 2QQMA 4XAAA 4M11A 4OQ9A 1IKPA 3TRSB 2F9BL 4XFBA 1SCSA 5JWPA 1QDCA 1QJY3 3NJYA 3NL1A 3I4IA 5CZKA 1KJRA 1CX2A 3PVEA 1RITA 4Y3OA 1BEV2 3BOWA 1BEV1 2NPRA 2VW0A 4LHLA 5FJKA 3ZMOA 2ZEWA 3RJRA 2I07B 1V6LA 3C2UA 3DEMA 4BDXA 3MF9A 4Y20B 1D4VB 2JG9A 2IVIB 1UZKA 3VDDB 4COVA 3AMMA 3H3LA 4KNCA 5A32A 3VHPA 4F7ZA 3DXTA 2P37A 2HWC2 2R32A 3VBSC 2HWC1 2YU2A 1CZSA 2WPIE 1LOFC 4MMXB 1WCUA 4NHKA 4P9JA 4QX3A 2WFXB 5KBFA 4IE7A 3LN1A 5FAXA 4AI9A 4CDUB 5BNOB 5C6CA 3PMEA 1Q8VA 2J94B 4RA0A 1D0HA 2J1AA 2XBWL 3S7EA 1A6CA 5J96B 4PDWB 3CNAA 4QX5A 3SMHA 4ARXA 3OB8A 1ATEA 2VMGA 2RHPA 2C9AA 4BJ0A 3GBFA 5CFDB 3ZSMA 4I3PA 3VHRA 4CVUA 3LN0A 3I2JA 2J38B 2RR13 1H9WA 2WT1A 4MGKE 3A0KA 3WUDA 1Y9GA 3C7FA 4Y1UA 4DRRA 3NJXA 2EXIA 5FYTA 4CP9A 3OG2A 4FVVA 1EPZA 3ZKUA 4QQHA 5K8SA 1AF9A 2WSVA 2IUWA 4CPBD 4UW6A 4YVSB 3AZYA 4AEDB 1OH4A 2XJSA 4IV3B 2VMCA 1BLZA 1G1QA 3VZOA 5JSRA 1BCXA 1XOYA 1W6MA 1Q8QA 1J59A 3Q9OA 1AXYA 5A7NA 2VL4A 1ST8A 4A7KA 1FT9A 4QKDA 4RYDA 5JOZA 3I2IA 1RUJ2 3ACLA 5H9RA 2J95B 1RUJ1 2AH2A 5J48A 2PFWA 1LEMA 4LO6B 5C9AB 5F3GA 3BTXA 1QIUA 4XJZA 5FPLA 3MIEA 4JRAA 3HIFA 5A3WA 1F8VA 5JBAE 4GD4A 2Y26A 3AX4A 4RHV2 4RHV1 1W04A 3UT0A 5LCWL 1ADXA 5HCHA 4GJYA 2BRTA 2C24A 4JZRA 4XXPA 5DUUA 1OFNA 2D1JB 1S1AA 1PVXA 2ZAAA 2HWD2 3B7MA 3GJBA 2HWD1 3FFZA 2BOKL 1LECA 1H30A 3B93A 1YYNA 3GHNA 4YGBA 1FNYA 4B4QA 1NZCA 2BZDA 4NJ4A 3N7JA 3M3EA 1LOFA 4FTEA 2VUCA 1TNRA 1O91A 3I2DA 2Q8CA 5CG9A 1CIWA 1OKQA 3KV4A 1NCQB 3KL6B 3A23A 4NROA 1W8ZA 2OA2A 3WW4A 4XQDA 2NMNA 1IOXA 5IJRA 1MQTA 3OEAA 4K40A 4H14A 1HT5A 3RPQA 1NQLB 2BOIA 1SG3A 1DZQA 2D5HA 5CG8A 3THPA 1GV9A 4HL0A 3FN9A 4ZXKA 2HWF2 4UXAA 2HWF1 3WLUA 4K1YA 4EQVA 1KIGL 3CEWA 4BPZA 1TG7A 3SXWA 5K9YA 4Q29A 1ZYBA 2ZGPA 5J09A 3N8YB 1GU3A 4CEWB 2WNOA 3VBSB 1IQIL 4Q2FA 5D1IA 1RUI2 4CDWA 1RUI1 1S0CA 5FMCA 3EJKA 2Y5HL 3F2ZA 3N9NA 4IV1C 5FPZA 2M74A 2EIGA 5DQ0A 3AMQA 1L3JA 3B3QE 1LMMA 4PIXA 3H42B 5E8DA 2V72A 4P9GA 2XBO2 5FO7B 3JXSA 2XBO1 2P95L 1IQNL 1DQ1A 4R52A 2JDHA 5FXVA 3VBRC 4FTSA 2VZUA 4P9YA 4QU1A 3WVJA 4EN6B 4YT7L 2MGPA 3DYPA 2PHRA 1JXNA 4FO9A 4BMEA 4A42A 3OYWA 1MS9A 4I30A 2MNGA 3VHOA 1AR83 1BJQA 2BU9A 3T1MA 5AFBA 2A3YA 2WL1A 1DDLA 5I0SA 4AI1A 5HCBA 1W6QB 2D93A 4XYXA 2IXIA 3R05A 1NXMA 2DVAA 3DPRC 3LKJA 5FZMA 5F5QA 4ET7A 3O1UA 4LA2A 4MSVA 4UWDA 4ASLA 1GICA 2J2UB 2DUPA 2WFTA 1RL3A 4XPVA 4QHBA 1C5HA 1WZXA 2Y5FL 1PGEA 2WT0A 4AL9A 4NO4A 1U0AA 1ZBE2 2HWB3 3IT8A 1ZBE1 3N3HA 4RR3B 3ABZA 3EGFA 4UOJA 3KCCA 5A3UA 1W7XL 1AXZA 1GUIA 4FPCA 4LHNA 4AF9A 4DOUA 2VCCA 2YHJA 3ACFA 1YGCL 2JDYA 3E6CC 5A6XA 3K51A 4M3CB 1OUXA 5FQ0B 1R1ZA 2UY9A 4QT6A 1WCKA 4QXKA 5FP9A 1W8TA 3AKTA 4NRMA 1CQEA 2D6NA 1OLRA 1RINA 4B29A 5SV8A 2QKDA 3BU7A 5DDJ3 1HV0A 4QX7A 5A3MA 5LA0A 1D2QA 1WBFA 2ZPXA 5JZGB 5JR7B 1OQ1A 2QQUA 3KGLA 1QQP2 1WW5A 3M3OA 1QQP1 4NHYA 1H1AA 1KDKA 5FZ9A 3WP4A 1LTEA 2NLRA 3VBFB 3ZR6A 1UZJA 1V3XB 1ONAA 1UZWA 2DVFA 1WUVA 2VNVA 3FZ3A 3LA3A 5FYIA 4B1LA 5JSPA 1MZFA 3E6DA 1RUH3 4M0NA 1LAJA 3O1TA 5FZHA 4CUFA 1SLCA 1Z6EL 4ISHL 3VBRA 2UWOB 2JG8B 1APOA 1YI9A 1OA3A 2PYTA 1G1TA 4YW3A 2K0GA 3KSCA 4NHMA 2BJSA 3JQWA 1O8SA 5T55A 3ZFEB 4E4DX 2W1SA 1ZX5A 4H7LA 3WDUA 3C7GA 5DZFA 2A71A 3ZDVA 2BSFA 3ZDSA 3IIAA 4YT6L 4NIDA 5KHHA 4BA6A 1AX0A 2BVVA 2GP3A 2ZXQA 2XJTA 1CR7A 5L73A 4BLIA 4LBJA 4SBVA 3HN3A 1MS3A 4FFHA 1XSRA 5F2SA 3T1LA 4E2QA 1H2LA 1XKAL 4N90A 1IQKL 3GISX 1OMIA 3FLTA 4DEVA 3MV11 2Y6KA 1IQDC 4DXSA 4LO8A 3SH4A 1TMF2 1O4TA 1TMF1 1WHFA 2WFF3 4UYBA 3P5BL 1ZNPA 1FAYA 2BP6A 2VVCK 2WS92 2WS91 3B9CA 4OFGA 4Q4W2 4QKBA 4Q4W1 5D8AB 4F3JA 1HQLA 4HVQA 1VBA3 2VM9A 2VOWA 5C3SA 2XL7A 4NUBA 2FD8A 1NE4A 3PUHA 4NWWA 4ZHAB 1V6NA 2ZEZA 2VMEA 2VGDA 4COWA 5L36A 1JOBA 1QXPA 1IGZA 2GC0A 4QPYA 4BM8A 1PGL2 4JHTA 1PGL1 1AJOA 1O59A 2BO2A 2YROA 2FLBL 2RE9A 5FMDA 4DS0A 1LGCA 4BDWA 1HX2A 1KJLA 3TK6B 4NE9A 2LALA 1UF2C 1PM7A 1LPGA 1X7AL 5CKMA 1NFUB 1ZREA 3T2OA 1W0OA 2W52A 4JDNA 3RI8A 1OPMA 1IP0A 3AYEA 2OX0A 1Q4GA 1QJU2 2J1VA 2VMIA 1QJU1 3AJZA 4QPIB 2Y7XB 5ERLA 4HKLA 1DP0A 3KCGL 3B02A 2JDUA 2Y6JA 5FZ7A 3J8F2 1S2KA 2VNGA 3J8F1 3V0BA 1KD7A 1HQWA 1S0EA 1NKGA 3ZYBA 2BEOA 3H8RA 2VZTA 5F1RA 2P6HA 1L5GB 4JQRA 3UGFA 4AQ6A 2EA7A 1ASJ2 3RQ0A 1ASJ1 2DCYA 5I93A 4EWAA 5KXDA 5FYUA 5FZDA 3F6UL 1ND2B 4Q1PA 1RUE2 5C4WC 1RUE1 1TE1B 4X8TL 1C57A 1P9JA 1WLTA 1H0BA 2J1UA 2XXZA 3BIWE 4Q0SA 4WM7B 3SISA 3H8OA 2LROA 3WCSA 2DTWA 1GZWB 4GKXA 1LK9A 3H5CB 1F2NA 1UY0A 4Y33A 3N7MA 2OQ7A 4EV0A 1RJ8A 2TGFA 3WNXA 2R043 5IKTA 4K21A 1JOJA 2X10A 3MZHA 3PVNA 4HK9A 4LORA 3Q7DA 1SLIA 3BI3A 3OUIA 2XBVL 2AC1A 2PN5A 5JB8E 3H1MA 4L97A 3S5QA 3PU8A 4LE3A 3ZSEA 4LITA 1W9TA 4XFIA 3WG3A 3WR0A 3ES4A 1NAEA 2DUQA 1CAXA 2JICA 2W94A 3GNEA 5FY0A 3O1OA 2I74A 2ZHMA 4QX0A 1YI7A 2PHUA 4PQQA 5CKNA 2WZR3 1F4HA 1WLCA 4EJRA 4C1WA 1DGRN 4PH9A 3Q8FA 4JQTA 4X6QB 4E2GA 3I3EA 1Z7S3 2VECA 1XNKA 1SHWB 5K0UB 1CZTA 3IDEA 2D3RA 1K42A 2VNOA 1XNAA 4CZSA 4YM0A 2BOJA 4NR1A 4WV8A 5F32A 3ECQA 4ARYA 5JCTA 5JBBE 2BERA 3K75B 3K4AA 4OZXA 3WHTA 3SC7X 4UFLA 5IAXA 1VBC2 1VBC1 5KHKA 4GB33 4F83A 1F4AA 2XWBB 3LDBA 3D0JA 4LBKA 3RZJA 2OQ6A 3VKNA 2RJKA 1Y9MA 2RMU2 3KV5A 5J36A 1BBT2 1HRV2 3PDQA 2PUQL 1BBT1 5LBCA 3WX5A 2VXRA 4CSWA 2MPFA 1RUF2 1GFF2 1RUF1 3HS7A 3L2HA 1FMD2 3SOVA 4AWDA 1FMD1 3ST7A 3AK0A 4D7SA 4PLOA 1ENSA 2O8OA 4JGYC 4GH4A 5IAVA 1UZYA 3PUIA 4Q4V3 4KI5M 5FZ3A 1VBD3 4LULA 2QDRA 4W50A 5SV5A 2KNIA 1MZEA 3NNMA 3P5BA 2WUHA 4D6SA 1HZ8A 5M0TA 1UMIA 4QX8A 1COV3 3ZN4A 3G6JB 3LSEA 5L19A 2CV6A 2ZGOA 3CF6E 1C4RA 3U11A 1FOD2 5IK4A 5IFPA 1FOD1 3KQBL 1FX5A 2B9UA 4KBBA 4DY3A 5JW1A 3CL1A 4EWEA 3MW4A 3U73A 3POGA 4YZ4A 2YDEA 4JV4A 4A2UA 2WG3C 1Q8PA 1YNAA 2DYCA 1WMXA 2XG3A 5BNPB 3GALA 3MPBA 3EMRA 2WZEA 5EZWA 1XU1A 3FJSA 1N1VA 2DTYA 4GWNA 2VCAA 3ELNA 2VG9A 1W3XA 4NMIA 5DMYA 2XR4A 5C5UA 4QPGB 1HT8A 1NXD1 2NM1A 1F5JA 2FDJA 3ZXAC 4KGGA 3I3MA 1C8M3 2DF7A 1XYPA 1EQGA 3EB7A 2BQ7A 5DUWA 5FYBA 4AHXA 1XBFA 2BW8A 3THDA 4CTEA 4RS0A 3D3AA 3RYRA 1RHI2 2G9GA 1RHI1 3NKTA 4D6QA 4WVZA 5BV6A 5AVPA 3TH3L 1Z6CA 1QOOA 4RD7A 4BCUA 1YJKA 3FUOA 2JE9A 3SNMA 4CCOA 2IWGB 1JTZX 1GNHA 1QNWA 4BH9A 4ES8A 5DAVA 4HPKB 4HG6B 2FMYA 3B01A 5JVVA 1E5SA 5A70A 3A0NA 2FDHA 5I0DA 4JYVL 1UY3A 3JB4C 4P02B 2WR9A 1SQ4A 1G9AA 5GJ6A 1G9BA 1ULEA 1V9U3 2JJLA 4ASKA 4HLTA 2RR12 5IKQA 2VNRA 2RR11 2FZ1A 2TEPA 2ZGRA 2ORXA 4QGNA 3FHIB 3VD3A 4LQRA 5JUVA 3BALA 2Y6FA 5EV7A 1AL22 5IWFA 1AL21 4MGTA 3K2OA 4F8AA 2RA0L 3T2PA 3JCIA 3H7JA 4XURA 1UZPA 2ZX2A 1UN1A 2K2TA 1JMUB 4P9WA 3PURA 4M4PA 2WWUA 1MR5A 1B35C 1HQNA 3OGGA 3N8ZA 4Q8LA 4WVMB 3D8CA 3RZMA 4BZ4A 2IC1A 4YW5A 2A73B 3J7LA 4B4PA 5C8CB 2DFBA 1WA4A 5FXZA 4BLJA 3UNPA 3P1IA 3CIHA 4MADA 4Y4RA 1NLSA 1WD3A 1MQ6L 2QQWA 1TLEA 5E89A 1YQ6A 2VC9A 3HWJA 3M3CA 3WY6A 3IM0A 1O3QA 2Q0AA 4MVTA 3OCPA 1VRBA 1Q43A 2GNMA 1MS8A 3QOPA 4EN7B 2R1BA 1Q8SA 2PLV3 3S6XA 2YBKA 2WYFA 4BISA 5A1FA 5JBCE 4FPYA 4ISIL 1ZAQA 4IGPA 4QQOA 5I8SA 5LB6A 1WKYA 4CU7A 1JZ5A 3UV9A 2WO2A 1LGBA 1NCRC 2G1MA 1HAFA 3GCXE 3B5LB 1G1SA 1UWWA 1VIWB 4PT6A 4S2FA 2GNTA 2XUEA 4GWMA 3ON7A 2DU1A 2H6BA 4E2SA 1HB3A 5HBAA 4D0EA 1W8OA 3NNLA 1GNYA 4CP1A 2GD4A 4HFSA 1LGNA 1CAUA 2BWCA 1XXNA 1LOBA 1K45A 1PMJX 1W9SA 4O61A 3WV6A 1E5HA 1O5LA 1G6NA 2WABA 2FLRL 3DN7A 1ULCA 4DUVA 3WHUA 2QQJA 3RMXA 3KK6A 1MS0A 3BU0A 3CHXA 5FYVA 2FBEA 4NRPA 1STMA 4A6SA 1NFXB 5K7PA 2C6SA 1SBFA 3GF6A 5ANQA 2VZSA 1HXS2 1HXS1 1UL9A 2VWNL 1JOPA 2VH0B 2WT2A 3PIGA 3POBA 4BIFA 1COUA 3W9AA 1O4YA 4B7KA 1W8UA 2D97A 3UYJA 3IMNA 2JG9B 3HAGA 2P1BA 3ZVXA 3BGAA 1QU0A 2DBNA 1ZRIA 4N9IA 4AHWA 1RB8G 1R1A3 3P3NA 4CCDA 2GMMA 3PTRB 1YFYA 4BXFA 2B7DL 1B35A 3AB0A 3N9QA 2WN3A 2BOUA 4XTPA 5E8AA 3VBHC 5H9QA 4S2HA 2LS6A 5FO9B 2R1DA 5L7OC 4QDRA 2ADEA 4X8VL 3ES1A 3MFCA 1UYXA 5C3PA 4PBPA 1VAMA 2W2PE 5T50A 4FQZA 1AR82 2Q1ZB 1W6NA 1AR81 4ZHNA 4QGMA 3IB3A 3RGBA 3CJIB 1VBE3 5JIUA 2BV4A 4N7IA 1DGWX 1FNZA 1UKRA 3MPPG 3Q8EA 2AACA 1YFXA 1NCRA 4IEXA 2JDKA 2GMPA 2J7MA 2XKOA 5F8PA 4Y22A 3K46A 4WZCA 4CP9B 4YWAA 5CEHA 5J3UA 2J34B 1OD5A 3MUY1 1W8FA 3FC0A 4ISRA 2W47A 1EAH3 4M10A 1DGRA 2YV8A 4Q1RA 1IQAA 1WMDA 4AI2A 2KR2A 3J7HA 2XLAA 1F7EA 5GLTA 1FATA 3WNOA 4HVRA 1DFQA 3DL3A 4Y5Z0 2VH9A 3I59A 3O0WA 4TSVA 5JXJA 1RXGA 3LDKA 1OXCA 2Y6LA 4GAZA 2ZX3A 4I0WB 4FFGA 1K3IA 1VJ2A 1V00A 3FBMA 3BTZA 2UWLB 2UY8A 3OF1A 2D3SA 4Q0QA 4OHVA 1I0UA 1GNZA 1F31A 3NAPA 1ENQA 2V4AA 2VRSA 1X33A 1PIV2 2A5ZA 2OIIA 1PK6B 4Z6AL 2Z42A 1FPN3 1ZRRA 4XDPA 4QU2A 5GLWA 1Q3EA 3V56A 1V1HA 2OZ6A 3LD8A 5FPAA 3HT2A 1IS4A 1RMU3 4HN1A 4MX3A 1XC6A 4FBFA 3FFGL 1CAWB 2VOXA 2W2NE 3Q8CA 4CE8A 4EZHA 4JZFL 4HKOA 3VBHA 1V70A 2UWAA 2XL9A 3D82A 4LKSA 5C33A 2QQKA 1EBVA 4BQ4A 4W6WA 4URAA 1QIQA 3AP9A 2R0HA 1MQTB 3F1SB 4QGLA 5ACA2 5J98B 1V6JA 5JVZA 1BZWA 1V1IA 1W05A 2AENA 3OD0A 5A3OA 1KEXA 1ZVFA 5A7OA 1SDDB 2B45X 1S0IA 3ZFGB 3AVRA 1CPNA 2VQAA 1AX2A 5JIAA 2OPKA 1C8NA 3DV8A 3ZIWA 1CEJA 2Y81B 1YQCA 4JGZC 3ZN5A 4EYUA 3KWVA 5LY2A 3OPWA 1OFSA 3T0BA 3T0AA 1SPPA 2IZWA 2PHBB 4ZS3A 1CWPA 1QOTA 1A3KA 3UESA 4FQ4A 4D7TA 3MHZA 1VE0A 4NAMA 3JZVA 4OHWA 4CDWB 3LTFB 3KM5A 3VGIA 1H4GA 3FE5A 4JC1A 4CXXA 4UI9L 3RR3A 1VBA2 1VBA1 4DXZA 3IAPA 2WPKE 4LA3A 1ZZ9A 4FAGA 4X8SL 1GZ9A 1NG0A 2JB8A 4L8QA 4CP2A 4BQ5A 1VB2A 1KSNB 3CZJA 1XRUA 2C1FA 3EBRA 3A22A 4KGQA 3NJZA 3CBNA 3BN6A 1POV1 2AZ5A 3RFRA 2HORA 1W6PA 3OGVA 5F5AA 3JD73 4DZGA 3VBOB 3NTGA 2BOHA 1AHSA 5F9TA 2ZX4A 4JDMA 2B42B 2V73A 3OYWB 4KU7A 3LGRA 1CPMA 1JI6A 3ACHA 4K8RB 1H8TC 3LEGA 2AEYA 5ABJA 3O1VA 4MGQA 4Q8KA 1DQ4A 1K5JA 1M1XB 2RS33 2YG0A 1UU6A 2HYKA 2KXLA 4ITCA 4LBQA 3SCGA 3WNKA 4UT5A 1PZ8A 5JOYA 4XUNA 4PQ9A 4ZAEB 1QJZA 5A7QA 1GP5A 2ZGQA 2QZ2A 3MIHA 4A4AA 3KVBA 2BNOA 2VTXA 2OVUA 4D7YA 5IUQA 4ATFA 2TUNA 2Y0IA 5FOJB 1W2NA 4PIZA 4RQPC 3GBWA 5KWRA 4H7MA 5DAXA 1JUHA 2ZACA 1KS5A 5FUPA 1DG6A 4DY5A 3E5UA 1AR72 4E8CA 2KL7A 1AR71 1J84A 3BUCA 3N36A 3N9MA 1K5MC 4JAAA 2WQ8A 4RN5A 3AXEA 1BQPA 4PI2A 4FOWA 5CU1A 3AL5A 1M06G 3H0OA 3J4UH 4BWOA 1FAKL 1W2AX 2LRPA 1EPWA 3LFIA 4FT8A 3H9AA 4JGZA 4XCAA 3SEEA 3AZVA 1SFPA 4AZZA 4BXSV 4MLOA 2ATFA 3I2GA 1DGWA 1JU3A 5A33A 1NQJA 1PMIA 3NSTA 3SLIA 3PVBB 3L9JT 3H3UA 3LWCA 2DCTA 2GSYA 5FP8A 1F7MA 3J9SA 5F39A 4R4XA 3MIFA 4OI0A 1VP6A 3VLBB 1IS3A 5DAPA 3T2QA 1MVEA 1LPZA 4LNVA 3C3VA 4YW7A 4K3UA 2WYGB 3C8XA 2J1EA 3LIWB 5T5OA 5ANNA 5FZ4A 2VPVA 3ROUA 4TLFA 4TYSA 4A3ZA 4K1ZA 4GMP0 5FPBA 1X8EA 5C5TA 5IK8A 1REFA 4Z8BA 2A6XA 2CAUA 1K36A 1G2LB 2ZHKA 3U78A 5FCCA 2HBUA 4FPHA 4WBBA 1H8TA 3S30A 1U5YA 2ZKLA 4NA9L 1W2OA 2EAAA 1RUD3 3NV2A 4AVSA 4EROA 1CJPA 1HX6A 3H1YA 1PVC3 5FYSA 3H7YA 3IWZA 3S7IA 1RIRA 5FY8A 2HLEA 3S5AA 2BMGA 3HR9A 4LKEA 1DCSA 2X5IB 4FPEA 4A41A 5F6LB 5FR3A 1H6YA 2VWOL 3UETA 4RRZA 3OTFA 4RUTA 3LPGA 3W5MA 3DCQA 2PHWA 3T2TA 4RQPA 4XIKA 2Y6GA 2YFZA 5F5IA 2VBDA 1F5FA 4DB5A 4XFFA 4CDXC 2WWJA 2YGLA 5KXEA 4HKWA 3RSJA 1H2NA 3CS7L 3R6SA 5FLHA 1K5MA 1L7QA 2VY0A 5EQUA 5HCFA 4YVWC 1T2XA 4WM8C 3Q8BA 3S57A 2B46X 1QF3A 2Y8KA 3RZLA 1URKA 2R073 1LNSA 3KCYA 3NV1A 1HB2A 1LRHA 3OY8B 5GZEA 2I2SA 4HONA 1G1RA 1DIWA 2PMWB 2QQLA 2WC2A 1AXKA 1DYPA 1FV2A 4RGGA 5FREA 1W90A 3M4FA 5A80A 5LATA 4Q27A 1RGSA 4NIGA 4OUEA 4YW4A 2GH8A 4Y26A 1KLOA 3NRUA 4AG4A 4XABA 4G4FA 5JDBA 4XCBA 2N7GA 4NPMA 1FF7A 2ZHNA 3H8UA 4XUPA 4Z92B 5IYYA 2W92A 2YGPA 1FE2A 2Y34A 3OD4A 1AR93 4K8FA 4DMIA 5BY5A 1EP0A 1QJX2 1QJX1 1XPWA 2K9ZA 1WMEA 5A3LA 5FY4A 1Z0HA 2KA3A 3FLPA 4QKFA 5A7WA 3CO2A 3W21A 3VBUC 1H6XA 1HN0A 3KB5A 4AK3A 2WLPA 1ENXA 4XBNA 5FWJA 1CONA 4AE2A 5A3TA 1MS1A 2HH9A 4MGSA 4PIYA 5I91A 2XJUA 1JBUL 2DCKA 5FO8B 1QNYA 3EYPA 2R063 4PHZA 2DURA 1N1SA 4LBLA 3POFA 3K3OA 3T0DA 3GCWA 2SBAA 3NWKA 3WINE 4YM1A 2FCTA 5CFCC 2W46A 4LEJA 1HN1A 1D7PM 2AEZA 1GOFA 3HNBM 4AFMA 5F3EA 5L9BA 1CAVB 4B3NA 2AYLA 4AFBA 1MPXA 4A6OA 4LOTA 1GK5A 1CAXB 1ZA7A 2WLQA 5CBLA 3WF4A 3VL8A 4IXLA 1JBCA 3ZO0B 1WLDA 2W95A 3T09A 4XUOA 5FZCA 3VDDC 2CWMA 1JYTA 2DFCA 2P28B 1FYUA 2W2OE 1IG3A 3HN1A 2BT8A 1PM4A 2EVXA 5E1RA 2EI6B 2VMHA 3A7QA 3KS7A 5BNOC 1S55A 5F3IA 4CDUC 3B69A 3Q3KB 1MZ6A 3OGSA 3GHMA 3WQBA 3AYCA 3HO3A 2W3JA 3WP6A 3ETQA 4EE2A 3C9AC 1RUC3 5LRSA 1UXZA 1W9YA 3H50A 3AKRA 2WZ8A 3JBG3 4W6XA 5GM0A 5BNNC 1MEC3 5C7GA 5CFDC 3KQEL 2A3XA 1JYCA 2WZPP 3DECA 3UGHA 4CA9A 1X7NA 3KQDL 1FI2A 2VVUL 2ZMKA 5JSOA 2CY6A 5GZFA 3MDPA 3HS6A 4YGCA 2LTNA 4QB2A 3USUA 4YZ2A 2G4IA 2EICA 2ARBA 2BDRA 1V6IA 1DVAL 1J83A 1LJ7A 2JB4A 1AYN3 2DDUA 2FZ2A 1DLCA 4FCAA 4I09A 4A45A 2W1UA 3VBUA 3WF2A 4H3WA 5LEJA 1F35A 3UKVA 1W0PA 2ID4A 4YVSC 4GH4B 4CRQA 4IV3C 4QQ2A 1SEFA 5I8YA 2X53S 1JUIA 2YXSA 1CVUA 5JMOA 1UY2A 2IXHA 1X9TA 5F1AA 1UYZA 3ZR5A 2ZS6B 3RYPA 3U14A 1R093 4IV1A 2JXAA 2YUEA 4MG2A 1IQML 1W6OA 1YCIA 3IBMA 5CFCA 4MZUA 4D6RA 4I3GA 5F6KA 4UFIA 2WPME 3AYDA 5L2ZL 3O12A 2VH6B 3AZWA 1G86A 1ZZCA 2Y64A 4FXGB 5EFUA 4CXYA 3POJA 4L92A 2YFUA 2ENRA 2GNDA 1TZOA 2VOKA 1MS4A 1XE0A 3BB6A 1C5MF 1PHMA 2P16L 1N1TA 3SCFA 2CSGA 3VDDA 3HVDA 3ZSLA 1PTHA 3KT4A 3RG0A 2VZRA 4MUVA 4NGAL 3MIGA 2H9EL 3QH6A 1IOEL 4M3CF 2E33A 3U7UG 4KQ7A 2JDAA 2FDFA 2XUMA 2VVVL 1IPKA 1PNGA 2VAUA 1UPSA 2WQ4A 5BUVA 1QWRA 3DPRA 4CDUA 4CYDA 3KQRA 2QQVA 5BNQA 1GWMA 4Y24A 1R1A2 2IXJA 1R1A1 1ZBA2 3N35A 1ZBA1 2W68A 3FMGA 2JECA 3LOIA 4P9IA 3HS5A 1BYHA 2ZHLA 3ACIA 3WF3A 4NG9L 2FD6A 1DZTA 1EYBA 1KFUL 5FYHA 4BQWA 5H9PA 5BNNA 3IMMA 4X8PA 5CFDA 3ME2A 3D5OA 1JZ2A 4V2WA 2A7AA 3V64C 1RXFA 3SW2A 4LO5B 1QEXA 2WO7A 2W2IA 1I1EA 4INDA 4KWJA 4LIVA 4M4RA 1C1LA 4ZU7A 5T54A 1IQGL 1GP4A 1NYWA 3LA2A 4Y76B 3MBWA 4IETA 5FMBA 1MZ5A 1XQNA 1HRI3 3J7NA 1VBE2 1VBE1
chains in the Genus database with same CATH topology
1SBDA 2YZ4A 2MHFA 3QBQA 4IV3A 5EGMB 3K9XA 1S0BA 5GLZA 1VBB3 1EAH2 1EAH1 2ETEA 3O5SA 4AFCA 2DU0A 4Z0LA 4RRXA 3PMSA 3QLQA 3ZXLA 5KC6A 2Y82B 4RGAA 3J26N 3TB0A 2P3FL 1CQ9A 2MEV3 3POSA 2BFUL 3D4KA 4XL1A 1I6XA 2BVBA 2H9EC 4YW2A 3WOGA 1LQDA 3L2YA 4IEQA 1N3QA 1NQDA 1O3TA 1LHNA 1LKNA 3SOBB 4C16A 1FPN2 1FPN1 1RUG2 1XKBA 1RUG1 2GU9A 4RR3C 5I0UA 2PR3B 1PGSA 2PA7A 3NTBA 5BXXA 2Q1MA 3WW3A 2QFEA 4RSUA 1KXGA 1LOEA 1FSBA 2BUKA 1AUTL 1AVBA 4K7JA 4E4ZA 3BPZA 1S0GA 4ATEA 1B09A 3DKWA 5GLUA 5JLVA 3VZJA 4KWLA 1CAUB 6COXA 4YLZA 3V64A 1D2SA 4XBMA 1S2BA 3WUCA 1J58A 1O3SA 1TEIA 1NA1C 5JZGC 2D5FA 1QXJA 1ULDA 4LMFA 2GZWA 5FMOL 2ZCWA 3FFQA 3UKTA 1BEV3 2D6OX 2Y38A 3VKOA 3N7KA 3WDVA 4MH0E 4FSJA 2AR6A 3APBA 2R49A 1PZ9A 2Z5WA 3IPVA 2KV4A 1G7YA 1ND3B 4UW5A 4JVAA 2FZZL 5T52A 2HWC3 4ASMB 1JHNA 2JG8C 3WW2A 2W08A 4LUMA 5GALA 3V65A 4I01A 2WA3A 3PJQA 2Q8OA 4YYOA 4A7IA 1DQ6A 3ZSKA 1ULFA 4EN0A 1BF9A 3ZXJA 3DGTA 1EV12 1EV11 3MDLA 2GN3A 3HPTA 1U67A 2A3WA 1MQ5L 4OI4A 3HD8B 1DF0A 4GXLA 2BOXA 3JD72 2VQ0A 1FAXL 3JD71 4J1XA 3CU7A 3U07A 2VUAA 1XE7A 4EN9B 4YG6A 2WSUA 5C4WA 2R0FA 2HWE2 1EMOA 2HWE1 4WZFA 2RS32 2RS31 3OLTA 4M00A 1BXHA 4CEYB 4JDOA 2UYAA 4RR3A 4BQ1A 3BT1A 1TOZA 1TME2 3WDYA 1TME1 2J4IB 1D4M2 1PNFA 1SLTA 1D4M1 2GN7A 3WT3A 4YFWA 2PHLA 4KG8A 2DVGA 2D6KA 2I45A 1HIXA 2P34A 3WP3A 1RUJ3 2ZKNA 1J3QA 4A7YA 1C3HA 4NHLA 5JZGA 3GCWE 1NA1A 1C28A 3NV4A 5J37A 3PJYA 4KH9A 1GR3A 1QJY2 4KU8A 1QJY1 1T6GC 4IEWA 4PJYA 4R9AA 4RHV3 4XQ4A 3IDCB 4QPIC 3WDXA 4NN0A 3E97A 2OW4A 3ILRA 3OJBA 3NAPB 1G9FA 4KG0A 2W2QE 1RC6A 4MGZE 4SLIA 2PQQA 5FDBA 3O7OA 3JB8A 2Q4SA 3ATGA 4E4SA 3MW3A 2AYHA 4FXKB 5KHGA 4Y1ZA 2XJVA 4ZKTB 1S0FA 3R4UA 1ND2C 2MHPA 4BHPA 1APNA 4WM7C 4PBOA 4BXWA 2ET1A 4B8EA 3V0AA 3D0SA 2HWF3 5GLVA 1LENA 1LOCA 3PHMA 3G7DA 1CX4A 5FRAA 3UL2A 3CENL 1HW5A 1KITA 2XC4L 4FPGA 3VL9A 3AFKA 1UAIA 4N43B 1WU1B 3E5QA 5EXOA 1UU4A 4ISQA 2GAUA 4JGYA 4XJ8A 1AL0G 2PAEA 3EHKA 3ILFA 1YUDA 2YC0A 4GMP3 2P3TA 4HT1T 2X29A 2D7FA 2ZABA 4RS5C 4W65A 1PZ7A 3VKFC 3ZXDA 1QH7A 4FOQA 2D44A 4XEZA 1V6OA 2NMOA 2ZZJA 3AP5A 4MGYE 3ZPYA 1Q5OA 4OVEA 3MGUA 2UWPB 2W2ME 3S0MA 3ZFFB 3RNSA 1DU3D 5IKVA 4Y7AB 2WKKA 5K0UC 2IXLA 3N4MA 3JU9A 2F4PA 2QCSB 4XFAA 2P2KA 2FLGA 1W6PB 2WNVC 4CDQB 4D0FA 1QXRA 4QPIA 3LA7A 1R083 2RS13 3WG4A 4AQ2A 1KDMA 1IQHL 5FTTC 3E6BA 2YGQA 5ABJB 2XWJB 1BKZA 2E7AA 1KS4A 1ZBE3 2D6LX 1AR63 2W86A 4FPLA 1LU1A 3KT7A 4XIOA 1A78A 1ND2A 3MLJA 3TAYA 3TBDA 3R0RA 1AR92 3FBYA 4WM7A 1AR91 5CAZA 1IQLL 4EN8B 1G2MB 4QQPA 2W26B 4CSYA 4MXWB 3IKWA 1WGPA 4R4ZA 2RJLA 1U8CB 5FPXA 4Y7BB 2OZJA 4BE3A 2W3IB 1WHEA 4BTUA 4S2DA 2D40A 2R062 3ENRA 2R061 5C8WA 2Z79A 4RS5A 1U5IA 1SLAA 5A33B 4AYUA 2XLFA 5A32B 4Z07A 2VWLL 4L9BA 4XLWA 1OA2A 5T3NA 3NT1A 2H6CA 4QPGC 1Q56A 4P9XA 2I9AA 3URFA 2ET7A 2IFWA 3B94A 2OYZA 4YW1A 2XBYL 4MMYB 2BNMA 2XH6A 3RMYA 5KC5A 2WNVA 1ATAA 4ONUA 2BPA2 4UW4A 4AXOA 3H3ZA 3BCWA 2XC5L 2A6YA 2G00L 4BMBA 1XYOA 2RS53 3DF0A 2AGSA 3AKQA 2BFUS 4N53C 4XDQA 1SLBA 1DQ5A 3H1WA 1POV0 2HWB2 2VVEA 3QH7A 2HWB1 4XTMA 4D69A 3SOQA 4GA9A 5DUXA 1OHFA 4IEVA 1HLCA 2P26A 2F6BA 5KHJA 1LCLA 2QDNA 1W6MB 2H0BA 3I7DA 2E63A 3LB9A 3ZYPA 4AI0A 4XMAA 3CLPA 1AYN1 1OI6A 4ZU5A 3P3PA 1O3RA 3R4SA 3K48A 5DDJ2 5DDJ1 3LCPA 3M7AA 5IT6A 5T5JA 2P94L 1K5MB 3M70A 3QMOA 2ZGUA 1KRIA 1GQGA 4Y1VA 1QJU3 4K9SA 2GDFA 3GZTB 2ZGLA 1HCGB 5DZEA 3WZ1A 5C8CC 1QGLA 1R092 2HEWF 1R091 1ZRCA 1LHUA 1RUH2 1RUH1 4KL1A 3ZXKA 1FFMA 4RFT0 4HVOA 2CJIB 1Y9QA 4P14A 3W9AA 5T5OA 2ZX0A 4LO4B 5FMOS 5J48A 3KGZA 3U4XA 4DINB 3AKSA 1CCFA 1LHWA 2A6ZA 4AEKA 1HREA 1PO13 4QPGA 4DFSA 1H1MA 1H4HA 5L7OA 1IGXA 1ALYA 1WMFA 1RUE3 3WQ1A 4YZ3A 1PO23 1SFNA 2QE3A 5DZGA 5GZCA 4BYYA 1F0RB 2BYVE 4FOYA 2A6VA 2GMEA 4ZH8B 4XF0A 5JOWA 4L11A 4NVPA 4XFGA 2ILMA 4YGEA 4XE9A 5FLIA 4U2AA 4XMIA 3ELAL 1SACA 4D3WA 4N53A 2WFF2 2WFF1 1I5ZA 3E5XA 3PLQA 5KXBA 1Y43B 4AVCA 3HO5A 2D98A 5I0TA 5LK7B 4OUSA 4RL7A 4FPFA 1NT0A 2BWAA 2JX9A 2VW2A 1AYM3 1HRI2 2UWBA 1HRI1 3QACA 3USSA 4NOTA 1YFUA 4I02A 3I54A 4AVVA 4Z1VA 5I8TA 1SCRA 5LEKA 3ZYIB 1J3PA 1OPOA 4Y71B 1BVVA 1REEA 3IDBB 4IQPA 4WVMA 2HKXA 1VBB2 3ZYRA 1VBB1 2GC1A 2WIIB 3WG1A 4A7ZA 1DX5I 4LR4A 4OHXA 4XW3A 1VRH3 3HBZA 4FPOB 2WA4A 2MEV2 2VVFA 3KZ4C 2MEV1 3LC3B 4IESA 2VU9A 4O02B 1WCDJ 2RMU3 1HRV3 3CJIC 3TZIA 2EF6A 5BPXA 1N1YA 2Y7ZB 1NLRA 1RUF3 3RDIA 1UKGA 1U5XA 1NFYB 5LRRA 1X50A 1ZRDA 1S0DA 1WW6A 5CIRA 3NW4A 4O1ZA 2WNUC 3LC5B 1XNDA 4COUA 3AMHA 4Q26A 2K2SA 3WDWA 3IJEB 5GZGA 3PTYA 3VBUB 1IQFL 2R042 2R041 2QZ3A 2XB6C 4OUMA 4RRWA 5CADA 4IV1B 4AEJA 3ZYJB 4AEMA 5CKQA 3EO6A 1WW4A 3VBRB 2WZR2 4AVAA 2NQYA 2WZR1 2D6MA 2CL2A 3M36L 4AGGA 1XU2A 1Z7S2 2VJ3A 1Z7S1 1PK6C 3CFWA 4TGFA 4COXA 1OOPC 1MOXC 3AMNA 4HANA 1B9WA 4AHZA 1VLNA 1RHI3 2ZJCA 1I3HA 3ZIXA 2ZGMA 3DPRB 1SZBA 1DYKA 1MACA 3W59A 1PFXL 1CVWL 3MYXA 3NV3A 4QM9A 3TYJA 1Y7BA 4GB32 1MQTC 3BTAA 4GB31 3ASIA 2QNKA 5BNNB 1JV2B 2TBVA 3THTA 3ZFGC 4Y4YA 5FBZA 3CJIA 4HMZA 4QQLA 2EI7B 3VKLA 1D0GA 3OLUA 3X29B 2ZAHA 1W2UA 4GQ7A 2GH2A 2KM2A 1H8VA 1AL23 2ZTNA 2WNUA 4CDWC 4FP3A 4Q4V2 4Q4V1 4MGIE 1GLHA 1VBD2 2WFPA 1VBD1 2UU8A 2ZBJA 4O9EA 4CUDA 1EY2A 1QKQA 1UZQA 1CESA 2YPJA 2PAMA 1COV2 1S0JA 1COV1 2CAVA 3ZXGA 2W3KB 1G9CA 4E1GA 1DDXA 1YUKB 2CWSA 2E53A 1A3PA 4Q4Y3 4JZDL 2WINB 1LEDA 4Q0VA 4IEYA 1MS5A 3UJOA 3INAA 4PLNA 4JCKA 1ENRA 3V0BB 3BPSE 3VBOC 2X8KA 1LODA 4N7UA 3ZN6A 2QJVA 2V09A 3RJ2X 2JENA 3ZYGA 4R9CA 1YIFA 3ZXFA 5CVRA 1PK6A 1W39A 1C8M2 1J3RA 1C8M1 4AFAA 5T5LA 1OOPA 2Y0OA 5BYNA 1TQ5A 4XBLA 1IKQA 1GZCA 4AQSA 4XILA 2UYBA 3NVCA 1CAWA 1DQ2A 3HQXA 2MGRA 5GKAC 4Z2WA 1URXA 1IVOC 2DWRA 2Y80B 2BNNA 1Q8OA 3VKMA 1O5DL 4BIOA 2OYUP 2OUHA 1ATDA 4IEPA 1IHMA 4ORFA 1BMV2 1LMJA 1BMV1 2OYEP 2XHKA 1RTVA 5JI7A 1LB2A 3ZFGA 1PXXA 4BTTA 5JB9E 5H9SA 2YGOA 1V9U2 4CDXA 1V9U1 1RVF3 2P3JA 1EPGA 4ZU4A 2EI8B 1HXS3 1IS6A 3UKNA 2V5YA 4YVWA 3TNPB 1EZQB 4DNYA 4WM8A 3MI8A 4GMP1 3AP4A 3POWA 3IPVB 3N8WA 1JYIA 2R16A 2DUOA 5KIRA 4CP0A 4PDWC 4XQWA 4EWDA 1DIYA 1EQHA 3V65B 3AXDA 4MV2A 2XVGA 4XXAA 2EXHA 4QMAA 3RZZA 5JPNB 5CISA 5HXVA 3MLLA 1ULGA 3M37L 1EAIC 2JDZA 4YM2A 3VBOA 1G9DA 2P3FN 4C91A 2NN8A 5JPMB 4HSJA 4GKYA 4OI1A 3KRKA 2PLV2 2PLV1 1EPHA 1XFEA 2E7TA 4HSLA 3TOJA 3VZKA 3O14A 3ZMNA 1R082 2RS12 2O8QA 1R081 2RS11 2XVLA 5C4WB 2X5IC 2RM23 3GZUC 3FUQA 4AEDC 3KMHA 2A6WA 2BGCA 2Z2SB 1AR62 4XETA 1AR61 1U12A 1HJ7A 1J1TA 4LT5A 1ZA4A 3ENSA 3TWIA 3ZXEA 5C9AC 3D6EA 4JTNA 4PLMA 3QH0A 3UK9A 3FX3A 1XDTR 4I0AA 2NP0A 1DGLA 1FV3A 1N1IA 1NA1B 3MIDA 3MF6A 4Y20A 4XJUA 2BZ6L 4GALA 1AX1A 3IITB 4GIQA 4ZXXL 2WNEA 1PIV3 3NO8A 2D43A 2ZGTA 1UIJA 5BNOA 1QDOA 1NCQC 4MYEA 3KLSA 3U10A 3MW2A 4C90A 1LOGA 4PDWA 3VHNA 3M2MA 1ZZ7A 2XVKA 3VZMA 4X8NA 5IKRA 4HZFA 4LBNA 4S2GA 3R4DB 4XZPA 4DPNA 1GQHA 2XKPA 5ACA3 1W8BL 1BK1A 2O1QA 4U36A 3N8VA 1EGFA 2Y5GL 1OQDA 4XHBA 3V0AB 1LHOA 4CEWC 4HK8A 3BT2A 5F19A 2OUJA 3M3QA 2UWCA 1CN1A 2PHFA 1NZIA 1AZDA 4R9BA 2ZGNA 2RS52 1OQEA 2ERFA 2RS51 2X5IA 4H55A 5AC93 4YVSA 4C0BA 3MFAA 4GULA 4JGYB 4OTYA 4AEDA 4E27A 4L2NA 1IPJA 3DUIA 4BTIA 4IEUA 2W39A 4WVWA 2ZA9A 2JEMA 2JJ6A 2W0XA 4YM3A 1XNCA 4AFDA 4KWKA 5C9AA 3QD6A 5E16A 2CGOA 1POV3 2P3UA 4P9LA 4XF3A 1YWKA 5KN5C 3ALQA 5K0HB 2PHDA 5AVAA 4LLFA 1J1LA 3OY8A 2EALA 5JI9A 1YLLA 4CUEA 3FCSB 1O4ZA 4FTBA 3WXPA 1N7DA 2LUWA 2GALA 2P3KA 4Q4X3 2B8MA 3B9IA 4XF9A 1G8WA 4M01A 5FFOC 1NCQA 3TN93 2IFRA 1RMU2 1RMU1 3LOBA 1FXZA 5IK7A 4YGDA 3S6PA 4YFZA 1UU5A 2ZX1A 1PO12 1PO11 3AJYA 3OBTA 2AUYA 4FPJA 1YHFA 4IEZA 1YJLA 1KQRA 3LAQA 1AR73 1PO22 4UW3A 1F0SB 1PO21 4GH4C 3N8YA 2XC0L 1L3YA 1A8MA 4FP2A 3VBSA 4CEWA 2QQPA 4A3XA 5COXA 2YY1A 3VBFC 4LHKA 1IZ3A 4FM5A 2KB9A 1XYNA 4J6GA 2ZGSA 3WP5A 2NZ9A 4YSFA 1N3OA 2CGPA 3ZSJA 1N47A 1F9KA 1H2KA 1N3PA 1CAVA 1MVQA 3RRDA 1HAEA 4RS5B 1QFKL 4LLOA 1UCXA 5HI0A 1CGPA 3ZFEC 3RI9A 3AMPA 2XJQA 3AP6A 2IXCA 1B35B 3LTGD 2FQPA 4R9DA 1AYM2 2Q5TA 1AYM1 5FDQA 1PGW2 4AI8A 1PGW1 2IXKA 4P5HA 2FMDA 4C0HA 1EPJA 1W6QA 2JE7A 3KCXA 2XJPA 1PRHA