3ZYJB

Netring1 in complex with ngl1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
330
structure length
326
Chain Sequence
YDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFESTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4C
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 63
structure length 326
sequence length 330
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyjB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyjB02
5COXA 5L2ZL 4A7IA 2TGFA 2Y38A 2D1JB 2BQ7A 1IQML 4AQSA 5JB9E 1Q4GA 2Y5GL 3KRKA 3KQEL 3RR3A 3TGFA 1CVUA 1UZJA 2WYGB 2WPIE 2H9EL 2J4IB 4BTIA 2P95L 3KL6B 4Y7AB 3N8WA 1CCFA 1COUA 3BT1A 1LQDA 2DDUA 3HS5A 2VVCK 4XLWA 1LPKA 1DVAL 5JW1A 4ZXXL 4RRXA 4CUFA 1IQLL 1F0SB 5KN5C 4TGFA 3OLTA 3ZYIB 2PR3B 2W2OE 5JB8E 1IVOC 4PLOA 2KB9A 1IQIL 5F19A 4JZFL 2F9BL 1A3PA 1P0SL 2WPKE 5JBBE 1SZBA 4JYVL 1V3XB 2Y81B 3NTBA 1MOXC 3KCGL 3SOBB 3FFGL 1KLIL 2Q1JB 1EBVA 4YZUB 3TH3L 3MDLA 3IJEB 3N8VA 4CSYA 2WFXB 1DX5I 2VWLL 2XBVL 1PGEA 1XFEA 1YUGA 5F1AA 5IKVA 1XKAL 1IQGL 1L3YA 3SOQA 1P9JA 3HS7A 4Y7BB 1AUTL 1BF9A 1DIYA 2XC5L 2WG4B 4ZH8B 2GD4A 3ZYGA 3DEMA 2YGOA 3TBDA 1NFXB 2P26A 3QCWA 5CKMA 3N8YA 1F7MA 3LTGD 4X8TL 2BOXA 3KQBL 2J94B 2P3UA 2J95B 4MMYB 1EGFA 1IQEL 1JBUL 3N8ZA 1NZIA 3KQDL 4Z6AL 2RHPA 5KIRA 2BQWA 3ELAL 1EMOA 2WYJB 1YGCL 1UZPA 2P3FL 2W2ME 1W7XL 3LIWB 4O02B 1CCVA 3GCWE 3TK5B 5IKQA 1YUKB 1EPIA 1ATAA 2XBWL 1EPHA 3BPSE 3N8XA 3U7UG 1TLEA 4ZAEB 1WU1B 1FAXL 3C9AC 1IJQA 2BMGA 4X8UL 2VWMK 1CEJA 4MMZB 3HO3A 4COXA 3CFWA 2KV4A 1EAIC 1Z6EL 4NGAL 1WHEA 3NJPC 1G1SA 1FSBA 1QFKL 2VJ3A 4O1ZA 3P5BL 3IITB 1G2LB 4NG9L 2W3KB 3V65B 2Y82B 3KK6A 5I46L 1ATDA 1C5MF 1HX2A 1FFMA 2B7DL 1NFWB 1EPGA 2EI6B 6COXA 3CENL 1W8BL 3QMOA 3LN0A 1JV2B 3CS7L 1ATBA 1G1QA 1HCGB 3HPTA 4PLMA 2P93L 1IQNL 2VH0B 1TOZA 2RA0L 2Y5HL 1FJSL 1EPJA 3V64C 4JYUL 3QH0A 3R05A 3Q7DA 4Y76B 1MQ5L 5JVZA 1HRFA 1KLOA 2UWOB 2BZ6L 1CQEA 1N1IA 2W2PE 2WPME 1B9WA 2XC4L 3N8YB 2P28B 1EMNA 1G2MB 1Z6CA 4X8SL 5CISA 1F7EA 2I9AA 4ISIL 1RFNB 1PXXA 1NPEB 2FZZL 1KIGL 4YT7L 2OYUP 1CX2A 4RRWA 2W2NE 2J38B 4CUEA 1WHFA 1OB1C 1YO8A 4BTUA 2M74A 2WPHE 3LTFB 2EI7B 1K36A 2BO2A 3GCXE 4LMFA 3MQEA 4YT6L 4MMXB 3K9XA 2KL7A 4BDXA 2YGPA 1N7DA 1IQJL 3TK6B 1HJ7A 1PTHA 3LAQA 2MGPA 2P16L 3ASIA 4ISHL 2CJIB 1NFUB 3HO4A 1EQGA 5CKNA 4JZEL 3LN1A 2UWPB 1J9CL 4Z0LA 1URKA 4E1GA 4XL1A 1G1TA 1U67A 1HT5A 4CUDA 5JVYA 2G00L 4PH9A 1TPGA 1XDTR 2WPLE 1APOA 1LPZA 1HAEA 1XKBA 1LMJA 3N8WB 4M11A 1HT8A 4D0FA 3FBYA 3TZIA 1L5GB 1FE2A 4OVEA 2PUQL 1KSNB 2WG3C 4JZDL 1KLJL 4RS0A 2J34B 1K37A 4Z0KB 4RRZA 5IKTA 5JBAE 4C16A 2Y7ZB 3PGHA 2WPJE 1M1XB 3NT1A 2EI8B 4Y71B 4ZHAB 2Y7XB 1IGXA 5JBCE 2K2SB 4FM5A 3M36L 1IGZA 1ATEA 5FDQA 4BXSA 4M10A 4AQTA 4Y6DB 1UZKA 5EGMB 4NA9L 1GK5A 3HO5A 5L2YL 4ZXYL 3LC3B 3ENSA 4X8VL 2MGRA 1U8CB 2VWOL 2VVVL 1F0RB 2AYLA 3BT2A 1IQFL 1CVWL 2XC0L 4PLNA 3FCSB 1EZQB 2FLGA 2RNLA 4OTJA 3Q3KB 1IP0A 4RUTA 2J2UB 3HS6A 3SOVA 1EQHA 1DDXA 2BOHA 2VVUL 5L30L 2BQ6A 2BOKL 4BTTA 3KQCL 2W26B 2OYEP 2UWLB 3GISX 3F6UL 2K2TA 1IQHL 1ZAQA 1NT0A 5E8DA 3CA7A 4G1MB 4D0EA 1HREA 1APQA 2XBYL 3OLUA 3H5CB 2ADXA 3F1SB 2W86A 4XBMA 1UZQA 1LPGA 3LC5B 2WFTA 3ZYJB 1IOXA 2W2QE 2FLBL 4RRYA 3EGFA 4BXWA 2P3TA 2XBXL 2FLRL 1G1RA 2Y5FL 4D90A 5IKRA 1YUFA 2VWNL 1IOEL 5K0HB 3M37L 2JKHL 1DQBA 2W3IB 4OTYA 1JL9A 2I9BA 1PRHA 1FF7A 1IQKL 1PFXL 1I0UA 2PHBB 4LORA 3U73A 1X7AL 2P94L 5CKQA 2VH6B 2BOUA 1NQLB 1NFYB 4Y79B 4URTA 4BDWA 2Y80B 3SW2A 3POYA 1FAKL 1HAFA 2FD6A 2MHPA 1ADXA 1O5DL 1HZ8A 2P3FN 2NPRA 3NTGA 1MQ6L
chains in the Genus database with same CATH superfamily
1R64A 1VBD1 1PO22 3WG3A 3AVRA 5COXA 4UXAA 4BE3A 1ODMA 4PBPA 2IWGB 4IXLA 3LOBA 4QB6A 2HWE1 3UGFA 1GICA 3WF1A 5FY4A 5L9VA 1YEWA 3T1MA 5JB9E 1UZWA 3HWJA 1Q4GA 2Y5GL 4OI0A 1GZTA 4ZU5A 2JJLA 3TGFA 2EXHA 5CFCB 2W3JA 5DAWA 4BQ5A 1S0DA 1QU0A 2G4IA 2H9EL 4RHV2 3EBRA 3NV3A 3KL6B 2WYSA 1D2QA 5BNPC 5C71A 4QDQA 4Y7AB 1W2TA 5ANNA 4QXCA 2P6HA 4OLLA 1L3JA 4YZ3A 3THPA 3ZX7A 5FZAA 2D93A 1GQGA 4L99A 2OS2A 2NYYA 2VXJA 2KR2A 1OXCA 1XC6A 4AEDB 4IV1A 3RJRA 5HPOA 1LHUA 1ZZ8A 4NRPA 1AYM1 1UU5A 2J1UA 4QX3A 4XYXA 4BYYA 1W8HA 4DRVA 3FJSA 3V64A 4BA6A 2F6BA 5JW1A 4RRXA 1OKOA 4GWNA 3T4HB 4CUFA 1ULDA 1IQLL 2CYFA 2DCTA 5DZFA 4B4RA 5ABJA 2UWAA 3FN9A 4LUMA 1JYNA 1MS5A 3WVJA 1UYYA 5KN5C 1F5JA 4LO8A 5GALA 3ZYHA 3OLTA 2WN2A 3Q8BA 4Q4W3 2DWRA 1F4AA 1MEC2 1ZZ7A 5JB8E 4IETA 1OSGA 2DTWA 5F39A 5JSOA 1VBE3 5F19A 2HWD1 2R063 4K40A 5CYYA 4JZFL 1P0SL 5I0UA 2LW8A 3VD5A 4CEYB 3GALA 1XQNA 5DG1A 1QY4A 4CDXC 3LKJA 1U5XA 5C4WC 2GNTA 4JDOA 4JYVL 1H1MA 3I2DA 4YVSC 3TNQA 4EZHA 1E5SA 2NMNA 5A3NA 2A3WA 1SDWA 4JVAA 1G86A 1PM4A 3BOPA 4RL7A 2EICA 1BQPA 2MEV1 3H3LA 4YZUB 2VECA 3KQ4B 2BT7A 2AENA 1LESA 4LHNA 1NYWA 2L9LA 5CBLA 3IJEB 2GMMA 4C8DA 4HN1A 3R0RA 4AHXA 2WFXB 1XSRA 3LPGA 4XEZA 3KB5A 2IXCA 4LA3A 5L19A 1Y4WA 2DU1A 5KXCA 3A22A 1UKRA 3FX3A 2WNVB 2XBVL 4XF4A 1YUGA 5IKVA 5F1AA 2VQ0A 5F5CA 3I3MA 3S6XA 1VBA1 5FYHA 1IQGL 1L3YA 3WUCA 2ETEA 1JYCA 2NZ9A 3W9AA 3ZFEB 1P9JA 1EAH2 1AUTL 3R4SA 3A0NA 1RXFA 3ILNA 3ACFA 3C7OA 4QPIB 5FLJA 3GM8A 1QXJA 5FUPA 4WVWA 4EN0A 2X5IC 1RUJ3 1PNGA 2FDFA 4QQLA 3DEMA 2QZ3A 1HRV1 2P26A 1NCQC 2P37A 2Q5TA 4DO0A 3SKJE 4XF3A 2J1EA 4PQQA 2WT0A 2OT7A 1X8MA 4TZDA 1UAIA 3V0BB 1SBFA 2GU9A 2VCAA 3AZXA 5FRAA 3S5AA 4TYSA 1GZ9A 2WRAA 1KFXL 1SBEA 1RUD3 2RM23 1IQEL 3BI3A 4M01A 4IEQA 2A6ZA 1JOJA 4RS5A 3VZJA 3N8ZA 1IS5A 2OA2A 2JENA 3TAYA 3X29B 5JSRA 4WM8C 4ITCA 1AL23 4Y24A 4ES8A 1FYUA 1V9U1 3N9PA 4LK6A 4NPMA 1DYKA 3J7MA 1ACCA 3GZUC 1TE1B 4D6RA 1DBNA 2K9ZA 5KR7A 4CCNA 1FOD1 4IEZA 4WVMB 2QBXA 4CDQC 5J09A 4A3ZA 4AF9A 2YYOA 4CP1A 2Q8OA 4TTGA 2W08A 2W0XA 3N35A 3SNMA 1YWKA 4FAHA 2G9GA 1LOGA 3TK5B 2R49A 5F3EA 4FTSA 1OHFA 2JDMA 3VBRA 1HB3A 1LOFA 3FUOA 4ZS2A 5IW0A 3T08A 1ATAA 5IT6A 1DQ2A 2XBWL 1NCRA 2VNOA 3VKLA 4FFGA 3BPSE 1GUIA 3B02A 3AMMA 2A75A 3OD4A 5IHRA 3K4DA 1SLBA 3AP9A 2PLV2 1WU1B 3CJIC 2IFWA 4DXZA 1UY2A 2RJKA 1CX1A 4WZCA 1ULFA 1ULOA 4X8NA 5FMOL 3PJYA 3RZLA 2X10A 3IMMA 5CVRA 2QQPA 4M00A 2XLAA 2BWAA 3KVAA 3UL2A 3MBWA 1QH7A 3EYPA 4X8UL 1FMD3 5A3LA 1JS9A 2HBUA 5TSWA 1U5IA 4COXA 2VZOA 3N3HA 1MZEA 1POV1 2WS93 3ZVXA 2P4EA 2E51A 4BH9A 2FDIA 1RB8G 1C8M1 1DYPA 5F3GA 2D43A 3HT1A 3TB0A 3VHOA 5LRSA 3KCCA 3POBA 4PQ9A 2HOXA 2IXJA 1SFNA 2C26A 1Z6EL 2HWB1 5IVEA 4G9SB 4OUEA 1OBNA 2GN7A 4ZZ8A 5BYNA 1FSBA 5A7WA 5C3PA 2B4KA 1QFKL 2GALA 4MXWA 5A80A 4H55A 1UXXX 1KITA 1YIPA 2Y34A 4O1ZA 1GU3A 1F31A 3P3PA 3GDBA 3DPRA 3POJA 4JHTA 4FT8A 4QPGC 1LEMA 5A6YA 3AFKA 3RSJA 1D4VB 2W5FA 1G2LB 3NV2A 1C5IA 4WM7A 4W65A 4IEUA 4BQ2A 2N7GA 5FP4A 4CU6A 1C5MF 1WD4A 1NFWB 1O8PA 2EIEA 4M3CE 5FZ1A 2RS33 4R8HA 3VBSC 3SLIA 3WHUA 3CENL 1APNA 1W8BL 3A0KA 4N43C 3WP5A 1WW7A 1PX3A 1ATBA 1CAVA 4XFCA 3ME2A 1ALYA 2HORA 3GCXA 4Q4X3 3SCGA 1A34A 2VXRA 2VTFA 4PDWC 1PVC2 5JZGA 4PLMA 4M4PA 1LB2A 5L9BA 2VNRA 2RA0L 1YC61 2Y5HL 4FP3A 2D6MA 2XWBB 4HKWA 4QWNA 1Z78A 3SHRA 4LA2A 1QJY2 3R05A 4GD4A 1OI6A 5D8AC 4UFMA 3T30A 4YZ2A 3O0XA 1HRFA 2Q30A 1KLOA 1HV0A 2UWOB 1M06G 1PIV2 2QDNA 2W2PE 2WPME 2KNIA 2BPA2 1B35A 3AP7A 1QNWA 2YU2A 4BDVB 4AFBA 4AVVA 4NMIA 3WF4A 5CISA 3KVBA 1F7EA 2R32A 4ISRA 5T54A 1ULEA 4A7YA 1XBFA 4OHVA 1WGPA 1WCDJ 2ZEWA 3WDVA 4JCKA 1NPEB 2DVGA 1S0EA 4N53A 4CU9A 2RS52 4DB5A 3DYMA 5C3OA 5FPZA 1NQJA 5FP9A 4LR4A 2KA3A 1YI9A 3I3DA 4MGIE 2W2NE 2X09A 1PK6B 3NQHA 4JGYB 2ADDA 1C5HA 5FZBA 4CXXA 5SV5A 2BDRA 2PYTA 3QACA 2XJPA 2GSYA 4BM8A 4GJYA 2VOXA 1C4RA 2ZEXA 4LBQB 4D6QA 1C1LA 4Q4W1 3BIEA 5FJHA 1NUKA 3MQEA 4YT6L 4M0NA 2W47A 4MH0E 3TWIA 3VDCA 1VBE1 1SFYA 2R061 4TXWA 1OD5A 4UYBA 2KL7A 4OI2A 4PI0A 1YJLA 2W2IA 4XBNA 2ZHNA 4GQ7A 4HVRA 4QGMA 4ONUA 1IQJL 1C3HA 1EYBA 1MS1A 1NAEA 3HMYA 4JHZA 1K5MC 1VBC1 2V4AA 1RMU3 4GMP3 2P16L 3ASIA 2TEPA 4MGKE 4Q8LA 3WLUA 1LHWA 4XJZA 3HO4A 1K5JA 2QQVA 4YARA 3WINE 5BPXA 4H3WA 4MO3M 4IEXA 1W2AX 1DLCA 3PVEA 3U75A 3V0AB 4PHZA 1HN1A 1A78A 1VBB3 3ZSKA 5I0TA 1IPKA 2CWMA 1ND2C 1V6NA 1ZBA2 1HT5A 1OOPB 1TNFA 4K3UA 4QPYA 5F37A 4I2OA 1JH5A 1LTEA 1HRI3 1N1TA 5T50A 4HFSA 1OVPA 1VBD2 2WNOA 4JZRA 2XR4A 3RQ0A 1Q3EA 3K2OA 1O59A 5F5QA 2HWF2 3RG0A 5EWSA 5GJ6A 2ARCA 3ZFFC 5LEKA 2YGMA 5JXGA 4DY3A 4NIIA 1APOA 2JDNA 4AFDA 4L2NA 2OQ6A 5G04L 4CCDA 3E1F1 2ZGKA 4RR3C 3NNMA 1XKBA 3VL8A 3N8WB 5DZGA 1XB9A 1RUJ1 3ORJA 3MV11 4LBLA 5F8PA 1TNRA 3I4IA 4UW5A 4Z1VA 4QDRA 1L5GB 3RMYA 3S30A 1REEA 4Y22A 3OBAA 2J1AA 2VMCA 2EA7A 5BNPA 3B00A 2PUQL 1Q8VA 2RG4A 3D3AA 2MNGA 2XG3A 2BSFA 3KV9A 3WP6A 3B69A 1RUD1 2RM21 1ZA4A 1XE0A 1K37A 1FATA 1LKNA 1NA1A 1ZX5A 3LEKA 4IL7A 1AYM2 4BCUA 2A1XA 2RMU3 3N7MA 2C4XA 2DFBA 1XU1A 3PURA 2VNVA 4Z82A 2WPJE 5JOXA 1M1XB 5L36A 5L7OB 4NHKA 1PO13 3KZ4C 2JXAA 1YYNA 5C8CB 4GH4B 4JKLA 4UFIA 5DAXA 2Y7XB 3INAA 4P9IA 1IGXA 3HBZA 4FM5A 2HWD2 3DXTA 2FDGA 2QCSB 3EHKA 1W8UA 5A7NA 3CF6E 3IT8A 4XPVA 5F2WA 1ZA7A 3MW3A 1QJFA 2NMOA 4FPJA 4NA9L 1SPPB 3MGUA 1OUXA 1RUF3 3MIFA 5J98B 1Q8QA 1IPSA 1GK5A 3WSOA 4B8EA 1AR62 5C4WA 1X33A 1GZWA 4YVSA 3RYRA 3ZN6B 4DXSA 1BK0A 4JTNA 4NUBA 1DGWA 1T2XA 4XJWA 4X8VL 2BGCA 3OSDA 1W8WA 2MHFA 2VVVL 3KGLA 3RJ2X 2CGOA 4V2WA 1IGOA 3BT2A 4FTBA 1QXPA 3KCXA 2PHLA 1IQFL 1RXGA 1CVWL 3URFA 2VMHA 3THTA 3WF2A 1HLCA 2WZR2 2YFZA 2FMYA 3FCSB 3T1LA 1EZQB 3WUDA 3KV5A 5KHHA 4B1MA 3BKZA 3HR9A 1GWMA 1ZREA 4GJZA 1HX6A 1GSLA 3Q3KB 2Q8CA 2QJVA 1FMD1 2WT1A 2XQRA 3G7DA 4KWUA 4DFSA 3OPZA 2J2UB 1MQTA 4Y4YA 4EYUA 1EQHA 1VBA2 3SKVA 5IYYA 2VVUL 2BOHA 2CNAA 2WS91 4R52A 1NLQA 4CCLA 1ONAA 1V6LA 2HWC3 3GGLA 3ACGA 1MS3A 3PTRB 2OYEP 1NXD1 1H8TB 1UU6A 3K75B 3NNGA 1DHKB 1BEV3 3F6UL 1QDOA 1IQHL 2X5IA 1EV13 1ZAQA 2Q0AA 3LFMA 4PI2A 1NT0A 1HRV2 2GH2A 3DN7A 4U36A 2CGNA 3IDAA 2C0ZA 3P6BA 4AGGA 4JGZB 1NCQA 2LTNA 5IAXA 1ZRFA 3LSEA 4RSUA 1UO9A 2DCZA 2D3RA 4LO4B 1QJU2 1Z7S3 3ETQA 3N7KA 2Q4SA 2VG9A 3BOWA 3LIGA 4D0EA 1BZWA 4LXLA 1M4WA 4HANA 1OT5A 2Z79A 1LHOA 3GJBA 3THDA 1BCXA 3OB8A 5DUVA 3IPVB 3WOGA 4UW6A 4CDUB 1XRUA 2FZ2A 1WKYA 4BQWA 5J1XA 3F1SB 1Y3TA 3P3NA 2PMWB 4WM8A 4AEDC 4E4SA 5LY1A 1V9U2 2ZS6B 4AR2A 5A32A 2YC4A 1BK1A 3NW4A 1COV3 2VZTA 3O1PA 1RJ7A 2RS31 2ERFA 4HK9A 4S2GA 4XBMA 5BV6A 1FOD2 2ZJCA 1UZQA 2DYCA 3N9NA 2ZX2A 3GYDA 4L0PA 2Y64A 2BVVA 4CDQA 4FFHA 4Q4X1 4XMIA 2WFTA 1H0BA 2YXSA 4RFRB 3WG4A 3HNMA 4QU1A 2BNNA 5BXXA 1L7LA 4YW1A 4OUSA 1YUDA 3N9MA 3HN1A 2FLBL 1DZQA 3BUCA 4XABA 5JR2A 4Y1YA 4CXYA 3S0MA 3B01A 4BXWA 3D5OA 3I2OA 2FLRL 1OQ1A 3JU9A 3LEMA 3RYPA 4FOQA 2R073 5FXVA 1V1IA 3ZIWA 5GM0A 3RI8A 2G19A 5DDJ3 2BZDA 2JG9B 3VL9A 2VWNL 1YUFA 1W6MB 5K0HB 5DUXA 2FDHA 2XUMA 1JZ5A 1SLAA 1DQBA 3CJIA 4MOAA 4OTYA 1JL9A 4YGCA 3DKWA 3FHAA 4YPJA 5EHDA 1PRHA 4QXBA 5FZ8A 5AC93 1LCLA 3VB9A 5BNNB 1I0UA 2PHBB 3OTFA 2P94L 2ZX4A 4FOWA 4Q0UA 3T3YA 4CUCA 3LA7A 2OZJA 5I8TA 3CEWA 4QHZA 4YG3A 2X8KA 2WNVC 1NQLB 4I3GA 2ZEZA 4QGNA 4Y79B 4URTA 3VDDB 1DDLA 1C8M2 3POIA 5FYTA 2FD6A 5GKAC 2ZHMA 3ZFEC 4H2AA 1O5DL 2BGOA 2QQLA 2VULA 3POFA 2GNDA 4QPIC 2J42A 2HWB2 5LBCA 1W6OA 5AFEA 3CZUA 4K1ZA 1MQ6L 1W6NA 4YZ5A 4OQ8A 3GZEA 1JU4A 2CDOA 2VZQA 5C33A 4ZKTB 3A4UA 3B7MA 3WDTA 1UL9A 2JIGA 3BALA 2QKDA 3WNOA 1H2LA 3NWKA 1X36A 4XDQA 2TGFA 2Y38A 4Q2FA 4D7YA 2WBKA 5FZMA 1VIWB 4JV4A 2BQ7A 1ULPA 2FDJA 4QPGA 5AVPA 5T5JA 1RMU1 4XE9A 3I2FA 3SH3A 4EJRA 3KHBA 1RVF3 2WQ8A 4B7KA 3QOPA 3T2TA 1YNAA 1CVUA 1UZJA 1F8VA 1NY71 3J4UH 4CPBD 1LULA 1MPXA 3PMEA 5K9YA 2W92A 4A6OA 1UF2C 1V70A 1VBB1 1S0FA 4GULA 3VBSA 2I45A 3ZFGB 1BYHA 2C9KA 1YXWA 2GNMA 1HRI1 3KGZA 5HXVA 3RS6A 1W6PA 4PDWA 2AYHA 3ZR5A 1JZ4A 1QNYA 2JDKA 1GWLA 2VD7A 3NV4A 5A3MA 3M4FA 3APBA 5DUWA 1P8JA 3D8CA 4XDPA 5SV8A 3M3EA 1LPKA 2BRTA 1DVAL 2E7TA 2WR9A 3HAGA 4CYDA 1PGL2 2WFPA 3QH7A 4XTPA 2BTVC 4Q0VA 4ZXXL 1QXRA 2WWUA 2Y8KA 1YFXA 4IERA 3TYJA 2HH9A 4KG0A 4TGFA 3CNAA 4XAEA 3EJKA 4I0BA 3SC7X 3Q8CA 1JZ2A 4PLOA 4N9HA 3JB4C 5FYYA 3PVNA 4K8FA 3MF9A 3TEZA 2B45X 3ZR6A 1RUC1 1ND3B 4FPGA 1W04A 3OOXA 1LAJA 2WZPP 5JBBE 3HN3A 3KQRA 2ARBA 3LWCA 2XKOA 4GWIA 3MZHA 1QJX3 2WABA 2WDBA 4J1WA 1KD7A 2W95A 5LRRA 4QB2A 4CU8A 4HKOA 5FMCA 3KV4A 1JYIA 1PZ7A 3NTBA 2K2SA 3KCGL 4N7IA 2E26A 2RMU1 4QQPA 3FLTA 2O14A 1UPSA 3WT3A 3OBTA 3H1MA 1HB4A 5CFDA 2DCKA 2W1WA 1PO11 1DCSA 4XHXA 4UOJA 3VKNA 3TH3L 3W5MA 2WUHA 1DYOA 3NRUA 3VBUB 4E2GA 4YM1A 3MDLA 4KGGA 2CAUA 1W06A 5I91A 3OYWB 2QQIA 4DNYA 2E7AA 3GBGA 4B4QA 3OCPA 4BISA 3K3OA 1HV1A 2JICA 1RYYA 2XVLA 1KEXA 3I59B 4UT5A 4K9SA 2VCBA 3DYPA 4N8MA 1YQ8A 3ZOIA 1RUF1 1VBC2 1XOYA 1BF9A 4FP2A 4Z8BA 1K5MA 1WMXA 2C6SA 2ZGLA 4CDWA 1DIYA 1BHGA 1JYWA 2WG4B 4ZH8B 5JMCA 4NAOA 1Y7BA 1AR93 2JD9A 4AAPA 4K21A 3QD6A 1GQPA 3OEAA 1UY1A 4IV3C 5FLIA 1NG0A 3WF0A 2F4LA 1YQ5A 3N8YA 5J96B 2JD4A 1WLWA 3NO8A 3D0SA 1ND2A 2R1DA 3ZXAC 4OMCA 3UETA 5JPNB 2J94B 2J95B 2WWJA 4RA0A 3C7HA 3OY8A 5HXMA 4MMYB 1CAWB 5A33A 4NIHA 1HIXA 2BWCA 5HV4A 3HD8B 1UW8A 5D21A 5A3UA 5ACA3 5T52A 2XJRA 4Q4Y3 3ZFFA 1X7NA 4M3CA 4I0AA 3U37A 1KQRA 2HWC1 1H6YA 3I2HA 2F17A 4AI1A 1R091 1WUVA 1V0AA 2BQWA 1JUIA 5LA2A 1LOBA 1UYZA 4E4ZA 4E27A 1VLNA 1VP6A 1BEV1 1W2NA 4GWJA 3MI8A 3WG1A 1EV11 4UF0B 2EXKA 4CSWA 4MSVA 2IXLA 3BCWA 2A6VA 3AK0A 3IAQA 1MZFA 3ZMNA 3MIEA 2P34A 1VRH2 1UZPA 1V6MA 1W9TA 3WQ7A 2XH6A 2JJ6A 2ZKNA 1QOTA 1ULCA 3OF1A 2OPKA 2YGQA 3LIWB 2QTWB 4HPKB 5FZ9A 1TZOA 1I5ZA 5JMOA 2RV9A 1RUD2 5IKQA 2RM22 1G6NA 2YG0A 1W99A 2PAEA 4GIQA 5I8YA 5JR7B 3HNBM 3AL6A 3K51A 1DGRA 3N8XA 3W59A 1VAVA 1AR73 4CCOA 4IEYA 2EIBA 3H1WA 1W6QA 3DXUA 4QPWA 1QQP3 3I2IA 4QX0A 4YFZA 2ZXQA 3FHIB 5F6KA 1COV1 3AXEA 4AFCA 2P3KA 4P9XA 1V6IA 1PK6C 5FP7A 5IVJA 5IK7A 2ENRA 5L73A 3C9AC 4YM3A 4MGQA 4M4RA 4A4AA 1PVXA 2SBAA 4B7EA 4QT6A 2IXHA 4LBKA 2BMGA 2VOWA 3LAGA 3MDPA 4KQ7A 5AFBA 4LKFA 1CEJA 1AX1A 4BWOA 1A3KA 2DCYA 3HO3A 3IMNA 5G05L 4U2AA 1S4CA 3T4VA 1BBT2 4AFAA 2IXKA 2D97A 2J1SA 1KS4A 2WZ8A 1X8EA 2AEZA 4I02A 2R071 1GR3A 2V72A 2VTXJ 4FTEA 2E6VA 5DDJ1 1H2MA 3BYWA 3C7FA 4OHZA 5ABJB 3UK9A 4W8JA 3EQEA 3EXUA 4PIYA 3NJPC 4CDWC 4CEWC 1CJPA 2BERA 3LCPA 4CP9A 5I8SA 3L9JT 1VMHA 1J84A 2ZGSA 5JVVA 3RZKA 3UGHA 3E6CC 2VJ3A 5AC91 3U0ZA 1OOPC 3P5BL 1IG0A 4PBOA 1FMD2 4ASKA 3WNLA 2J7MA 5KHKA 3RZHA 2R0HA 4NG9L 2FDKA 2YC0A 4NR1A 3T2QA 2WS92 4EN6B 4OUMA 1OURA 2JDZA 1RUH1 5I46L 1W8OA 1YJKA 1FFMA 5FY1A 4QD2A 6COXA 2EI6B 3I2KA 4KU7A 3O0VA 1LHVA 4IEVA 4W6XA 2JECA 3LN0A 1J83A 4HVOA 1VR3A 2R0FA 2R30A 5C7GA 3GZAA 4KH9A 4LLOA 5FCCA 5FYUA 5F7UA 5B2GB 5J37A 2ADEA 1FI2A 2P93L 3RDIA 2VBDA 2W1UA 4XW3A 1BMV1 4C0BA 1TOZA 4EROA 1O4YA 4LO6B 4GZ9A 2A5ZA 3M3QA 3ZPYA 4JYUL 5BNOB 1AF9A 4MHRA 3Q7DA 1RVF1 2ARAA 5CEHA 2BW8A 1CPMA 1G7YA 4QB1A 4AEDA 1N1IA 4AGRA 2UWCA 1OQDA 4Q4V3 1DGWX 2XC4L 3ZXJA 5IATA 2EIDA 4QXKA 2RS32 3LA3A 1EMNA 1G2MB 1Z6CA 1AR81 4GKXA 4RQPA 1GOGA 1DQ4A 2XBO3 2Y0OA 1FV2A 3NSTA 5D1IA 3USUB 4HSJA 4COZA 2AZ5A 2TBVA 5L7OC 3AYCA 4Q4X2 1PXXA 5C5TA 2PQSA 4FVVA 1SQ4A 2OUJA 4KBZA 2D3PA 1ZZ9A 4IEWA 3VBOB 2ZAAA 4DUWA 5C8CC 2YFUA 4GH4C 4DZGA 3ZO0B 1RL3A 4AXOA 4YT7L 1R083 2VAUA 2W1QA 2ZGTA 3JBG3 4QKFA 2JDHA 1CX2A 4XFBA 5C3SA 4LO5B 2WAAA 1D4M3 2J38B 4CUEA 5FMOS 4P5YA 1WHFA 1S2EA 1CAXB 3TEWA 1YO8A 4YW2A 5LCWL 1RUE3 3JD73 4AL9A 5A70A 2ZKLA 4MYEA 5FPAA 3HIFA 1JN2P 3O1VA 3I3BA 1IS6A 5FZOB 2CWSA 1DG6A 1AYN3 2YGPA 4FPEA 4PIZA 1GYKA 4XMAA 1CWPA 4Y5TA 3HQXA 2G9ZA 3VBRB 4Z07A 4DMIA 1QJX1 1PTHA 2XONA 3DKQA 1NCRB 2XJQA 3ZYPA 4ISQA 1NFUB 1IKPA 1OA2A 2WNVA 3ES1A 2YY1A 1FNZA 3HOBA 4XJ8A 4YW6A 3LPFA 3RI9A 2B42B 2O0OA 1PMIA 1K42A 2UWPB 1A6CA 2E7QA 4G3YC 3WCSA 3WQBA 2BNMA 5IUQA 1HXS1 5E6HA 2XB6C 2QUOA 3BU7A 1BVVA 1TG7A 2AGSA 3K46A 3T0AA 4AWDA 4W6YA 2WL1A 5CIRA 2ZZQA 2ZCWA 3KM5A 1SCSA 3LGRA 4FCAA 3U4SA 4ARXA 3W20A 2C24A 4PCRA 4LLFA 4JAAA 1IG3A 1UQXA 2PHUA 5EV7A 2RS13 3TN93 1O8SA 4AYUA 2JDUA 5F3CA 3VD9A 4IDZA 1EP0A 1O3TA 3E6DA 4FXGB 3O1MA 2KXLA 3VZLA 5JPMB 1PO23 1XDTR 5EYXA 2PHRA 2VUDA 3OD0A 1RMU2 3AKQA 3V0BA 4CXWA 3VZMA 2BFUL 4O61A 4M11A 5FZ4A 1HT8A 4CDUC 4D0FA 4XAAA 1AR91 1E5RA 1NY72 4AZZA 5C8WA 5JLVA 1VBB2 2ZGNA 4L11A 4M0HA 5A7WB 1SLIA 3SH5A 3SISA 3B5LB 3VD7A 1FE2A 4F3JA 4FBFA 1QJZA 2R042 4Q1PA 4RHV3 1TME2 3LEIA 3KF3A 4GB31 1GZCA 5KXEA 3AYEA 3NJYA 1HRI2 3ZM8A 2RDQA 2VR4A 1VRBA 3DPRB 3H8UA 4HL0A 3MIDA 2VUJA 1OA3A 4P02B 4RS0A 3WZ1A 5I0DA 2J34B 4Z0KB 2B46X 3JXSA 5FUIA 5A7OA 5ACA1 4Q4Y1 4HZFA 4K6BA 2D6NA 4P9WA 4HG6B 1RUI3 5JBAE 3NAPB 1N3PA 5APAA 1GNHA 3ZYRA 4AE2A 2DUPA 2XJSA 5LEJA 3ZYBA 1JOBA 2JDAA 2ZHKA 2VOTA 4OYUA 2AH2A 2WFF3 3RZZA 4BMBA 4EWDA 1DP0A 4WVZA 3RYKA 4R4ZA 2VMIA 2JG9C 2Y6JA 4ZHAB 4A3XA 4KWJA 2A6WA 4QKBA 3ZSEA 4LPLA 5JZGB 5JBCE 1AX0A 1CD3G 1IGZA 1IKQA 1HQLA 4X6QB 1RUC2 1XNTA 5FWJA 1ATEA 4BXSA 3DGTA 2WQ4A 1F4HA 1FX5A 1SCRA 4C90A 2VL4A 5FZHA 3BTZA 4A94C 3IBMA 2AUYA 2JB4A 5BNNC 3TEYA 2YV8A 5B4NA 5CG8A 5L2YL 4AQ6A 4XCAA 5EP9A 1J3RA 1AR71 4XUTA 1QOSA 2B7YA 2P3YA 1B35B 5I0RA 3ENSA 1QQP1 5A3WA 3S7EA 1J3PA 2OW4A 1U8CB 2VWOL 1X9PA 3E6BA 3VDDC 1Q8SA 2D6OX 3U78A 1PO12 4YVWB 4K8RB 4QAWA 1WBLA 2JE9A 5JCTA 4PT6A 2XC0L 4FQZA 4PLNA 1QKQA 4QU2A 5FMDA 3RGBA 1UX6A 5FKCA 2FLGA 2ZX1A 3L2YA 3WQ0A 1IP0A 2WNUB 5E89A 2YGLA 4CUBA 1VMJA 4W50A 2XLFA 2R1BA 3AJYA 3MIHA 3EMRA 3BB6A 3KT1A 4P00B 4D7TA 2BOKL 1US2A 4BTTA 1V6KA 1PMHX 3ON7A 2W26B 1EPWA 3ZYFA 1EAH3 1ZRRA 3IIAA 3KD4A 4AQ2A 1SHWB 5FUNA 4LIVA 4NRQA 3D82A 1ENXA 4IV3A 1K45A 1DF0A 2JG8B 1IOAA 2C1FA 5E8DA 2GN3A 1GMMA 3GHNA 4B4PA 5FP3A 4UFJA 2YPJA 3CA7A 4G1MB 4ZXKA 1HREA 5A1LA 3ZFGC 2BQPA 3OPWA 2XBYL 3MICA 5FZCA 4AVBA 4A45A 2HEYF 1EUUA 3ILFA 2I07B 1CZTA 2GC2A 1W8NA 3TEXA 4P14A 3WR0A 1JHJA 2XHKA 1RHI2 1R092 2LRPA 1URXA 3GCWA 3H42B 3ACLA 3T0DA 5HCHA 3MW2A 4IGPA 3SITA 3VHPA 3NKGA 4NHXA 2ET1A 2ZMNA 4BOWA 1IOXA 2XJVA 3AZVA 3VBHB 1PNFA 4LBQD 4IGQA 1N1YA 2VPVA 3OGRA 2W94A 5K0UA 1HJGA 2P3TA 3IM0A 1RINA 1SMVA 4AOCA 5FKBA 1ND3C 1G1RA 4LKDA 4AVCA 1TVGA 2GMEA 4I09A 4JQTA 4A41A 4CUAA 4NO4A 2VGDA 3IDCB 4D90A 4LK7A 5IFTA 2D6KA 4XJUA 3M37L 3IKWA 2CHHA 4LBOA 4Q4V1 1COV2 4META 2JKHL 1OFSA 4QGLA 4D3WA 4DUXA 1ASJ3 4JX0A 4Y22B 1PK6A 4KBBA 5BNPB 2XBO1 5IK8A 5FZFA 4KWKA 2XXZA 3AJZA 3RPQA 2HWE2 1OFNA 5FQ0A 2RDNA 2WC2A 2ZAHA 1FF7A 3NVCA 1IQKL 4UFKA 4XC9A 3VBUC 3I97A 3MLLA 1X7AL 1NA1B 1QGLA 1UMZA 2NLRA 1R081 2QQJA 3JBG1 4I30A 4NHMA 4OCTA 4UAPA 4OI1A 3ZDVA 2BOUA 2VVEA 3K77A 2P1BA 2FBEA 3CO2A 1D4M1 1S0BA 3ECQA 3MLKA 1W2OA 4MGSA 1FAKL 1G9FA 1Q8OA 5J48A 1R1A3 3VZNA 1HZ8A 2OX0A 4FFFA 5EXOA 5JI9A 1RUE1 1SLTA 1NLRA 2P3FN 2PHFA 4IGOA 4CEWA 2UU8A 3V0AA 1KS5A 4D8MA 3UGGA 2DVAA 1W90A 3WDXA 4O65A 1MS0A 2ATFA 1AL21 1AYN1 5IJRA 1JZ6A 3K4AA 1H9WA 5FQ0B 5DN2A 1F2NA 1OOPA 1ZNPA 3N9QA 4O9GA 1WMDA 5LK5A 4AQSA 1GZWB 1H6XA 2Z4FA 4FOVA 4LE3A 1MS8A 1DGLA 3KRKA 3NL1A 5LK7B 3KQEL 3RR3A 1BKZA 3AYAA 1RUH2 1PGW1 2VC9A 3PU3A 4A42A 3ZXDA 4HXCA 5C9AB 4AI2A 5A1AA 2J4IB 5FPBA 1TQ5A 1ENRA 1W3VA 1CONA 1YFYA 2ZGRA 1UXZA 3N8WA 2GC0A 4XUOA 1CCFA 3UV9A 1COUA 3BT1A 1GWKA 2WNEA 1LQDA 3FL7A 3H50A 3LB9A 3NNLA 3OUJA 3AX4A 2DDUA 2JKXA 3TOJA 3HS5A 3TN91 2RS11 4CDXA 4EN7B 4EQVA 5E16A 1MQTB 4X6RB 4AVSA 1BMV2 2RR13 3NV1A 5JXHA 2VVCK 1PVC3 1XE7A 2DCJA 4NOTA 3GBWA 2WAOA 5FFOC 4XUNA 4FO9A 1IQAA 1ZM1A 2MEV2 2B9VA 3ZSMA 1MR5A 2J1VA 5DABA 4COWA 1RVF2 4TLGA 5FZ6A 2GDFA 1HQNA 3PLQA 2X5IB 1Q43A 3W5NA 4NPLA 1W3XA 4LNVA 4YGDA 4C0HA 3E5QA 2WSVA 1C1FA 1MACA 1OC1A 5FDBA 2BBAA 3B93A 4JDNA 1NCQB 1AR82 1PIV3 2A73B 3FLPA 4HT1T 3UJOA 1FPN3 4MHUA 2VBPA 1IVOC 4YM2A 2KB9A 1JXNA 3MIGA 1IQIL 4HOOA 1LODA 4XJAA 4B1LA 2AACA 3M1HA 1G9BA 3MIBA 5L7OA 3J7NA 1A3PA 1UYXA 2FCVA 3POWA 1BVP1 4IEOA 4QMAA 2F4PA 4GA9A 3N4MA 1O6UA 1TMF3 1SZBA 2IVIB 1YQ2A 3LD8A 1OLRA 4GH4A 5C8CA 3GF6A 1V3XB 2Y81B 3VN4A 3J9SA 2LALA 1MOXC 3DF0A 1UOFA 2W39A 3SOBB 4P08A 1IZ3A 5EPAA 4YW5A 1RUI1 5CFCC 3FFGL 1SG3A 2Q1JB 4EE2A 1JYVA 2X29A 2WFF1 4OZOA 1ST8A 1EBVA 3DECA 4XFFA 2J1TA 1UZYA 1WLDA 3HEIA 1JODA 3R4UA 1OQEA 5A1FA 3POGA 3N8VA 1JMUB 1UY3A 3AM2A 2RJLA 2VCCA 1XFEA 1DLLA 3BTAA 4HBNA 2KD7A 3WW1A 3WNKA 1MZ6A 1UY0A 3HS7A 1IS3A 1LGNA 3JQWA 1CQ9A 3OBRA 4XFIA 2Q1MA 2XC5L 4GKYA 5F2SA 4BHPA 3RZGA 2XUEA 5FJKA 4AW7A 4RGGA 3FLRA 3PNAA 5FK8A 2O8OA 2DV9A 3LF7A 1UYPA 4MGTA 2XMLA 2PELA 1NFXB 3QCWA 5FY0A 1HXS2 2ES3A 2J22A 4YGBA 4DS0A 4F7ZA 5FREA 5A6ZA 1K3IA 3HT2A 4XF9A 3KQBL 4BXSV 3VBFB 2P3UA 1U12A 4QHBA 4XIKA 3LOIA 1GP5A 1ZRIA 4CU7A 1EGFA 2IZWA 4HLTA 4AK3A 4ZHNA 1JBUL 1CIYA 1ZBE3 4MGYE 1NZIA 1D2SA 3KQDL 4Z6AL 1VBD3 2FCUA 2YHJA 2RHPA 4LEJA 4OMDA 3WNPA 1UPIA 5IVFA 1CAUB 2HWF3 4LHLA 2IVJA 2ET7A 5KHGA 3ELAL 4XCBA 2A7AA 5BNOC 1AR92 1EAH1 1EMOA 3QBQA 2WYJB 2RDRA 5H9PA 3VUOA 1RUOA 1W6OB 1GANA 4L8QA 3ZMOA 1WCSA 2XLGA 1WMFA 3WXPA 3S6PA 3DV8A 2ZX0A 4FPOB 3ZXGA 4FQ4A 4GB32 4S2HA 2W2ME 5A7QA 3ZXKA 1W7XL 4XZPA 2NM1A 4JTOA 2OVUA 3KWVA 1DZRA 3HBKA 3GCWE 3O1RA 3MEPA 4YGEA 4R9AA 3MUY1 3VBOC 2VTXA 2XKPA 4Q4Y2 2E63A 4W4ZA 1KJLA 2IXIA 3J7HA 4GXLA 1AYM3 4Q5OA 4BLIA 3RFRA 3TRSB 4YNIA 2WA3A 4NWWA 5FYBA 3CKHA 4E9KA 3AL5A 4LKSA 4CCKA 1KDMA 4QQHA 1Q56A 2PHDA 3VD3A 5DUUA 1W6MA 1W6PB 3CU7A 4GMP1 1IJQA 4PDWB 4Y20A 4ASLA 1BJQA 4MVTA 2QQMA 5FZKA 3FUQA 5KXDA 5IVCA 3THCA 3CFWA 3H7YA 1KXGA 2HKXA 3SCHA 4QKDA 2FCTA 5FZ0A 1ODNA 3VBRC 3E5UA 1BLZA 3AMPA 4BMEA 3ZLIA 5BNNA 3D0JA 3KF5A 4N43A 3O1TA 3RMXA 2WQZC 1AR63 2P3JA 1PM7A 4NGAL 1E5IA 1QMJA 1Z0HA 1WHEA 4FPFA 4A2UA 1ASJ1 3GNEA 3ZSLA 2XVKA 5B4XA 3A21A 4LBNA 4Y5SA 5DMYA 2WWSA 2BEOA 1O3QA 2GP5A 1OPOA 1LGBA 1UIKA 2YMZA 2WZR3 3BTYA 1NLSA 5D8AA 3I3QA 5CU1A 4CPBA 5FO9B 4BQYA 3FWEA 4LUKA 2A6XA 3V65B 1J1LA 4UWDA 1OLMA 2AR6A 3J26N 1XXNA 1DZTA 4QM8A 1W2UA 4P5HA 5J3UA 1ATDA 1HX2A 1U0AA 1VBA3 2OQ7A 4KWLA 1R1A1 4UBGA 1SACA 2B7DL 1PGSA 1N3QA 1EPGA 1PZ9A 2ZABA 4DOUA 1YHFA 5CFDB 2AEYA 5JIUA 3QMOA 3CS7L 5FZDA 3AP5A 1G1QA 4YWAA 1HCGB 5FZEA 4COVA 4CTEA 1DQ1A 5T5OA 3HPTA 2TUNA 1IQNL 1UMHA 4WZFA 3RZJA 2VH0B 1C28A 1KFUL 3O12A 2QFEA 3R6SA 3MFCA 1EPJA 1LU2A 1V6JA 3ENRA 4RFT0 1QJU3 3AXDA 4Q1RA 4Q26A 1F15A 1H8VA 3QH0A 3DPRC 2BOJA 3H0OA 1I6XA 1MQ5L 5FTTC 1POV0 3K3NA 5JVZA 2HLEA 3M7AA 4Q4W2 1UMIA 2BZ6L 4QDSA 4DY5A 1B9WA 3RZMA 4S2FA 4CCEA 1A8DA 1VBE2 3BN6A 2R062 3NAPC 4BQ3A 3N8YB 4X8SL 1V9U3 2WLPA 3NKTA 3K48A 2ZGMA 2Q8DA 1HDKA 2A6YA 2GH8A 4MGZE 1I1EA 4R4XA 5H9QA 2I9AA 4ISIL 1RFNB 3JZVA 2OUHA 4FPLA 2Y6FA 5LBEA 4EN9B 4Q8KA 5F3IA 2FZZL 4KNCA 2W46A 5JZGC 1KIGL 2RR11 4XETA 1PVC1 4SLIA 1PZ8A 4GAZA 4BZ4A 1SDDB 3PUAA 5LBFA 2OPWA 4NE9A 1MZ5A 4FXKB 4NJ4A 1NE4A 2NQYA 4GWMA 1OLQA 3PJQA 4BTUA 2WPHE 2KM2A 3LTFB 2VY0A 1K36A 4Q29A 1JZ8A 5HV0A 2EAAA 2BO2A 1B35C 1PIV1 5LASA 2WT2A 1FPN1 2XBO2 4M3CF 5FYZA 1O3SA 2LS6A 4BDXA 4YVWC 3ABZA 2CAVA 3S57A 4Q0QA 1N7DA 4C91A 3VBUA 2WO2A 2UWBA 4N7UA 4RR3A 3I2JA 4ZONA 5IAVA 1TMF1 4C1XA 1OVSA 1W8TA 4ISHL 1R082 1RUJ2 1SBDA 2BP6A 5FYSA 4AHYA 5F1RA 1UX7A 2WNUC 1EQGA 3AC0A 4ZU7A 1GFF2 1W6QB 2BUKA 3WQ1A 5CKNA 3I59A 1NKGA 2WINB 4GALA 4JZEL 3B9IA 4M3CB 1UWWA 3LDKA 4QKNA 2W52A 3RNSA 4DEQA 3P5BA 1JZ3A 1URKA 1WA6X 1Z7S1 3FMGA 5GZCA 2VE1A 5FBZA 4E4DX 2Q8EA 1U67A 1W05A 4DIQA 2QDRA 1ZRCA 3ZKUA 2HWB3 2G00L 5JDBA 2JG8C 3KCYA 4RN5A 1LR5A 1GKBA 1S0IA 1TPGA 1AL22 1CZVA 4E8DA 4L97A 3UESA 1ZRDA 2XOMA 5IWFA 4AEJA 3WHTA 5LY2A 3C7GA 1HAEA 4JGYC 2UYAA 4DPNA 1QH6A 5FO8B 1CAWA 1EPZA 2ARXA 2Z5WA 1JYTA 1H2KA 1PGW2 1UN1A 1S2BA 2D6LX 3VHNA 1ZZ6A 3Q8AA 5JOYA 1OKQA 4TSVA 4CP9B 1REFA 4CP2A 1UZ0A 3C2UA 3I8TA 2E32A 4IV1B 4O9EA 3USSA 3OGGA 2R16A 3AKSA 4O7XA 3I54A 5JSPA 1UNBA 2ZEYA 3LQCA 4ZPIA 5L9RA 2EXIA 2WG3C 4ZU4A 5IVBA 5KBFA 1V6OA 4UF0A 4AEMA 2QE3A 2RS12 3A7QA 4YG0A 4BJ0A 1J3QA 1VE0A 4HKLA 2BNOA 3VBHC 3VZKA 1ZBE1 1X9TA 3MO4A 4N90A 4MG2A 2GC3A 1WCKA 1WZXA 4RRZA 2AC1A 1XE8A 3Q8EA 3N7LA 4XFAA 2HWF1 4XVHA 4Y1VA 4HPKA 3WNXA 2XGXA 1FT9A 3SQOA 3JB8A 4HK8A 3MW4A 4FSJA 5KC5A 1RGSA 3NT1A 3WP3A 3CHXA 4Y71B 4H14A 4F83A 2PHXA 1UY4A 2VMFA 3M3CA 4ORFA 2IFRA 2QQUA 3M36L 5GLZA 2PN5A 5FZ3A 4OHWA 2NN8A 1H1IA 5FDQA 4M10A 2BJSA 3LZZA 4AQTA 2B9UA 4AI3A 1UZKA 5EGMB 1VALA 3HQRA 4NIDA 1AHSA 1Q8PA 4YZ1A 4SBVA 3U1XA 2X05A 4Y1UA 2V73A 2ZPXA 2OXBA 4AI0A 4AG4A 4ZXYL 4IUGA 2B39A 1GBGA 1NA1C 1RUI2 2TNFA 1RUG3 4NRMA 1VAKA 1UOBA 2YDEA 4AHWA 3G6JB 4UW3A 3UKVA 2MGRA 4BK5A 5CFCA 4NIAA 5LW9A 4ET7A 3PIGA 1OF4A 3ELNA 2YBPA 2WFF2 2AYLA 4MADA 4RQPB 5FPVA 5ANQA 1ZVFA 3OGSA 4Q0PA 2ZHLA 5FZ7A 2VZ3A 3BIWE 3J8F3 2SLIA 1BXHA 4B29A 1GV9A 1XJAA 5C6CA 4CZSA 4BU2A 4RUTA 3T09A 4Y1ZA 4AHZA 2Y6KA 1DDXA 4D94A 5L30L 2VMGA 3MHZA 5FYCA 1G9CA 2BQ6A 2D6PA 4BIFA 3KQCL 4HVQA 1VBC3 3KV6A 2UWLB 2VQAA 5F32A 4D0QA 1DGRN 2K2TA 1AR61 2QZ2A 3T2OA 2E33A 3AKPA 3PMSA 2Y26A 3HQUA 4RS5B 3WNNA 2P5BA 3RWKX 5C9AC 1AJOA 3PDQA 5GZEA 3BGAA 1OH3A 4X8PA 2DU0A 1OLME 2EAKA 3PVBB 4AI9A 4B3NA 2BFUS 2WZR1 4DXTA 1APQA 4AGVA 4W6WA 3OLUA 2PHTA 4MLOA 5E8AA 1IS4A 3RVHA 4MV2A 3H5CB 1JTZX 5LBBA 4LE4A 4BLJA 5KC6A 4IW3A 2ADXA 2D3SA 4XACA 4ZS3A 1MQTC 1HKDA 4QX1A 5EFUA 4NIGA 4JKMA 4XJ9A 1H4HA 4FOYA 2WO7A 2W86A 3QH6A 1AVBA 4Y5Z0 4GU3A 3ZXFA 4E2QA 1O4ZA 5BNOA 1L7QA 3DYOA 4OFGA 1XNCA 1LPGA 3FHQA 4COUA 1LOEA 1UOGA 4IQPA 1S0JA 3LC5B 5EJ3A 5K4LA 3ZYJB 4WBBA 3IZOA 5LB6A 4IEPA 2HJIA 4LO7A 4MXVA 2VUAA 1VRH3 1JZ7A 1XNKA 3EGFA 1AUYA 3USUA 1XYNA 2XBXL 4D7SA 1X82A 3CIHA 1QJU1 4YW4A 1OD3A 3FC0A 2DVDA 3ZFEA 2Y5FL 4DRRA 2ZOEB 1FAYA 4QPIA 1D7PM 3VBOA 2XQXA 4PF5A 4RGKA 3P1IA 4YSFA 1H8TC 5IKRA 2CDPA 1LMMA 4H7MA 3I3EA 5EQUA 3WD5A 2W87A 4I0WB 2VMDA 2VMEA 1J58A 2Y33A 4CE8A 5HCAA 1GQHA 2ZGPA 3I7DA 4JGZC 4NVPA 1US3A 2W3IB 3NNJA 2A71A 2I9BA 3EB7A 4QM9A 1CAXA 5LATA 3BODA 3ST7A 3CL1A 4Z92B 2YC2A 1JI6A 1YI7A 5JOZA 3U73A 1CZSA 5CKQA 3I2GA 1LOAA 2VH6B 2YBKA 3M8LA 1NFYB 2EXJA 2V5YA 5FZOA 4BDWA 1WLTA 3SW2A 1BBT3 3POYA 2Y6GA 4XTMA 5FPXA 2MHPA 2VJXA 4MXWB 1KDKA 5I93A 5FBJA 2YPDA 5GLUA 4BK4A 3H9AA 4AVAA 4CCJA 4EWAA 4WVMA 1JHNA 2NPRA 1ASJ2 2Z69A 2JE8A 3FE5A 3CZJA 3H3UA 4WM7B 1UU4A 3M3OA 2C9AA 5FY5A 4V2VA 3PIJA 4I01A 4QXHA 4Z2AA 4PF1A 5L2ZL 2LUWA 4A7IA 1O5LA 1YQ6A 4QQ2A 5FY8A 1CR7A 2YBSA 2D1JB 5KXBA 1D0HA 3VBFC 1IQML 4AFMA 2J1RA 4A44A 4YM0A 2ZMLA 5DG2A 3KSCA 5EYYA 1AL0G 3PTYA 1CAVB 2WYGB 3DL3A 3LEGA 2WPIE 1UOJA 1R1A2 1VPHA 3LE0A 3AMQA 3MYXA 2PFWA 4V1PA 2R6QA 4BTIA 2P95L 1E5HA 3F2ZA 1MEC3 2XHNA 3CBNA 4QX5A 4ARYA 3AKTA 2GNBA 2YZ4A 3LA2A 2CTVA 4RGAA 2BBVA 2IUWA 1UIJA 3UKTA 5DAQA 2GAUA 1W8ZA 4YFWA 5GLWA 1S2KA 4R9CA 2VH9A 3SH4A 2RMU2 4CUGA 3WDYA 1XNDA 4XLWA 2HEWF 1OA4A 3PU8A 2VNGA 4J6GA 1IHMA 2O8QA 2WKKA 2JE7A 3F95A 4XXAA 1JW6A 4Y26A 3VZOA 5FV3A 3OBZA 1VAMA 3CMGA 5AVAA 4CA9A 2H6BA 3NNFA 3NJZA 4IV3B 1H2NA 1LECA 1F0SB 4YZ4A 2PTMA 3ZYIB 3LDBA 2PR3B 3NAPA 4N53B 2W2OE 1WLCA 4XHBA 1A8MA 4UFLA 3WV6A 5CAZA 3IN9A 3B3QE 3O1SA 2Z2SB 1GLHA 2F9BL 1CJDA 1RUF2 2A70A 5J36A 2WPKE 1W0PA 3M2MA 3NJVA 1NZCA 3WG2A 4DXRA 2P2KA 1W9FA 2RR12 4ZZ5A 2QNKA 5FO7B 2ZBJA 3B9CA 2D7FA 3GXUA 1STMA 4NPRA 4YW7A 5CG9A 1GOFA 5FZIA 4GMP0 1KLIL 4PIXA 2VW0A 2PQQA 4ZXEA 3WY6A 1WWYA 2ZGUA 2G9FA 3RWNA 3WW4A 1Y9GA 1LNSA 1HN0A 1AXYA 1EUTA 3MPBA 4BQ1A 2OZ6A 3TNPB 3V56A 4CSYA 1FPN2 1HQWA 3K4ZA 4QX8A 5K8SA 1DX5I 2D40A 2VWLL 3CDZB 3WX5A 1H4GA 2WZEA 2VVFA 3VKFC 5FY9A 1V1HA 1PGEA 2HWC2 1ULGA 3C7EA 4MZUA 4FPYA 4YVWA 3OPTA 5K0UB 5DZEA 1XKAL 4XQDA 3SOQA 1PHMA 1TMF2 3B94A 3VHRA 2WSUA 3MPPG 4KGQA 4Y7BB 4AI8A 1BEV2 5GLVA 1MVQA 2W91A 1EV12 4LITA 3E5XA 3IAPA 4NROA 3O1UA 3U07A 5FR3A 2WNUA 3H8OA 1RUG1 1NE6A 5FXZA 2GD4A 3ZYGA 3OG2A 4A7ZA 2VQUA 2CGPA 2YGOA 3TBDA 5CKMA 1Z7S2 2DURA 3AYDA 4D69A 1F7MA 3LTGD 1QHDA 5CFDC 4X8TL 2BOXA 5FK7A 1QJEA 5F5AA 3VV1A 5HBAA 4XUQA 1AZDA 4CP0A 2VQTA 3J8F1 5A7SA 2JG8A 3AFGA 4PJYA 3O14A 2VBBA 3H3ZA 4DUVA 2H0VA 4J25A 1WBFA 1AXKA 4OQ9A 3WDUA 1QEXA 4XQ4A 5DPNA 3OUHA 5ERLA 4ES9A 5KIRA 2I74A 3KHCA 1CVNA 2B5HA 1JBCA 5T5LA 3FFZA 1NX9A 4JGYA 4CEYC 3VGIA 2PLV3 3KT4A 4OHXA 2D98A 4Q0SA 5FMBA 5JXIA 2NPIA 5ISLA 2JEMA 3ALQA 4TN7A 4LBQA 1YGCL 4KL1A 2P17A 5H9RA 4CEWB 5FWEA 1KKEA 4FAGA 1F5FA 4NWVA 2P3FL 2Q1FA 3ES4A 3BTXA 4EV0A 3M70A 5LA1A 4F8AA 4XF0A 3ZDSA 1SFPA 4JC1A 5A6QA 4O02B 2R072 2R043 2UURA 1CCVA 2WIIB 1MVEA 1OPMA 1TME3 2WN3A 2ZX3A 3O7OA 2QQOA 3OGVA 4UI9L 1W9YA 1YUKB 4Y3OA 5DDJ2 1EPIA 3H1YA 3N9OA 1ZBE2 3FFQA 1JUHA 4XQWA 5FZLA 1DFQA 3VBHA 1ENQA 1EPHA 2H9EC 2ILMA 3JD71 3N7JA 4INDA 4LT5A 3O0WA 2ZACA 4OHYA 4XZUG 3U7UG 2HBTA 1TLEA 4ZAEB 5T3NA 3U11A 1WW6A 2JDPA 3QLQA 4LBJA 2O1QA 5E1RA 3WDWA 5IVVA 2CV6A 1C57A 1POQA 1FAXL 5AC92 3VDBA 2D5HA 5EZWA 4LKEA 3POEA 5F5IA 3MLJA 3ATGA 4JDMA 3L2HA 4CDXB 1VMFA 5C4WB 4COYA 4YVSB 4CCMA 2DBNA 2VWMK 2DUOA 1YIFA 1RC6A 4MMZB 3FBMA 4LHSA 1VRH1 4OZXA 4QQOA 1NXMA 5FXXA 4ASMB 1LK9A 1ZZCA 1YRZA 1LGCA 3GZTB 1RUC3 1KGYA 3R4DB 4LTAA 2VOVA 1O5UA 2KV4A 4XFGA 5IK4A 5HI0A 1EAIC 3OUIA 4UW4A 4DQAA 2ZMKA 5J7MA 2PAMA 1DQ6A 4IE0A 4FPCA 1MS4A 1N47A 1MS9A 1S0CA 1H9PA 2BVBA 1XSQA 2HYXA 2ZTNA 3FZ3A 1RITA 3MF6A 4XFHA 3OEBA 5T5PA 3WEZA 1NQDA 5CB7A 3CQOA 5FXWA 1G1SA 5DQ0A 5FOJB 1PO21 4LIUA 3VLBB 4LOTA 3IITB 4LJHA 1QDCA 5GZDA 3SCFA 5LWBA 1QJY3 3AZYA 1XYOA 2XWJB 2W3KB 2JB8A 1YCIA 5T55A 2E31A 3WP4A 1WCQA 4DINB 2NP0A 3MV01 4KMQA 2Y82B 3KK6A 4KG8A 1BBT1 4S2DA 3S5QA 3ZSJA 5KWRA 3GJAA 1T6BX 5JAXA 2JWPA 5ACA2 3JQXA 4DEVA 3AB0A 4RHV1 5FP8A 2JX9A 4HSLA 1W8FA 3AMNA 1VJ2A 2XDVA 2H6CA 1SEFA 3POSA 4ZY9A 1OH4A 4BQ4A 1YFUA 3ETPA 1JV2B 4Y4RA 2VVDA 3PHMA 2WA4A 1R1ZA 3ZXEA 1CGPA 1FNYA 5DAPA 5C9AA 3ZIXA 1W9WA 5BNQA 2K46A 2E9QA 4BIOA 4WM8B 4IV1C 3NJXA 1JYXA 2RS53 4QX2A 1FJSL 2DBIA 5A32B 1O3RA 3V64C 2ZZJA 1YLLA 2WYFA 1SPPA 4N9IA 3HVDA 3VKOA 5JOWA 3KT7A 2VOKA 4Y76B 2QQKA 3T2PA 2P6CA 4P9YA 2GZWA 4XURA 4Y33A 5HCBA 3ZN6A 4CDQB 5ABJC 1CQEA 1XNAA 1KJRA 2D5FA 1DIWA 1RHI3 4JKKA 2P28B 1R093 2V5DA 2Y6HA 1QF3A 3MFAA 3AKRA 1MEC1 5DAVA 1Q5OA 3SMHA 1LEDA 1AJKA 2OKXA 4NAMA 2VCMA 4XILA 1CPNA 1QJX2 3C3VA 2FD8A 5IK5A 5CA6A 4RYDA 1F35A 1CESA 1T6GC 4CRQA 1OMIA 2VZSA 4AAXA 5GZGA 2XVGA 2OYUP 1IPJA 2W68A 3WW2A 5EIYB 4RRWA 3WCRA 1OUSA 3IDEA 3N36A 1O4TA 3CJIB 1QWRA 4JQRA 4K20A 5JIAA 2VZVA 4CVUA 4E2SA 1WW4A 3IWZA 3D6EA 1S1AA 2HEVF 2ZGOA 4HONA 4IE5A 4OI4A 5JUVA 1OB1C 4MUVA 1H8TA 1AX2A 4XDOA 2M74A 1FV3A 2EI7B 1ZBA3 1W28A 2PHWA 3GCXE 3OJBA 4LMFA 2EIGA 3PL0A 4G4FA 4JGZA 4L9BA 4E8CA 4MMXB 2PXJA 5K7PA 1PGL1 5LA9A 2G1MA 1PX4A 2ORXA 3K9XA 2DF7A 4RQPC 5LZ6A 1HJFA 3ITQA 1I3HA 2BT8A 2WO3A 2YROA 5H9SA 3TK6B 5A3OA 1DU3D 2HWE3 1HJ7A 2EALA 3BU0A 1I9RA 3LAQA 2MGPA 1LHNA 2K0GA 4CDUA 2CJIB 2ID4A 3IPVA 4Y1XA 2IC1A 3VKMA 5FZGA 1WW5A 5JXJA 4HMZA 1O91A 1U5ZA 2UY8A 1W6NB 2JIJA 2XL7A 1Y9MA 4P9GA 5A3TA 3LN1A 1N3OA 1O7FA 4FPHA 4NHYA 1J1TA 5A7PA 1J9CL 4Z0LA 4HN0A 4YG6A 5KHIA 3U14A 4E1GA 4XL1A 1ENSA 2BU9A 1G1TA 4CUDA 1WCUA 1KRIA 1GNZA 1V00A 2CU5A 3IDBB 4K7JA 4QPGB 5M0TA 5JVYA 2YUEA 4FPKA 4Y20B 4A6SA 1W39A 3NMBA 4PH9A 1N1VA 4RD7A 1REDA 2LM3A 3BVCA 4YW3A 3UYJA 2XPJA 4RS5C 1OF3A 4NHLA 3ZN4A 5I0SA 3I49A 3C8XA 5CADA 2WPLE 2B8MA 3VBFA 5JI7A 1LPZA 4BPZA 3VBSB 5C5UA 3DCQA 1LMJA 1UZVA 4N43B 4I3PA 3UJQA 1QOOA 4BQXA 3VDAA 3ZKYA 2RDSA 1W9SA 2JG9A 1SLLA 2LROA 2RJ2A 3LSDA 3FBYA 3TZIA 1RUH3 2WO1A 3KLSA 1CAUA 3H8RA 5CNAA 3S7IA 4BXFA 1H1AA 1XYPA 4OVEA 2HWD3 4ATFA 1KSNB 3CLPA 2FHRA 4JZDL 2Q1ZB 1KLJL 4XOGA 3PVOA 5D8AB 5BY5A 2ZA9A 1D0GA 1LOFC 3LFIA 1AR72 1U5YA 4J1XA 1NCRC 5C70A 1QQP2 2VZPA 1G9AA 2Z42A 4HETA 5IKTA 4R9DA 5JWPA 3KMHA 4C16A 3GHMA 2VZUA 4JRLA 5FYMA 2Y7ZB 3VDDA 4ATEA 3AP4A 5C3RA 3PGHA 2Y60A 2OIIA 2PLV1 4WV8A 1SLCA 3PUQA 4XBLA 1B09A 2MEV3 3ZXLA 5KHJA 1C8NA 2VW1A 2EI8B 4XXPA 1YQCA 2ORZA 2H0BA 4XUPA 5F6LB 3H8XA 4IESA 1XPWA 2W1SA 2WJSA 2K2SB 1Y43B 5FIXA 1AR83 1RJ8A 3T0BA 3E97A 4QX7A 2HYKA 3JUUA 1GOHA 1XNBA 1JOPA 4Y6DB 1CIWA 2R041 1K12A 1TME1 4AVTA 2AREA 2GP3A 4GU4A 1F9KA 1E57A 3HO5A 1UCXA 1UKGA 1WA4A 2BOIA 2GC1A 2UYBA 4YLZA 4LOSA 3LC3B 3M3IA 3HPNA 4P9JA 1G9DA 2BV4A 1RIRA 3RRDA 1HRV3 2FZ1A 2PAKA 4BB3A 1F0RB 1LOCA 2OYZA 2MPFA 4XBQA 5CZKA 3SXWA 4A7KA 1EY2A 2CL2A 3PUHA 5EJZB 1L7RA 2A3YA 4WVVA 2V09A 2D44A 3WW3A 3ZFGA 4URAA 4LHKA 3DUIA 1K5MB 2RNLA 4CDWB 3JCIA 4KI5M 3SEPA 5F9TA 4OTJA 3PUSA 4C1WA 3ILRA 2GMPA 1VB2A 4D6SA 2VO5A 5DXDA 2X53S 1TEIA 1RTVA 2BGPA 3HS6A 3SOVA 4WM7C 3U10A 4YYOA 4Z2WA 1NOVA 1W03A 5FY7A 2QQNA 2CY6A 3AMHA 3UNPA 2Y6LA 4LULA 3EO6A 3KS7A 2FMDA 1QIUA 4FI9A 1ND2B 3LDRA 1DQ5A 2VZ1A 1RUG2 3GISX 3Q8FA 1LRHA 2RE9A 3OY8B 1FOD3 3V65A 5A33B 1UD1A 1FXZA 1W0OA 2QQWA 3D4KA 1JU3A 4LQRA 5FOBB 3U4XA 3W58A 3AZWA 4OULA 5A6XA 2V4VA 3ZFFB 3BPZA 1Y9QA 2QVSB 3OGJA 2DVBA 1HB1A 1HXS3 5FYIA 3GBFA 3A23A 3J8F2 1GP4A 1ND3A 2W9XA 4RR3B 2VU9A 1HW5A 3UT0A 2CSGA 1RUNA 1QJY1 4UBHA 4P9LA 4AEKA 4Q4V2 2DFCA 2PA7A 1S0GA 2ZGQA 4IE4A 3N9LA 5GLTA 4CCCA 1DQ0A 3AZZA 5IFPA 4IE7A 1CN1A 4CEYA 2Y0IA 1J59A 2EF6A 4XF1A 1YFWA 1GP6A 3BPSA 1PMJX 3IIIA 4R9BA 1LJ7A 1WD3A 3O5SA 2XJUA 1X50A 4EN8B 3OYWA 2C5DA 2W2QE 2VM9A 3JBG2 3CJXA 5C3QA 4N53C 2UY9A 1CX4A 4RRYA 1D4M2 1H30A 4Q27A 2RS51 4UFHA 1POV3 4GB33 1ZZBA 2FQPA 3MUZ1 5EJ1B 3ZN5A 3SEEA 2XJTA 1C8M3 4L92A 3O1OA 1RUE2 3JD72 2P3IA 1QIQA 2VZRA 3WF3A 1W0NA 3IB3A 2BYVE 1IOEL 2VUCA 4H7LA 3AVSA 3H7JA 2XL9A 1RHI1 2R7EB 3ACIA 4MX3A 3ROUA 2YU1A 3UKNA 3HJRA 5BUVA 5FYVA 1AYN2 4NN0A 4KU8A 1ZYBA 2A3XA 3LIHA 4TWTA 1AXZA 1LENA 2RVAA 5E88A 1UZZA 2VW2A 2E53A 5HCFA 4EWEA 1N1SA 4XIOA 1IQDC 1PFXL 2DUQA 5A3PA 1XU2A 5LA0A 3HNYM 4LORA 2YB7A 4E4HA 1VB4A 2EVXA 1I5PA 4TLFA 3ZPOA 2DTYA 5IVYA 3WNMA 1WMEA 3AP6A 4K1YA 3VD4A 5K0UC 2Y80B 2JKBA 5FPUA 3Q9OA 1HAFA 2JDYA 3ACHA 1ADXA 2WLQA 5FLHA 5FAXA 5GZFA 2I2SA 4FFIA 5D2AA 1G8WA 2DVFA 4QHOA 4EZ4A 1ZBA1 1HB2A 4IE6A 2VRSA 3NTGA 3PUIA 4JRAA 4LBMA 5FPLA 3TN92 3W21A 4YRDA 1GNYA 1S55A 3J7LA 1LU1A
chains in the Genus database with same CATH topology
1VBD1 3WG3A 1PO22 5COXA 4UXAA 4BE3A 4PBPA 2IWGB 4IXLA 3LOBA 2HWE1 1GICA 3T1MA 5JB9E 3HWJA 1Q4GA 2Y5GL 4OI0A 4ZU5A 3TGFA 2EXHA 5CFCB 1S0DA 1QU0A 2G4IA 2H9EL 4RHV2 3EBRA 3NV3A 3KL6B 1D2QA 5BNPC 4Y7AB 3THPA 4YZ3A 4OLLA 3ZX7A 1L3JA 2D93A 1GQGA 4L99A 2NYYA 4AEDB 4IV1A 3RJRA 1LHUA 1ZZ8A 1AYM1 1UU5A 4XYXA 4BYYA 4DRVA 3FJSA 3V64A 4BA6A 2F6BA 5JW1A 4RRXA 4GWNA 4CUFA 1ULDA 1IQLL 2CYFA 2DCTA 5DZFA 4B4RA 5ABJA 2UWAA 4LUMA 1MS5A 3WVJA 1ZRCA 5KN5C 1F5JA 4LO8A 5GALA 3OLTA 4Q4W3 2DWRA 1ZZ7A 1MEC2 5JB8E 4IETA 1OSGA 2DTWA 5JSOA 1VBE3 5F19A 2HWD1 2R063 4K40A 4JZFL 1P0SL 5I0UA 4CEYB 3GALA 1XQNA 5DG1A 1QY4A 4CDXC 3LKJA 1U5XA 5C4WC 2GNTA 4JDOA 4JYVL 1H1MA 3I2DA 4YVSC 3TNQA 2NMNA 2A3WA 1SDWA 4JVAA 1G86A 3BOPA 4RL7A 1BQPA 2MEV1 4YZUB 2VECA 2AENA 1LESA 4LHNA 1NYWA 5CBLA 3IJEB 2GMMA 4HN1A 3R0RA 4AHXA 2WFXB 1PGL2 4XEZA 3KB5A 2IXCA 4LA3A 5L19A 5KXCA 2DU1A 1UKRA 3FX3A 2WNVB 2XBVL 4XF4A 1YUGA 5IKVA 5F1AA 2VQ0A 3S6XA 1VBA1 1IQGL 1L3YA 3WUCA 2ETEA 1JYCA 2NZ9A 3W9AA 3ZFEB 1P9JA 1EAH2 1AUTL 3R4SA 3A0NA 3ILNA 4QPIB 5FLJA 1QXJA 4WVWA 4EN0A 2X5IC 1RUJ3 1PNGA 4QQLA 3DEMA 2QZ3A 1HRV1 2P26A 1NCQC 2P37A 2Q5TA 4XF3A 2WT0A 1X8MA 4TZDA 1UAIA 3V0BB 1SBFA 2GU9A 3AZXA 5FRAA 4TYSA 1GZ9A 1KFXL 1SBEA 1RUD3 2RM23 1IQEL 4M01A 4IEQA 2A6ZA 1JOJA 4RS5A 3VZJA 3N8ZA 1IS5A 2OA2A 2JENA 3TAYA 3X29B 5JSRA 4WM8C 4ITCA 1AL23 4Y24A 4ES8A 1FYUA 1V9U1 1DYKA 3GZUC 1TE1B 1DBNA 2K9ZA 1FOD1 4IEZA 4WVMB 4CDQC 5J09A 4AF9A 2YYOA 4CP1A 2Q8OA 2W08A 2W0XA 3N35A 3SNMA 1YWKA 4FAHA 2G9GA 1LOGA 3TK5B 2R49A 4FTSA 1OHFA 3VBRA 1LOFA 3FUOA 5IT6A 1ATAA 1DQ2A 2XBWL 1NCRA 2VNOA 3VKLA 3BPSE 3B02A 3AMMA 2A75A 3OD4A 1SLBA 3AP9A 2PLV2 1WU1B 3CJIC 2IFWA 4DXZA 2RJKA 4WZCA 1ULFA 4X8NA 5FMOL 3PJYA 5CVRA 2QQPA 4M00A 2XLAA 2BWAA 3UL2A 1QH7A 4X8UL 1FMD3 5A3LA 5TSWA 1U5IA 4COXA 3N3HA 1MZEA 1POV1 2WS93 3ZVXA 2E51A 4BH9A 1RB8G 1C8M1 1DYPA 3VHOA 2D43A 3HT1A 3TB0A 5LRSA 3KCCA 4PQ9A 2IXJA 1SFNA 1Z6EL 2HWB1 4G9SB 2GN7A 5BYNA 1FSBA 1QFKL 2GALA 4MXWA 4H55A 1YIPA 1KITA 4O1ZA 1F31A 3P3PA 3DPRA 4FT8A 4QPGC 1LEMA 3AFKA 3RSJA 1D4VB 1G2LB 3NV2A 1C5IA 4WM7A 4W65A 4IEUA 2N7GA 1C5MF 1WD4A 1NFWB 4M3CE 2RS33 4R8HA 3VBSC 3SLIA 3WHUA 3CENL 1APNA 1W8BL 3A0KA 4N43C 3WP5A 1WW7A 1ATBA 1CAVA 4XFCA 3ME2A 1ALYA 4Q4X3 3SCGA 2VXRA 4PDWC 1PVC2 5JZGA 4PLMA 1LB2A 2VNRA 2RA0L 2Y5HL 4FP3A 2D6MA 2XWBB 4HKWA 3SHRA 1Z78A 4LA2A 1QJY2 3R05A 1OI6A 5D8AC 4YZ2A 3O0XA 1HRFA 2Q30A 1KLOA 1HV0A 2UWOB 1M06G 1PIV2 2QDNA 2W2PE 2WPME 2KNIA 2BPA2 1B35A 3AP7A 1QNWA 4AFBA 4AVVA 5CISA 1F7EA 2R32A 4ISRA 5T54A 1ULEA 4A7YA 4OHVA 1WGPA 1WCDJ 3WDVA 4JCKA 1NPEB 2DVGA 1S0EA 4N53A 2RS52 4DB5A 5FPZA 1NQJA 4LR4A 2KA3A 1YI9A 4MGIE 2W2NE 4JGYB 1PK6B 1C5HA 5SV5A 2PYTA 3QACA 2XJPA 2GSYA 4BM8A 2VOXA 1C4RA 4LBQB 1C1LA 4Q4W1 3MQEA 4YT6L 4M0NA 4MH0E 3TWIA 1VBE1 1SFYA 2R061 1OD5A 2KL7A 4OI2A 1YJLA 4XBNA 2ZHNA 4GQ7A 4HVRA 4QGMA 4ONUA 1IQJL 1C3HA 1EYBA 1MS1A 3HMYA 1K5MC 1VBC1 4Q8LA 1RMU3 4GMP3 2P16L 3ASIA 2TEPA 4MGKE 3WLUA 4CDWC 1LHWA 4XJZA 3HO4A 4YARA 3WINE 5BPXA 4H3WA 4IEXA 3PVEA 3V0AB 1A78A 1VBB3 3ZSKA 5I0TA 1IPKA 2CWMA 1ND2C 1V6NA 1ZBA2 1HT5A 1OOPB 1TNFA 4K3UA 4QPYA 4I2OA 1JH5A 1LTEA 1HRI3 1N1TA 5T50A 4HFSA 1VBD2 3RQ0A 1Q3EA 5F5QA 2HWF2 3RG0A 5EWSA 5GJ6A 3ZFFC 5LEKA 2YGMA 4DY3A 4AFDA 1APOA 4L2NA 2ZGKA 4RR3C 1XKBA 3VL8A 3N8WB 5DZGA 1RUJ1 4LBLA 1TNRA 3I4IA 4UW5A 4Z1VA 1L5GB 3RMYA 3S30A 1REEA 4Y22A 2EA7A 5BNPA 3B00A 2PUQL 1Q8VA 2MNGA 2XG3A 3WP6A 3B69A 1RUD1 2RM21 1ZA4A 1K37A 1FATA 1LKNA 1NA1A 1ZX5A 4IL7A 4BCUA 1AYM2 2RMU3 3N7MA 2DFBA 1XU1A 4Z82A 2WPJE 5JOXA 1M1XB 5L36A 5L7OB 4NHKA 1PO13 3KZ4C 2JXAA 1YYNA 5C8CB 4GH4B 2Y7XB 3INAA 4P9IA 1IGXA 3HBZA 4FM5A 2HWD2 2QCSB 3EHKA 3CF6E 3IT8A 4XPVA 5FQ0A 3MW3A 4EWEA 2NMOA 4FPJA 4NA9L 3MGUA 5J98B 3MIFA 1RUF3 1Q8QA 1GK5A 4B8EA 1AR62 5C4WA 1X33A 1GZWA 4YVSA 3RYRA 3ZN6B 4JTNA 1DGWA 4XJWA 4X8VL 2BGCA 2MHFA 3KGLA 2VVVL 3RJ2X 2CGOA 1IGOA 3BT2A 4FTBA 1QXPA 3KCXA 2PHLA 1IQFL 3URFA 1CVWL 2VMHA 3THTA 1HLCA 2WZR2 2FMYA 3FCSB 3T1LA 1EZQB 3WUDA 5KHHA 3HR9A 1ZREA 1HX6A 1GSLA 3Q3KB 2QJVA 1FMD1 2WT1A 3G7DA 4DFSA 3OPZA 2J2UB 1MQTA 4Y4YA 1EQHA 1VBA2 2VVUL 2BOHA 2CNAA 2WS91 4R52A 1ONAA 1V6LA 2HWC3 1MS3A 2OYEP 1NXD1 1UU6A 1H8TB 1DHKB 1BEV3 3F6UL 1QDOA 1IQHL 2X5IA 1EV13 1ZAQA 2Q0AA 1NT0A 1HRV2 2GH2A 3DN7A 4U36A 2CGNA 2C0ZA 4AGGA 4JGZB 1NCQA 2LTNA 1ZRFA 3LSEA 4RSUA 2DCZA 2D3RA 4LO4B 1QJU2 1Z7S3 3ETQA 3N7KA 2Q4SA 2VG9A 3BOWA 4D0EA 1BZWA 1M4WA 4HANA 2Z79A 1LHOA 4CDUB 1BCXA 5DUVA 3IPVB 3WOGA 4UW6A 1XRUA 2FZ2A 3F1SB 1Y3TA 3P3NA 4WM8A 4AEDC 4E4SA 1V9U2 2ZS6B 5A32A 1BK1A 3NW4A 1COV3 1RJ7A 2RS31 2ERFA 4HK9A 4S2GA 4XBMA 5BV6A 1FOD2 2ZJCA 1UZQA 2DYCA 2ZX2A 3GYDA 2BVVA 4CDQA 4Q4X1 4XMIA 2WFTA 1H0BA 2YXSA 3WG4A 5BXXA 2BNNA 4YW1A 4OUSA 1YUDA 3HN1A 2FLBL 1DZQA 4Y1YA 3S0MA 3B01A 4BXWA 3D5OA 2FLRL 1OQ1A 3JU9A 3RYPA 4FOQA 2R073 3ZIWA 5GM0A 3RI8A 5DDJ3 2JG9B 3VL9A 1YUFA 2VWNL 1W6MB 5K0HB 5DUXA 2XUMA 1SLAA 1DQBA 3CJIA 4OTYA 1JL9A 4YGCA 3DKWA 1PRHA 5AC93 1LCLA 5BNNB 1I0UA 2PHBB 3OTFA 2P94L 2ZX4A 4FOWA 4Q0UA 5I8TA 3LA7A 2OZJA 3CEWA 4YG3A 2X8KA 2WNVC 1NQLB 4I3GA 4QGNA 4Y79B 4URTA 3VDDB 1DDLA 1C8M2 2FD6A 5GKAC 2ZHMA 3ZFEC 1O5DL 2VULA 4QPIC 2GNDA 2HWB2 1W6OA 5AFEA 4K1ZA 1MQ6L 1W6NA 4YZ5A 5C33A 4ZKTB 3A4UA 3B7MA 3WDTA 1UL9A 3BALA 2QKDA 1H2LA 3NWKA 1X36A 4XDQA 2TGFA 2Y38A 4Q2FA 4D7YA 1VIWB 4JV4A 2BQ7A 4QPGA 5AVPA 5T5JA 1RMU1 4XE9A 3SH3A 4EJRA 1RVF3 4B7KA 3QOPA 3T2TA 1YNAA 1CVUA 1UZJA 1F8VA 1NY71 3J4UH 1LULA 3PMEA 5K9YA 1UF2C 1V70A 1VBB1 1S0FA 4GULA 3VBSA 2I45A 3ZFGB 1BYHA 1YXWA 2GNMA 1HRI1 3KGZA 5HXVA 3RS6A 1W6PA 4PDWA 2AYHA 1QNYA 3NV4A 5A3MA 3M4FA 3APBA 5DUWA 3D8CA 5SV8A 3M3EA 1LPKA 3HAGA 1DVAL 2E7TA 4CYDA 2WFPA 3QH7A 4XTPA 2BTVC 4Q0VA 4ZXXL 1QXRA 1YFXA 4IERA 3TYJA 4KG0A 4TGFA 3CNAA 3EJKA 4I0BA 4PLOA 4N9HA 3JB4C 3PVNA 4K8FA 3MF9A 2B45X 1RUC1 1ND3B 4FPGA 2WZPP 5JBBE 3KQRA 3LWCA 2ARBA 3MZHA 2XKOA 1QJX3 4J1WA 1KD7A 5LRRA 4HKOA 1JYIA 1PZ7A 3NTBA 2K2SA 3KCGL 4N7IA 2RMU1 4QQPA 3FLTA 1UPSA 3WT3A 3OBTA 3H1MA 5CFDA 2DCKA 1PO11 4XHXA 3VKNA 3TH3L 3VBUB 4E2GA 4YM1A 3MDLA 4KGGA 2CAUA 5I91A 3OYWB 4DNYA 2E7AA 3GBGA 4B4QA 3OCPA 1HV1A 2JICA 3I59B 2XVLA 4K9SA 4Z8BA 1RUF1 1VBC2 1BF9A 4FP2A 1K5MA 4CDWA 2ZGLA 1DIYA 2WG4B 4ZH8B 5JMCA 1Y7BA 1AR93 4K21A 3QD6A 4IV3C 5FLIA 1NG0A 3N8YA 5J96B 2JD4A 1WLWA 3NO8A 3D0SA 1ND2A 2R1DA 3ZXAC 5JPNB 2J94B 2J95B 4RA0A 3OY8A 4MMYB 1CAWB 5A33A 1HIXA 2BWCA 3HD8B 1UW8A 5ACA3 5T52A 2XJRA 4Q4Y3 3ZFFA 1X7NA 4M3CA 4I0AA 1KQRA 2HWC1 4AI1A 1R091 1WUVA 2BQWA 1JUIA 1LOBA 4E4ZA 4E27A 1VLNA 1VP6A 1BEV1 3WG1A 3MI8A 1EV11 2EXKA 4MSVA 2IXLA 3BCWA 2A6VA 3AK0A 1MZFA 3ZMNA 3MIEA 2P34A 1VRH2 1UZPA 1V6MA 3WQ7A 2XH6A 2JJ6A 2ZKNA 1QOTA 1ULCA 3OF1A 2OPKA 2YGQA 3LIWB 4HPKB 1I5ZA 1RUD2 5IKQA 2RM22 1G6NA 4GIQA 2PAEA 5I8YA 5JR7B 3K51A 1DGRA 3N8XA 3W59A 1VAVA 1AR73 1CGPA 4IEYA 3H1WA 1W6QA 4YFZA 1QQP3 3FHIB 5F6KA 1COV1 3AXEA 4AFCA 2P3KA 4P9XA 1V6IA 1PK6C 5IK7A 2ENRA 5L73A 3C9AC 4YM3A 1PVXA 2SBAA 4B7EA 4QT6A 2IXHA 4LBKA 2BMGA 2VOWA 3LAGA 3MDPA 4KQ7A 5AFBA 1CEJA 1AX1A 4BWOA 1A3KA 2DCYA 3HO3A 3IMNA 4AFAA 4U2AA 1BBT2 2IXKA 2D97A 1KS4A 1X8EA 4I02A 2R071 1GR3A 4FTEA 2E6VA 5DDJ1 1H2MA 4OHZA 5ABJB 3UK9A 3EQEA 3EXUA 4PIYA 3NJPC 4CEWC 1CJPA 3LCPA 5I8SA 3L9JT 5JVVA 2ZGSA 3E6CC 2VJ3A 5AC91 3U0ZA 1OOPC 3P5BL 4PBOA 1FMD2 5KHKA 2R0HA 4NG9L 2YC0A 4NR1A 2WS92 4EN6B 4OUMA 2JDZA 1RUH1 5I46L 1YJKA 1FFMA 4QD2A 6COXA 2EI6B 4KU7A 3O0VA 1LHVA 4IEVA 4W6XA 2JECA 3LN0A 4HVOA 1VR3A 2R0FA 2R30A 3GZAA 4KH9A 4LLOA 5FCCA 5B2GB 5J37A 1FI2A 2P93L 3RDIA 4XW3A 1BMV1 4C0BA 1TOZA 4EROA 1O4YA 4LO6B 2A5ZA 3M3QA 3ZPYA 4JYUL 5BNOB 1AF9A 3Q7DA 1RVF1 2BW8A 1CPMA 1G7YA 4AEDA 1N1IA 4AGRA 2UWCA 1OQDA 4Q4V3 1DGWX 2XC4L 3ZXJA 4QXKA 2RS32 3LA3A 1EMNA 1G2MB 1Z6CA 1AR81 4GKXA 4RQPA 2Y0OA 1DQ4A 2XBO3 3NSTA 1FV2A 5D1IA 3USUB 4COZA 4HSJA 2AZ5A 2TBVA 5L7OC 3AYCA 4Q4X2 1PXXA 4FVVA 1SQ4A 2OUJA 3VBOB 2D3PA 1ZZ9A 4IEWA 5C8CC 2ZAAA