3ZYJB

Netring1 in complex with ngl1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
330
structure length
326
Chain Sequence
YDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFESTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4C
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 326
sequence length 330
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00053 Laminin_EGF Laminin EGF domain
B PF00055 Laminin_N Laminin N-terminal (Domain VI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3zyjB01
2.60.120.1490 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyjB02
2Y82B 2FLGA 2KL7A 3KQCL 3N8YA 3ASIA 2VWMK 3ELAL 2W26B 4JZFL 1EPIA 4O02B 2WFXB 4MMYB 4A7IA 4D0EA 1EMOA 3CA7A 1IQJL 4YT7L 1G1SA 1MQ5L 3HPTA 3QH0A 5JBBE 1APOA 1W8BL 2VVCK 2B7DL 2VJ3A 5CKQA 1UZQA 2BQWA 1ATEA 2F9BL 5IKTA 5IKVA 1DX5I 4XBMA 5JB9E 2JKHL 2TGFA 4PLOA 3N8WA 4YT6L 3CENL 1YGCL 1NZIA 3R05A 1IVOC 3QCWA 3NTBA 1IQLL 3KK6A 4BDXA 1A3PA 5KN5C 2P93L 1DIYA 4ISHL 2G00L 4BTTA 3H5CB 2BMGA 5E8DA 1K36A 4NGAL 1TPGA 1P0SL 1F0SB 1CX2A 2K2TA 2UWOB 5F19A 1HT5A 3POYA 2J95B 1HAFA 4M11A 3ZYJB 1WHEA 3NJPC 1YUKB 3LC5B 2Y7XB 2Y5GL 2Y5HL 5JVZA 1N7DA 3BT2A 1JV2B 2H9EL 3LN0A 3EGFA 3LTGD 3HO5A 2AYLA 1G2LB 4Y71B 1FAXL 2WYGB 2ADXA 2VWLL 2W2PE 4Y7BB 4OTYA 5JVYA 4ZHAB 2OYEP 4RUTA 1N1IA 1IGXA 1XKBA 3LTFB 4Z0KB 3SW2A 4BXSA 2FLBL 3N8WB 3LIWB 4LORA 3RR3A 2XBWL 1J9CL 4ZXYL 4X8UL 1NQLB 4AQTA 1UZKA 1EAIC 3U7UG 2W3IB 1CQEA 1IQHL 2P3FN 4Y79B 3IITB 1DDXA 4PH9A 6COXA 4LMFA 1FFMA 5CKMA 2VWOL 1U67A 4JZDL 5F1AA 5L30L 1EPGA 3GCXE 1PRHA 1F7EA 2NPRA 5L2ZL 3BT1A 3KQEL 2VVVL 1L5GB 4ZXXL 1EQHA 3DEMA 1HCGB 2P94L 3V64C 5JW1A 1NT0A 3GCWE 3SOQA 1PTHA 1CEJA 1EQGA 4MMXB 4RRYA 1CVUA 3F1SB 3TGFA 4CUDA 2WPKE 3KQBL 1APQA 3HO4A 1UZPA 3IJEB 1WHFA 2VH6B 1TLEA 3N8VA 1X7AL 1Z6EL 1PGEA 3C9AC 1IGZA 1PFXL 2Y5FL 2UWLB 2FD6A 2YGOA 2WPJE 3M36L 5L2YL 2J94B 1IOXA 1ATBA 3TBDA 1JL9A 3HS7A 1M1XB 4COXA 1IP0A 2KV4A 3CS7L 4BXWA 4AQSA 1XDTR 4XL1A 4G1MB 2MGRA 1URKA 1XKAL 1CCFA 1I0UA 1K37A 2BO2A 2VH0B 1YUFA 2J34B 1IJQA 4YZUB 2I9BA 4BDWA 1UZJA 4RRWA 1KSNB 1DVAL 2VVUL 1HREA 1CVWL 1HT8A 1SZBA 2W2NE 2RHPA 1G1RA 5JBCE 2XBYL 2Y80B 3LN1A 2XC5L 3V65B 1QFKL 4URTA 4D0FA 2I9AA 1YUGA 1C5MF 1KLJL 1ZAQA 1IQGL 1IQEL 2FLRL 5IKRA 1EZQB 2EI7B 1AUTL 2WG3C 3KCGL 1KLOA 1IOEL 1LQDA 4NG9L 2MGPA 2WPIE 2W2QE 3CFWA 3HS6A 3NT1A 3Q7DA 1NFXB 3OLUA 4Y7AB 4FM5A 2WPLE 1W7XL 2P3FL 1HX2A 2P3TA 4JYVL 1PXXA 2KB9A 1Z6CA 1ADXA 4JYUL 2W86A 1F0RB 2P28B 2BOUA 2MHPA 1JBUL 1L3YA 2P95L 1OB1C 4MMZB 5CKNA 1EMNA 1HRFA 3TZIA 1V3XB 3FFGL 2FZZL 1LPZA 1GK5A 3SOBB 1EPHA 4JZEL 1NFWB 4BTUA 1FJSL 5K0HB 4ZAEB 1G1QA 1O5DL 1U8CB 3N8ZA 1FF7A 4XLWA 3P5BL 2EI6B 3F6UL 1B9WA 2W2ME 2WFTA 1EBVA 2WG4B 2CJIB 4PLNA 3QMOA 2DDUA 2Y7ZB 3ZYIB 2Q1JB 5FDQA 3ZYGA 4CUFA 4ISIL 5IKQA 3SOVA 1NFUB 1XFEA 3U73A 3FCSB 1IQFL 4OTJA 4RRXA 2J2UB 1KLIL 2W2OE 2WYJB 1F7MA 2WPHE 2XC4L 4NA9L 1IQML 1FE2A 2GD4A 4Y76B 1MQ6L 1ATAA 5I46L 3GISX 2Y38A 4E1GA 4D90A 4O1ZA 1NPEB 5EGMB 5CISA 2EI8B 1TOZA 1RFNB 4PLMA 4CUEA 3TK5B 3KQDL 3OLTA 4OVEA 4Z0LA 4TGFA 3MDLA 2P3UA 2XBXL 3K9XA 1G1TA 2WPME 1BF9A 4X8TL 1IQKL 2PR3B 3N8YB 4M10A 2XC0L 3N8XA 1YO8A 2RA0L 4X8VL 2BQ6A 1LPGA 3HS5A 3KL6B 2W3KB 2P26A 1HJ7A 4Y6DB 3M37L 3Q3KB 4BTIA 2VWNL 1DQBA 1EPJA 2BOHA 2PUQL 4C16A 2BQ7A 2J4IB 4CSYA 5JBAE 1Q4GA 3NTGA 4ZH8B 1LMJA 3FBYA 5COXA 1P9JA 2P16L 2D1JB 2BOXA 1COUA 3LAQA 3ENSA 1CCVA 2BOKL 2PHBB 5JB8E 1ATDA 3TK6B 1IQIL 1EGFA 4RS0A 2Y81B 4RRZA 5KIRA 1KIGL 1HAEA 2M74A 1MOXC 2YGPA 1FSBA 1G2MB 1NFYB 2RNLA 3BPSE 1FAKL 2OYUP 3KRKA 2BZ6L 3PGHA 3TH3L 1IQNL 4X8SL 3HO3A 2K2SB 2XBVL 3LC3B 1WU1B 4Z6AL 1LPKA 2UWPB 3MQEA 1HZ8A 2J38B
chains in the Genus database with same CATH superfamily
3ENRA 5DAWA 5BNOA 3VKOA 4Q4V2 1UCXA 4IETA 1FYUA 3B9IA 3K4AA 3VZNA 4K3UA 3KQCL 3N8YA 1H8TB 2VMEA 4NRQA 4B1LA 3POEA 1XQNA 2WO2A 1RUG3 2GN7A 5FPUA 1WW6A 1MZFA 2Y6JA 2DBNA 2IXKA 2C1FA 3P3NA 5HI0A 3O1OA 3PTRB 4DQAA 4A7IA 1D2SA 5CEHA 4PDWA 2OPWA 1V9U3 2CWMA 1FMD3 1GICA 3B01A 3GZUC 2W1UA 4P9YA 4AWDA 3WCSA 1MQ5L 3HPTA 1H9PA 4XW3A 5D2AA 1YYNA 2D3SA 5CFCA 2P37A 1EUTA 1NA1A 3AXEA 4J6GA 1XU1A 1UWWA 3RS6A 2W52A 2D6OX 4M0NA 1QY4A 4K9SA 2F9BL 4UFJA 4XUTA 5F3EA 5GLWA 5IW0A 3H0OA 1PO12 3PUQA 1VRBA 4XDQA 2IUWA 2UYBA 1O8PA 5EFUA 2JKHL 5FZOB 5ACA1 1H4HA 3N9NA 4U36A 5F5IA 4QM8A 3BGAA 2XOMA 1R1ZA 2BJSA 3MIHA 2W08A 5DDJ2 4Q5OA 3CENL 3LEMA 2CU5A 4NJ4A 4AVCA 2Z4FA 4R9BA 1NZIA 1AR83 4LPLA 3TWIA 3R05A 4YG6A 4B4RA 2VOVA 3QCWA 1BQPA 1IG0A 1DGWX 3VB9A 4BOWA 4CEWB 2E6VA 1A3PA 2WO7A 3IPVA 1XYOA 2F6BA 4FAHA 3OEBA 2VECA 1JBCA 3H5CB 1W8ZA 1CAUA 4E9KA 1QJX3 3O7OA 4IEZA 5E8DA 4Q4V1 5I93A 3AL6A 4NGAL 2VUJA 5A7SA 1NA1C 4YW4A 3ZKYA 2WA3A 2DV9A 4BHPA 4W6WA 5FKCA 4AVBA 1L7LA 2ZTNA 4BMBA 1RUF2 1F0SB 2ZAHA 4DY5A 1JYVA 1O3SA 3ZN4A 5JPMB 5F19A 4YZ4A 4JDOA 5KHGA 1W6MB 3OY8B 1HT5A 1UPIA 1KS4A 1WCUA 1D4M3 2JIJA 3VKFC 3K46A 1PM7A 5FWJA 4M11A 3EBRA 1AJOA 1GMMA 1W2TA 2DU1A 1YUKB 2DCKA 1W6QA 4XHXA 2Y5HL 1YJKA 3HPNA 4AEMA 1GOFA 4R4XA 3LN0A 4CCJA 3BTZA 5APAA 3TYJA 1ZRFA 3SH5A 1PO11 3AB0A 4ZZ8A 3H3UA 1ZA4A 3MIDA 4MXWA 2V4VA 3WG2A 2PHXA 3NV2A 4Y71B 1S0BA 2WYGB 5DDJ1 1TME2 1MS0A 4YFWA 1M06G 4LT5A 5IFPA 2YGMA 2VWLL 3VKMA 2W46A 2XBO2 5E88A 2WNOA 4QDQA 3TEXA 1U12A 2OUHA 4JTNA 3OOXA 4OTYA 1RXGA 4QQOA 5DN2A 2GN3A 5F1RA 2DBIA 3O0VA 2OYEP 3AP9A 3ZYFA 4OHVA 5JMCA 1UY1A 2VGDA 1QQP3 3K3NA 3ZR6A 1Y9QA 1AX2A 5FZOA 4B8EA 5JOXA 4BXSA 2YBSA 2FLBL 5HXMA 3W5MA 1NCRB 3KVBA 2ZKLA 1H8TC 1NAEA 5CU1A 3RWNA 2Q0AA 3V0BA 1V00A 4CE8A 1X9TA 4FPFA 1J9CL 2Y0OA 4FBFA 1W9FA 4DRRA 4ZXYL 5JUVA 1WW4A 3FLTA 4AQTA 2WDBA 3U7UG 3HQRA 2W3IB 3QD6A 3R0RA 1IQHL 2VPVA 4YLZA 3AYCA 2P3FN 2LALA 3WP4A 3IITB 3TNPB 1DDXA 2WRAA 1O8SA 3H50A 3VDDB 4TXWA 3VD5A 2ZJCA 3P6BA 4DXSA 1VIWB 4A4AA 2BP6A 2P17A 1FFMA 5CKMA 3AJYA 2VWOL 2YROA 3ZSKA 3T2TA 3GCXE 1OLME 4FPLA 3IIIA 4AHZA 4QKBA 2ZBJA 2WWUA 4BQWA 2ARXA 1HW5A 4QD2A 1GNZA 5IAVA 1IZ3A 3BT1A 2QQUA 4ITCA 2XWJB 4ZXXL 4FQZA 4KGQA 3A0NA 2VZRA 4XBNA 4YW2A 5FZHA 3VD4A 5JMOA 4XMAA 3IZOA 4BK4A 2XBO1 2P3JA 5EJZB 3GCWE 3ZXLA 2CWSA 5TSWA 3ZMNA 3SOQA 1EPZA 4MVTA 2J22A 1GZ9A 2ZX1A 1GNHA 1CEJA 4Q4Y3 4Y33A 4DFSA 1RUC2 4NOTA 4YVWA 5AC93 5KXCA 3EJKA 3POFA 3K3OA 1CVUA 2R073 3TGFA 1LKNA 3RSJA 4CUDA 3J8F2 2WPKE 4A6OA 1YFYA 1DQ4A 2N7GA 1CAXA 4IW3A 3ZXJA 5F6LB 1UZ0A 4DPNA 3ATGA 3HO4A 1DP0A 2OS2A 3IJEB 1UNBA 2VCCA 1WHFA 2CGNA 4S2GA 1JYIA 2VH6B 5B4XA 4XUOA 1DYKA 4XEZA 2QZ2A 5IAXA 4TSVA 1BVP1 4HPKA 2ZX3A 2D6PA 3M7AA 1WLWA 4JZRA 5GZCA 1CD3G 2XJVA 2ZGTA 4O7XA 4YW1A 4OUEA 1IGZA 3OBAA 5FZCA 4E2GA 2B8MA 4YWAA 4OULA 1JN2P 1MEC3 2A6XA 2D3RA 5FUIA 1K5MA 3NV1A 1G6NA 2A75A 4NRPA 1GNYA 1KJRA 5L9RA 1IOXA 1ZBA3 5EV7A 3UKNA 3MW3A 4N7IA 3LA7A 3OD4A 3TBDA 5JPNB 2QTWB 3I3QA 2ZCWA 4AHXA 1VBB2 1I1EA 5A1FA 4Z2AA 1IP0A 3JBG3 2FBEA 3ZSEA 2P3IA 5A6XA 5A6YA 3CS7L 3A4UA 4AFAA 2CV6A 3N9LA 2BV4A 3IIAA 4NVPA 4AI1A 1GU3A 3EQEA 3O1MA 2JDPA 2X09A 4KBZA 4MV2A 2V73A 5DABA 4G1MB 2Z69A 1BBT3 2MPFA 1O6UA 2VC9A 3OGSA 3WT3A 1XKAL 1C3HA 1UO9A 4P5HA 3VKLA 1CCFA 5GZDA 3WNNA 1YEWA 5D8AB 4ATEA 5I0DA 4BB3A 2IXLA 2WR9A 4RS5B 4QPYA 3J8F1 3C8XA 3VHRA 1WD3A 1NCRC 5JAXA 3NAPA 2RS33 4WV8A 1KFXL 1IJQA 5HCFA 4IE5A 3M3OA 1GSLA 2W91A 2WT2A 3OGVA 2P2KA 1Q43A 4XFAA 4EE2A 2OQ7A 4FOQA 2JDHA 2D6KA 4E4ZA 1VP6A 3PUAA 3TEZA 1US2A 2QKDA 2E53A 2WAOA 3KV5A 2VVUL 5JI9A 2VTXJ 1IPSA 4XBLA 3SCFA 4NIAA 3BIWE 3HBZA 5E8AA 4C1XA 5FYUA 2NLRA 4N8MA 2AENA 1RUNA 5A6ZA 3KV9A 3ZFEA 1J58A 1DFQA 4QX3A 2RHPA 1N47A 2RJ2A 2VZUA 1H4GA 1UPSA 3WG4A 1W6NB 2V4AA 2XGXA 4JKLA 1ZREA 3RMXA 1S2EA 3PNAA 1TNFA 2QQLA 3AYAA 2Y80B 4O65A 4Q0UA 2DTYA 4XF9A 2I74A 4YM2A 4YARA 1LHWA 3M8LA 4M0HA 4Y3OA 4K40A 4JGYB 4MXVA 3GDBA 4E2QA 2R7EB 3WHTA 4WVMB 3M3IA 4FPHA 1UOGA 1EUUA 4JQRA 4PT6A 5JXHA 2BOJA 2I9AA 1MPXA 3DPRA 1YUGA 4HK8A 2HWD1 4K1YA 4Q29A 1VMFA 1ZAQA 1VBD3 4OMDA 2PHUA 2VG9A 5AVPA 2FLRL 1DDLA 2DWRA 1ZZBA 1QHDA 3H7JA 4YGEA 3T30A 1V6IA 1EZQB 2ZACA 5CVRA 1O3RA 4XJZA 3ZFEC 2EI7B 2CAVA 4Z2WA 3THTA 1Q8VA 4EROA 1GQPA 2JE8A 2VTFA 4R52A 2J1SA 4GWMA 1UD1A 4A7ZA 4R4ZA 4LO6B 3U75A 1R1A2 3CZUA 3WQ1A 2OUJA 1IOEL 4RGAA 5FPVA 4KGGA 4ZPIA 3WW2A 4NROA 2FDIA 3UYJA 1FV3A 5D8AA 4FPOB 4URAA 1SLIA 3CFWA 1CZVA 4FFIA 3VBHB 3KT1A 1RTVA 5HCBA 1NFXB 1OC1A 3M3CA 2ZXQA 2XVGA 5HV4A 1HRI2 1EAH3 3KHCA 3NO8A 2A1XA 2AEYA 4GWIA 4CUCA 4OZXA 1V1IA 2NMOA 4QQHA 4QX5A 2P3TA 1W8HA 4NAMA 5EWSA 1QDCA 3O1TA 1S2BA 1XOYA 4L2NA 1A3KA 4K7JA 4M3CB 1XSRA 5LCWL 3DL3A 2W1SA 4EJRA 1L7RA 2Z79A 1REEA 2R49A 1DZQA 1ADXA 1S0CA 2QE3A 3DV8A 3SHRA 2VW0A 4CTEA 1SFPA 4BDVB 1GANA 2P28B 3VV1A 3ZX7A 1GFF2 3BI3A 1X82A 2JDMA 3IAQA 1H30A 2ZX4A 1TNRA 2B42B 1OB1C 1MS4A 4XYXA 3BTXA 1Q56A 4H7MA 1OLRA 1QWRA 2OKXA 4H14A 4LK6A 5D8AC 4COZA 3AL5A 3Q8CA 4RS5C 1V3XB 1KJLA 1W6NA 2BYVE 5DAPA 3FFGL 2FZZL 2DF7A 3HR9A 1LHNA 3SOBB 1EPHA 4ORFA 1LOFA 4A94C 3CJIA 3ZXKA 4BTUA 1MACA 2FCVA 4DEQA 2GZWA 1FF7A 1FNZA 1R093 1WMFA 2EI6B 5IK4A 4WVMA 2NM1A 2EVXA 3UESA 3WDTA 3LSDA 4CRQA 2JDNA 1OPMA 1R1A1 3HT2A 1QGLA 2A73B 4ISQA 4KH9A 2D40A 4XJWA 1OMIA 1SMVA 4IQPA 1YIPA 1ND3B 1SLTA 2G1MA 2CJIB 2TBVA 4W6XA 2EALA 1V6JA 2EF6A 2GU9A 4FPKA 5FYSA 4YZ3A 3WY6A 4CP2A 2DDUA 2VMDA 4LHNA 4BQ5A 1HRI1 2JDUA 4XAEA 1IQDC 1WCDJ 4QPIA 4Y20B 1U5IA 5IKQA 5B2GB 4DUXA 1AR63 4GWNA 4NPRA 4FPGA 1W9WA 2C0ZA 1S1AA 3GXUA 2J1AA 4AI3A 1NFUB 1XFEA 1RUE3 1URXA 2QZ3A 2ZGRA 1OVPA 5IVVA 2XB6C 4HLTA 3CJIC 2J1TA 1N1SA 4OTJA 3E5QA 3RGBA 4RRXA 2V09A 3VBHA 3RZLA 1KLIL 1QH7A 4GB33 4D0QA 2WYJB 1PIV2 2C5DA 2DVAA 2RS12 2VQ0A 4PIYA 2A7AA 5A70A 1G9DA 3O1RA 1RHI1 3TN91 3Q8FA 4DRVA 2I45A 1FE2A 4Q0VA 1O59A 1ATAA 5IJRA 3USSA 3ZFFB 5I46L 1HQLA 1CR7A 2ZOEB 5FK8A 4E1GA 1POQA 4BQXA 4D90A 3WNXA 5C4WB 5KXDA 1Q8SA 1X8EA 5BPXA 1NPEB 1BK1A 4M3CA 4WVWA 2CDPA 2HLEA 2ORZA 3VBRB 1S0FA 4EYUA 1PZ8A 1JZ7A 1G8WA 1YQ6A 5FZDA 5FZEA 2DVBA 2WKKA 2OZ6A 2AGSA 3PUIA 4CPBD 4TGFA 1XC6A 2WS93 3MDLA 2Q4SA 2Q8OA 2EIBA 3WDYA 3EYPA 4LKSA 4IDZA 3MUZ1 1C8M3 4QKNA 1UN1A 1ZZ7A 1LESA 2B7YA 3VBHC 2AEZA 3THCA 1BF9A 3USUA 4N43A 4XAAA 2VZOA 4HZFA 1NCQA 2IC1A 3LDBA 1ENXA 3CQOA 5GKAC 3EXUA 3O5SA 2BNOA 1SPPA 4Y1ZA 5E1RA 2UURA 5E89A 4PHZA 1YO8A 2RA0L 2VNGA 4XVHA 2NZ9A 1SEFA 3VBFA 1ULEA 2NQYA 3MPPG 4GA9A 3LA2A 2VNOA 5LY1A 2ZAAA 3U07A 2P26A 1QH6A 2BQPA 3KCXA 5T50A 5C5UA 1HJ7A 4C91A 1RUJ2 1GBGA 4Y6DB 2D93A 3Q3KB 2FCTA 3RRDA 1UF2C 1NX9A 2D44A 1IS4A 3E5XA 3D3AA 3I54A 3N9QA 3OYWB 2PUQL 2RS11 2WWSA 1OFSA 1RUD3 2Q8DA 3SXWA 1ZZCA 5FIXA 1XPWA 2GH8A 3KF3A 5J3UA 3LIGA 4XXAA 1W04A 5FPZA 4BH9A 3VBOB 4Y20A 1Q4GA 1LMJA 4I01A 2VY0A 1RUI2 3WNKA 3FBYA 2EAKA 1OHFA 3NMBA 4N43C 4ET7A 4N90A 5CYYA 2P16L 1AYN3 1NCQC 3PL0A 1ND2B 3L9JT 1MS1A 2HJIA 1GWMA 5G04L 4DO0A 2ARBA 5DAQA 3LAQA 2F4LA 3ENSA 4LUKA 2VUDA 1Z7S3 2PHBB 5JB8E 1ATDA 4GZ9A 3BUCA 2BBVA 3LGRA 3PIGA 1RUOA 4CUAA 3U37A 1S4CA 1B35A 3VBFC 5EXOA 1VAKA 1OI6A 4CXWA 2Y81B 1LENA 2YGPA 1FSBA 4FFGA 3RVHA 2VQAA 1NQJA 4YW5A 5DAXA 2OYUP 1ND3C 2BZ6L 3TH3L 1JI6A 1ZVFA 3BVCA 3M70A 4J1XA 4E27A 5KHHA 4LLOA 2XJPA 1CJPA 2XKPA 4X8SL 3OGRA 3A0KA 1QDOA 3MEPA 4NIIA 1ALYA 2K2SB 3ZDVA 3AP4A 1KXGA 3KCCA 5A7OA 3ZIXA 4YG0A 1C5IA 2XJSA 1W9TA 4XZUG 5I0SA 3MQEA 1LEDA 3AJZA 4D7YA 3U4XA 1W2UA 2BZDA 1QU0A 2J38B 1RUJ1 1XE7A 4L97A 3FBMA 4JV4A 3F2ZA 4IE4A 1JMUB 2BFUL 3APBA 4UF0A 2P5BA 4JC1A 4ZY9A 2YG0A 1HN0A 3MW4A 4DZGA 3ELAL 5C3OA 4JVAA 4IXLA 3BYWA 4JZFL 3RQ0A 1HIXA 1EPIA 1UKGA 2NYYA 2V5DA 1HN1A 3MIBA 4O02B 4NAOA 4QPGB 1RUI1 2JX9A 2VMGA 5EJ3A 1Q8PA 5C4WC 4YW3A 5JXIA 2VCBA 2ZGOA 1IS6A 3JB8A 1OOPA 1SBDA 1ZYBA 2P6CA 2VMFA 2WUHA 5G05L 1UZYA 1VLNA 1SG3A 2ENRA 3LIHA 4HVQA 1G1SA 3QH0A 1PM4A 2HH9A 3VBRC 4JGZA 5JBBE 3WQ7A 3AZVA 1JYWA 5IVEA 2CL2A 1W2NA 3WQ0A 1I5ZA 4K20A 1NXD1 5CKQA 2PHLA 2BQWA 1ATEA 3AP5A 4OHWA 3VBOA 1C8NA 3OPZA 1JS9A 5LBFA 4Q4X2 3I2FA 4QQLA 4XBMA 5LBCA 1DQ2A 5IT6A 5LA9A 5CNAA 1ODNA 3N8WA 1CAWA 4LBQD 1SLAA 3ROUA 4META 3T4HB 1CESA 4K8FA 3AKSA 1PO13 3LFIA 4AYUA 1N1TA 4OHXA 1N3PA 3NKTA 3HQUA 3ECQA 4B7KA 2BT7A 3KK6A 1SLCA 3MLJA 4X8PA 4B4QA 3HN1A 2P93L 5LEJA 4ISHL 2G00L 1O4YA 2VMIA 4IEWA 4JTOA 4JGZC 2B9VA 1JTZX 1OF4A 1X7NA 1ZRRA 4XACA 1BVVA 1TPGA 1WWYA 5JOWA 1VBC2 1GQHA 4LO5B 2K2SA 2VZPA 3VBOC 4AE2A 1CX2A 2R1DA 2J1VA 2RDNA 4OI2A 3POYA 2NPIA 1NLQA 2LRPA 3TAYA 1JZ2A 4NRMA 1HB4A 4FPYA 2PQQA 5BNOB 1RUF3 4AGGA 4BM8A 1WHEA 3ETPA 1UY4A 4QU1A 5F3CA 4CCLA 4MGQA 4W4ZA 5FAXA 3T3YA 2O14A 2VXRA 1N7DA 5FJHA 1JV2B 3I59A 3K75B 3CF6E 5GLVA 3NV3A 4EN9B 4JX0A 2Q1MA 1VAVA 1BYHA 2ZHLA 4LHLA 1QOOA 3OB8A 4Q4X1 1Y9MA 5LASA 4AEJA 4PDWB 3TB0A 3PTYA 3CKHA 3I2GA 4QQPA 4XJUA 4DXTA 4BISA 3RYKA 1EPWA 4I30A 4CA9A 2FZ2A 3I8TA 1BEV3 1CPMA 4RL7A 4Y5Z0 3C7OA 5CFCB 1G9AA 4WBBA 3FFZA 2VMCA 2XG3A 5DZGA 1NA1B 4ZHAB 2PELA 4MGSA 1TME3 2D5HA 4TLFA 3KQ4B 4E8DA 1UXZA 4RUTA 4QX1A 5DUXA 1ZZ8A 4CZSA 3OD0A 5J36A 2GH2A 1IGXA 5IVJA 3LTFB 1ASJ3 4P9JA 4AW7A 4CCMA 2YUEA 3PIJA 2PHDA 3RR3A 2XBWL 4KWLA 1VBC1 5CB7A 1CAVA 1DGWA 2ILMA 4N9IA 2H6CA 2PXJA 5EP9A 5I8SA 4CDQB 2W3JA 3ME2A 1D0HA 2GC3A 1NQLB 3DXUA 4QPGC 4QX0A 2DCJA 4AVSA 3KGZA 3OBZA 3IPVB 3BTYA 2BU9A 3NW4A 3J26N 5CADA 4XMIA 1ULPA 1N3OA 1JYCA 1BXHA 1TMF1 1UU6A 1CAUB 4BXSV 5JVVA 4D6SA 6COXA 3E97A 1K42A 1BZWA 4YFZA 3INAA 1OFNA 1CQ9A 1FOD2 2WO1A 1OF3A 2EIEA 3RZMA 3AMMA 3O1UA 1U67A 2E7QA 3AMPA 2YFUA 1ENQA 1OUSA 3FUQA 5F1AA 1LEMA 3I97A 2DFCA 5FXWA 1KD7A 4XJ9A 4GQ7A 2D98A 3JUUA 1AXKA 4R9AA 3CNAA 4QKFA 2FDHA 3FHAA 4IUGA 2CSGA 3BPSA 4BQYA 5C8CA 4DMIA 2R061 3VZMA 1MS9A 1L5GB 2VVVL 4XFIA 3S6XA 5C8WA 1JYTA 1VMHA 1W0OA 1H6XA 4FTSA 3WUDA 2P94L 1CIWA 3V64C 2D97A 1W6QB 5JW1A 1YFWA 1A6CA 2EA7A 2X5IA 5CA6A 4CEYA 4Z1VA 2HEVF 2UU8A 4NHYA 5E16A 3ZKUA 4PJYA 2IWGB 2HYKA 4KBBA 2O1QA 4MMXB 4XOGA 3F1SB 2WO3A 1DZRA 4QGLA 1DCSA 3NVCA 4MXWB 1DQ1A 2JE9A 2QBXA 4ZHNA 3WW3A 3HIFA 5K7PA 1RUC3 3UL2A 5ABJB 1CX4A 3ZXDA 2RR12 3AKTA 4P08A 1FATA 4XBQA 1HB1A 2RDQA 2BVVA 1S0JA 1B09A 1K3IA 2C9KA 4GU3A 1H1MA 5LBEA 4ES8A 2JB4A 5GZFA 4LO4B 2Z2SB 1PGEA 5J96B 2XXZA 1PFXL 2RG4A 2TEPA 3IDBB 2FD6A 5BNOC 1UMHA 4AQ6A 3Q8AA 2YGOA 2UY9A 4FQ4A 4IEVA 3JQXA 2WPJE 2BDRA 3MGUA 4JQTA 1FOD1 2ZZJA 4MADA 2Y6HA 3V0BB 4UAPA 1IS3A 4O61A 3U0ZA 4QWNA 3MHZA 5I91A 2YU2A 1UYXA 2ZKNA 1MVQA 2J94B 3CZJA 4HK9A 3VDBA 3CL1A 2FMYA 2R043 4DXZA 4IGQA 4CDQA 4P9IA 1E5RA 3MIFA 2WFF3 1DHKB 3WLUA 4ARYA 1MQTA 4UFHA 4NO4A 3HS7A 1RMU3 2JG9A 4WM8A 4PDWC 3LSEA 4AZZA 5A1LA 5BUVA 2JG8A 2MEV3 2NMNA 2DVFA 4AEDA 5C9AA 1J1TA 2KV4A 1RITA 3HMYA 2YC2A 2E7AA 3H8XA 1M4WA 1XDTR 4XL1A 2RJLA 5CFCC 1UZZA 2HWB2 3IDAA 5FK7A 3UGFA 1ULCA 1VBB3 3MUY1 4LBKA 4P5YA 2MGRA 4H3WA 3MF9A 4NHKA 3MV01 4W6YA 2E26A 1QIUA 2FDFA 3WF1A 3AP6A 3KMHA 4M3CE 3ZYPA 4Y1XA 3N7JA 3HOBA 1UL9A 4HONA 3MF6A 3ZLIA 1YUFA 3R6SA 2J34B 2WNVB 4IE0A 1K12A 1YHFA 5A3OA 3D0SA 4Q2FA 3KB5A 1GWLA 2RR11 3MLKA 2DFBA 4J1WA 4CDQC 1AR93 3QH7A 4HG6B 1XRUA 4KNCA 1BJQA 4CU8A 2JG9C 4XF1A 1LJ7A 4YVWB 2BEOA 1S55A 4AEDC 3JZVA 2I07B 4LBJA 4RRWA 1V6LA 1KSNB 1W3VA 2YYOA 5KR7A 5FO7B 1CAXB 1UZWA 4MHRA 5JSOA 4COVA 4NHXA 5ABJA 4P9GA 3LZZA 3LA3A 2Q1FA 3J4UH 1W2OA 3H3ZA 3NJVA 4Y26A 4GMP1 3N35A 2BOIA 4HPKB 4LBQA 3MLLA 1LU2A 1ZX5A 3OPTA 5FZ4A 3LPGA 5FZ7A 3ZN6B 1CGPA 4A44A 4DUVA 5KWRA 1J1LA 1NE4A 1XB9A 2PLV3 4Y4YA 5F5QA 3WP5A 1VBE2 1IPJA 2RMU2 3D82A 1IG3A 4LQRA 2OYZA 2PAMA 4YW7A 1QFKL 4URTA 2W2IA 1DQ5A 2P34A 4MGZE 1K5MB 4RR3A 1U0AA 2W39A 2HWB1 5LB6A 5AVAA 1F35A 4QMAA 4FPCA 1XE8A 3CDZB 3RJ2X 1PVC2 1LGNA 2D43A 1E5HA 1COV2 1RINA 1IQEL 1P8JA 2QQNA 4QT6A 2WJSA 2WYSA 5JLVA 4R9CA 3VUOA 1O91A 2H0BA 3SQOA 4QHZA 1PGW2 5ABJC 3ITQA 2Y33A 3M4FA 4XPVA 3RZHA 1AUTL 3KZ4C 2TUNA 3KCGL 3URFA 1UIJA 5IFTA 3S7IA 1BHGA 2ZHMA 2LROA 4YW6A 2W9XA 4OCTA 3M1HA 4NR1A 4CUBA 2AACA 4R9DA 3OG2A 4NG9L 5LWBA 2C6SA 4SLIA 4IESA 2WNUA 3HS6A 2ZGMA 2HWE3 2K9ZA 3OLUA 4Y7AB 1WGPA 4RR3C 3RDIA 3NAPB 4HT1T 2WNVA 3O0WA 4YZ1A 2VOXA 2WPLE 1YQ2A 2YFZA 4UI9L 2EXJA 1S2KA 5FYHA 5D1IA 3SITA 5KHJA 1HX2A 4QM9A 1KGYA 1PXXA 5HCHA 5K8SA 5FXXA 1APNA 1AL21 3NKGA 3S5QA 1HRI3 1Z6CA 1PNFA 1QXPA 4JYUL 2W86A 1GP6A 1POV3 1VBE1 2ZABA 4Q0QA 2JECA 2RMU1 4YGCA 1V0AA 4CDWB 2BOUA 2IFRA 1BKZA 4AI9A 4FVVA 1ZBE3 1JBUL 2ZEWA 3L2YA 1LODA 3OF1A 5GJ6A 4L9BA 4RSUA 2WZR1 3BOPA 1OA2A 3CHXA 3ZFEB 5CKNA 4MMZB 1O5LA 5FMDA 5IK7A 1PVC1 3NQHA 5DUUA 2WNUC 1MR5A 2IVJA 1COV1 2KR2A 5IVCA 3J7HA 3O14A 4LULA 4EWAA 3H3LA 1SQ4A 1UYZA 3ZN6A 1LPZA 1GK5A 1KDMA 3H8RA 3R4UA 1NFWB 1IS5A 2WNVC 1CONA 5K0HB 1PGW1 3KVAA 5A80A 2BBAA 1WUVA 1V6MA 3D4KA 1V70A 2VULA 4TN7A 2HWF3 2VZVA 3F6UL 2HORA 1VRH1 1WCSA 3DPRB 3I2HA 4LBMA 3WP3A 4GJYA 4YVWC 1XNBA 1KFUL 1F9KA 1PZ7A 4OHZA 3CMGA 4RHV3 3VD7A 1N3QA 4PF1A 2XUEA 3IM0A 4DXRA 1WW7A 3IMMA 3QMOA 3MIGA 4BQ2A 2Y7ZB 3S0MA 5FDQA 4NE9A 3ZYGA 2JIGA 5JR7B 4Q27A 5A7WA 2ATFA 1LK9A 5BV6A 4Q0PA 1AR82 3RI9A 2ERFA 1XNTA 4JHTA 2PAKA 2XHNA 2HWD2 4A7KA 1HKDA 3U73A 4BYYA 2QNKA 3RYPA 1OQ1A 3PMEA 3ALQA 4OI4A 4ASKA 2QVSB 3JD73 2YBKA 2J2UB 2A6YA 1HRV2 1MZ5A 2PN5A 2VR4A 3DYPA 2RM23 4N9HA 1K5MC 4TWTA 1NZCA 1F7MA 4M00A 5FYZA 3B93A 1Q8OA 5LRSA 1X9PA 1MQ6L 4LR4A 2JJLA 2ID4A 5A3UA 4MUVA 5A3PA 3GISX 3DCQA 2B45X 1XNAA 1PGL2 1D4VB 3LWCA 1PIV3 3LFMA 1HXS3 4QAWA 3WEZA 1DLCA 1OD5A 3NJZA 4GAZA 2EI8B 1U5XA 4BE3A 1FMD1 4AL9A 4C0BA 5EJ1B 4CDWA 4MG2A 3WUCA 1N1VA 2R0FA 3VHPA 3I2JA 2QUOA 1JUHA 2B4KA 4OVEA 1U5YA 4Z0LA 1U5ZA 3POJA 4KU8A 2ZGSA 3N9OA 1RGSA 4NWWA 3H7YA 1ONAA 1PNGA 1XU2A 3HVDA 1G1TA 4CP1A 4X8TL 2WSVA 3ACHA 5FMOL 1KQRA 3NAPC 4M10A 1C1LA 3CJIB 3VD3A 3WF4A 1W9SA 3ZSMA 2XC0L 2G19A 1G9FA 5FZFA 4GULA 1GZWA 3ELNA 3W5NA 3IT8A 4K21A 5LA1A 1EP0A 5SV5A 3O1SA 1LPGA 1AR81 1LCLA 2KM2A 3HNBM 5FYVA 3KL6B 4CDUA 2Y0IA 4BIFA 1VALA 2W47A 2UWBA 1R64A 1XJAA 4AVVA 5T54A 2X8KA 4BTIA 5JSPA 2HWC3 5KC5A 1W99A 3P5BA 3PU8A 1QQP2 4JKMA 4XF3A 3E6CC 1HRV1 1LOCA 1LMMA 2WNEA 4IV1A 1DQBA 5L9BA 4CDWC 5AFEA 1EPJA 2PTMA 2PYTA 4F7ZA 2VZSA 1UOJA 2ET7A 4C16A 3MO4A 2BQ7A 3LKJA 4QPIB 2J4IB 5HXVA 4CSYA 1UIKA 3WW1A 3NTGA 4FSJA 3I4IA 1AYM3 4PF5A 5F8PA 1RUH3 1UYPA 5COXA 1YFXA 1PGL1 4GJZA 1PX4A 1VPHA 2BOXA 1O4TA 2RE9A 2W92A 4GH4A 2ZEZA 3HNMA 1CCVA 2BOKL 4R8HA 3FZ3A 5DG1A 1SLLA 4IEQA 3TK6B 1IQIL 4Y1UA 3WSOA 3DPRC 4GMP0 4IL7A 3GF6A 2XL9A 5KIRA 2BGOA 5FZLA 1KIGL 1HAEA 1SCSA 3WXPA 4OZOA 4DY3A 3RYRA 3DN7A 3J7MA 4QHOA 2QQVA 3BPSE 4ES9A 3ZSLA 1HLCA 3AMQA 3V0AA 1UAIA 4M01A 2IXIA 2O8OA 3ES1A 2D6NA 2VUCA 3HO3A 1UOBA 4LBNA 4EN8B 4MOAA 5FPXA 2A5ZA 2JJ6A 4A45A 3BALA 2BRTA 1RHI2 3TN92 4COWA 4D8MA 3PJQA 4QXBA 2GMPA 2VE1A 3O0XA 1F2NA 4Q4Y2 4GH4C 1O3TA 4JRAA 1PGSA 1PO22 2VL4A 3HQXA 2R072 4QX8A 5C3SA 3USUB 2QCSB 1QQP1 4N43B 2CY6A 1NCQB 2VCMA 5LRRA 4PI0A 2VWMK 2W26B 1MVEA 1SBEA 1SPPB 1ZRIA 2CYFA 2PHTA 3POIA 3WDWA 4X6RB 5LBBA 4AI0A 1HJGA 1UMZA 3VBFB 1ULDA 3A22A 1F8VA 2WFXB 4MMYB 5FZ3A 1H2LA 4D0EA 2WWJA 3R4SA 3MZHA 3N4MA 4EWDA 3CA7A 5HCAA 1IQJL 3M3QA 2A6WA 3LDKA 5FYYA 1WCKA 3WVJA 1MS8A 3AKRA 1AR73 1W6OA 3C7EA 2HOXA 4OQ9A 2RS53 1VBA2 1APOA 2WZ8A 3QOPA 1MEC2 4BJ0A 1H2NA 2HBTA 4QGMA 2ZPXA 1E57A 3FJSA 3T2OA 2DUQA 1UZQA 1JHJA 4PBOA 5IKTA 1ENSA 5IKVA 3JXSA 1JU3A 1KEXA 1DX5I 3N7KA 4XUPA 3VKNA 1H2MA 2TGFA 1AHSA 2W1QA 3OBTA 4RN5A 4AI8A 2PQSA 1DIWA 3UT0A 1LOFC 3NNJA 1DGRA 1UQXA 4I2OA 3M3EA 5FJKA 1YGCL 4OQ8A 4LHKA 1W6PB 1X50A 3LPFA 4BA6A 1IVOC 1YNAA 1B35B 2Q30A 3NTBA 5T5OA 2WBKA 3LD8A 3IKWA 4C8DA 3MICA 1HQNA 1GUIA 4YVSA 4MGTA 1BBT2 1JZ3A 2Y6FA 5FXVA 5KN5C 4BTTA 1DIYA 4Q4Y1 2ZHKA 2D5FA 1GYKA 1PO21 4Q26A 2R071 5L7OA 3W58A 1W8UA 2KXLA 3S57A 2XONA 3WX5A 1CVNA 3TOJA 3ETQA 3LEIA 5C3RA 1YI9A 2QFEA 4RFT0 3TNQA 5FPBA 3VZOA 1SFYA 4LJHA 4QGNA 1V6OA 4QPIC 4CSWA 3LEKA 1QJFA 3KT4A 4HSLA 2GDFA 2XJTA 5H9SA 3VLBB 1ZA7A 2P4EA 4XE9A 4XC9A 3KCYA 2J95B 1GP4A 4AHWA 3DYMA 3FC0A 2VU9A 1LRHA 3HNYM 1JZ4A 4UF0B 1NE6A 5ANQA 3T09A 1ACCA 2H6BA 2Y7XB 4AOCA 2Y5GL 1T2XA 1VBA1 5IWFA 4YM3A 1G9BA 1MEC1 1DQ6A 1UU4A 4YVSC 1LTEA 3BT2A 1QXRA 2YHJA 4JCKA 3H9AA 3J9SA 4WVVA 5F5CA 3IBMA 3PUSA 2P6HA 2OXBA 5JDBA 3WW4A 1QKQA 4QU2A 5A3NA 1EV13 1QJY3 3B00A 5T5PA 5L7OC 2C9AA 4HBNA 1KS5A 1OOPB 1W05A 1G2LB 4DNYA 3N36A 4XF4A 2F17A 1YI7A 2JDKA 3UKTA 3IB3A 1CZSA 2LW8A 3JBG1 5A7QA 3S7EA 2ADXA 2LUWA 2W2PE 4JGZB 2GNDA 4QX2A 1GLHA 1OA3A 4CU7A 2KD7A 1Q3EA 3DF0A 3NNFA 3WG3A 2WLQA 5JVYA 5CFDA 1UX6A 2RDRA 3DXTA 4XJAA 4HVRA 3VHNA 2BUKA 4Y22B 1BBT1 4AFMA 5C7GA 5FYBA 3J7LA 2DCYA 3D0JA 5FY8A 1N1IA 2DCTA 1W03A 2DUPA 4Z0KB 1VBD2 4MLOA 3RWKX 3SW2A 3CO2A 3VZJA 4CP0A 1IKPA 3N8WB 1CAWB 5FYCA 5FYMA 4LORA 5M0TA 1LNSA 2WLPA 2NP0A 5JWPA 3VGIA 1K5JA 2E51A 5FCCA 3H1WA 1W6PA 3CJXA 3SH4A 2XMLA 5BNPB 4AVTA 4X8UL 2FD8A 2Q1ZB 1NKGA 4XCAA 1OQDA 4RD7A 5FP3A 4FTEA 1J3QA 4A6SA 4GU4A 4ZXKA 5F37A 4WZFA 5FP9A 3K48A 5FY4A 4Q8KA 4Y79B 1RL3A 3MYXA 4PH9A 4D94A 2BT8A 1OKQA 4W65A 5ISLA 4LMFA 3WQBA 4FPEA 2A3WA 3THPA 5CFDC 1W8TA 4C1WA 3RZGA 4FTBA 5IVYA 2OZJA 3ZXFA 5KXBA 4JZDL 3MFCA 5L30L 1XXNA 1EAH2 1EPGA 4XDPA 1WMEA 1PRHA 5ACA3 1UY3A 5JSRA 1J3PA 2WN3A 3ABZA 1FOD3 2NPRA 1DG6A 2WQ8A 4LKFA 2Q8EA 2GNMA 4BQ1A 5JZGA 3C7HA 3POGA 5L2ZL 2DCZA 1ENRA 3CU7A 3GBWA 3MBWA 4KU7A 2PHFA 3QBQA 1WLDA 5DPNA 3ZM8A 3TRSB 2VOKA 5GZGA 1B35C 4E8CA 1S0EA 5L36A 4CCKA 4FP3A 1PZ9A 4MGKE 3LEGA 1JXNA 3Q9OA 1FT9A 4UW5A 1PTHA 2ZEYA 3I59B 5F3GA 4CDXB 1EQGA 4RRYA 1I5PA 1UZVA 4MZUA 2JDYA 1AJKA 4NHMA 4Q4V3 4UXAA 4QXKA 1VBD1 4YGBA 4AGVA 5C5TA 1HB3A 4YGDA 1JOPA 4FOWA 4BU2A 2VVFA 4CEWC 3IDCB 1APQA 4IEUA 2ZGPA 3I2OA 5FZAA 1AUYA 3BCWA 4HXCA 2GMMA 5K0UA 1J59A 1O5UA 3FHIB 5JIAA 3BTAA 1TLEA 2XL7A 5C6CA 1X8MA 3OUHA 3VBSA 3KWVA 3L2HA 5JZGC 3E6DA 5JOZA 5F39A 1X7AL 3TEYA 3OGJA 5J48A 4Y22A 2JKXA 4ASLA 2Y5FL 4L8QA 2XLAA 1C4RA 2VW1A 3POSA 5A1AA 3OSDA 4HL0A 5GZEA 1MZ6A 3V65A 4DB5A 3M36L 2RV9A 3HD8B 4XCBA 5FLJA 2WAAA 4JKKA 3IN9A 1C1FA 3AM2A 2UY8A 3OUIA 1CAVB 5FR3A 2ZGNA 1EAH1 4YSFA 1VMJA 1HQWA 5BNPA 4M4PA 1AR62 2R0HA 3BU7A 2OA2A 1JL9A 5C33A 3FE5A 1OOPC 1RUE2 1Z0HA 5DDJ3 4QHBA 4RA0A 5FV3A 1YWKA 5IUQA 2H9EC 2XDVA 3WINE 4AAXA 1JZ6A 5FZ1A 4AQSA 5CBLA 4BK5A 4AAPA 3EB7A 4UFMA 2VQUA 4XQDA 3AX4A 2XVLA 4XZPA 3OTFA 4V2VA 2IXHA 4QB1A 3W20A 1UX7A 2EIDA 1I0UA 1JW6A 4IV3B 5A32A 3AVRA 5FY9A 3ZMOA 2HWB3 1K37A 5C8CB 3NNLA 4TLGA 2BO2A 1QNYA 3KD4A 2MNGA 2E33A 1TMF2 3NNMA 4NPMA 1CN1A 1DU3D 3ORJA 1OPOA 4XUQA 3T4VA 3LQCA 1I9RA 1Q5OA 2GSYA 2X5IB 2AUYA 4IGPA 1FX5A 1HJFA 4NN0A 2YPJA 4BDWA 2JEMA 1GZTA 4HKOA 4ZS3A 5FZGA 1R091 2DU0A 3IDEA 4QQ2A 1OD3A 3RJRA 1QF3A 3N3HA 3GNEA 4CDXA 1UZJA 1ST8A 1YC61 2WS92 2ZGUA 5FQ0B 2Q8CA 3EHKA 1C8M2 2VBPA 3OCPA 3J7NA 4N53A 1CVWL 2R062 2XJQA 4UYBA 5CIRA 1SZBA 1W8OA 2O8QA 4FAGA 2W2NE 1K45A 3P3PA 1QJEA 4BCUA 1AF9A 2K46A 5B4NA 1T6GC 1J83A 1G1RA 3T0DA 1JUIA 3EMRA 5KHKA 3AVSA 5JBCE 1AR61 2WQZC 1OQEA 2XJUA 2XBYL 3M2MA 5H9PA 1RUE1 3H8UA 5FTTC 4DIQA 3ACFA 4A42A 2AZ5A 3BPZA 4I09A 4A3XA 2XBO3 4K8RB 5J7MA 1G7YA 1CX1A 1JOBA 5FDBA 4MO3M 5EPAA 1UOFA 3GZEA 3VHOA 4H55A 1QJZA 5DG2A 2R6QA 5FY0A 1C5MF 1KLJL 2UYAA 5LK5A 4IEYA 4CDXC 4BWOA 5FMCA 2RMU3 1V1HA 1IQGL 1YIFA 1MQTB 3ILRA 2JG9B 4WM8B 5F6KA 5IKRA 2JG8B 1YQ5A 1H0BA 4AEDB 5C9AB 1AYN2 4YPJA 1ZRDA 5H9RA 3O12A 4IE6A 3VBUA 3AFKA 3FFQA 1AZDA 4AQ2A 1XNKA 2WG3C 1Z7S2 2XPJA 2FCUA 2BW8A 3PURA 5A3WA 4FP2A 5BNPC 4CPBA 5HV0A 1X36A 1JHNA 5FUPA 1LQDA 5FZ8A 2MGPA 3MIEA 3DGTA 2WS91 3Q7DA 2J7MA 3NT1A 2WL1A 4XFGA 3A23A 4IV3A 1C8M1 1YLLA 4D6RA 2B46X 3PVNA 1YRZA 4JDNA 4AI2A 4FM5A 4BMEA 1DLLA 1W7XL 3UJOA 4CU6A 3AK0A 4YM1A 4XTMA 5IK8A 4AHYA 4JYVL 3VDCA 4C0HA 3BN6A 1O7FA 2GALA 2KB9A 4X6QB 1CZTA 3PLQA 1W39A 5FP7A 3VBUC 5IVBA 3LE0A 1W06A 3LCPA 5FQ0A 3AZYA 1R082 1JYNA 5T52A 5KC6A 2WSUA 1NYWA 2P95L 2E31A 3FUOA 3GZAA 5DZEA 4JRLA 5DUVA 3T1MA 3T1LA 4AF9A 3JB4C 1QJU2 3VZLA 3ILNA 4EN6B 3E1F1 4Z92B 5K9YA 3RG0A 3TZIA 3J8F3 5BNQA 4MSVA 1XNCA 3T2QA 1CWPA 4IV3C 4LBQB 1CJDA 2BERA 3AXDA 3DUIA 5C8CC 4HKLA 4L99A 2YC0A 2R16A 4JZEL 5ANNA 1H9WA 1AYN1 1OUXA 1FJSL 2OIIA 4ZAEB 2QQKA 2WZEA 1G1QA 5CZKA 4AFBA 4CYDA 1O5DL 4ZXEA 1UXXX 1U8CB 3N8ZA 1D0GA 1WA4A 3P5BL 2X5IC 2YBPA 1Z7S1 3AP7A 1SBFA 2HYXA 4KWUA 4LXLA 1OVSA 3GYDA 1F4AA 4ZU4A 4CEYC 3ST7A 1B9WA 2GNBA 4UFLA 5F2WA 5FMBA 2WFTA 5I8TA 3UNPA 1BMV2 4EV0A 4Q0SA 1SDWA 2PHRA 3RZKA 5BNNB 2EIGA 2I2SA 3HBKA 2TNFA 3OUJA 4PLNA 5CAZA 1LGCA 2GAUA 5FUNA 5JXGA 4LITA 1ZZ9A 1A78A 1FPN2 3ZDSA 4DEVA 3ZYIB 2WC2A 4LTAA 1DZTA 1VB4A 4UWDA 1WW5A 3WV6A 2J1RA 4CUFA 1NUKA 2Y6KA 2XLFA 3I7DA 4OI1A 1UMIA 3MFAA 3SOVA 1L3JA 3B5LB 4KG8A 2PMWB 3N9MA 3ZYHA 1ODMA 3POWA 4YG3A 2R32A 4D3WA 1YUDA 2VTXA 2WNUB 1IQFL 2E7TA 5GLUA 5F5AA 2KNIA 4AFCA 5FO8B 2W2OE 4UBHA 1R081 4SBVA 2HWD3 2FMDA 2WPHE 2XC4L 2WYFA 4LLFA 4NA9L 3K4DA 2GC1A 3T0AA 4FOYA 2C24A 1QJU1 2WA4A 2JXAA 1SDDB 1REFA 5F7UA 5IHRA 5LW9A 2AR6A 1HRV3 1MQTC 2VOWA 3DECA 3H1YA 3B9CA 1VE0A 4WM8C 5FZ9A 2JG8C 4O9GA 5C9AC 5CISA 2DVGA 2Y26A 4H2AA 5LATA 5CG9A 4XIOA 2DYCA 1XYNA 5FO9B 1DYOA 3SEEA 4YZ5A 5AFBA 1GZCA 5JOYA 3KGLA 2J1UA 4EN0A 5C3PA 3VN4A 2G4IA 5EYYA 3OLTA 3K2OA 1F5FA 3N7LA 3AZXA 2P3UA 1NG0A 3DKQA 2XBXL 4BPZA 1BMV1 4HMZA 5EYXA 1FXZA 2OPKA 2QQIA 3PVOA 2B5HA 4OI0A 1XSQA 1O4ZA 2WPME 1AL22 2WT1A 3RFRA 3WNMA 1FNYA 3RZZA 3U1XA 3ZR5A 1FPN1 1H8TA 3AKQA 5LEKA 1IQAA 3N8XA 3TEWA 3FL7A 3ZSJA 4Q4W2 1BEV2 2IFWA 2L9LA 3KV6A 3MI8A 2QQWA 3HS5A 4Y24A 5FZKA 2HEWF 2WZR2 3WF2A 1STMA 4I0BA 3WHUA 1W3XA 3H8OA 1NLRA 4KG0A 3B02A 4OMCA 3DYOA 3UGHA 4MYEA 4NHLA 1F4HA 1ZNPA 2ARAA 4I0WB 4XILA 1TZOA 5BNNA 3ZYBA 4LIVA 1F5JA 3WCRA 2VNVA 1LOEA 4EWEA 1ASJ2 1E5IA 2BOHA 3H1MA 3WP6A 4COUA 1PK6B 4LKEA 5A7WB 3K77A 4W8JA 1JZ5A 3X29B 2ZS6B 5JBAE 2GC0A 4ZH8B 4GXLA 3KQRA 3WOGA 4HFSA 1VRH2 4HN0A 1IHMA 2W1WA 2ZZQA 3O1VA 2XWBB 5FY5A 3IWZA 1COUA 1FV2A 2JENA 2QQMA 1RVF2 3ZFGA 4XIKA 4AEKA 1ZZ6A 2P1BA 4FPJA 4XJ8A 2NN8A 4ISRA 4OHYA 1RUF1 1Z78A 1H6YA 3GBFA 3Q8EA 4OUSA 1XE0A 3HN3A 3LOBA 1H8VA 1R1A3 2K0GA 3VL9A 4GWJA 1MOXC 2ETEA 3I3EA 4XXPA 3VZKA 4CEWA 2VZ1A 3WR0A 1G2MB 1NFYB 1UY2A 4QDSA 3WDXA 1S0DA 2ADDA 2HEYF 2W68A 1FAKL 1C57A 1E5SA 1GQGA 3KRKA 5GM0A 3S30A 4YZ2A 5BNNC 2E9QA 2VZTA 1IQNL 2DURA 4ZONA 4M3CF 1FI2A 4QDRA 3IMNA 2D6LX 1GV9A 2P3KA 2JDZA 4PCRA 4PIZA 5FPLA 3ZPOA 5A3LA 5HBAA 2G9GA 4Q4W1 4F8AA 1BEV1 1DYPA 2F4PA 1WD4A 4FXGB 5A7PA 3OGGA 3LC3B 1WU1B 2XVKA 1LPKA 1W6MA 2UWPB 1LHOA 4JHZA 1J3RA 1LOAA 3OY8A 4HSJA 3SKJE 1L7QA 2OQ6A 4P9LA 3I3MA 1C28A 1SCRA 3D5OA 3JU9A 1RUG2 1IOAA 1TME1 2BWAA 3KM5A 4WVZA 1NY72 1Y7BA 2V72A 1AX0A 5SV8A 4K1ZA 4MGYE 2R30A 4FI9A 3U78A 3WNLA 4Z8BA 2E32A 3LDRA 1RHI3 2Y82B 2FLGA 2KL7A 1ASJ1 2ZMLA 3ASIA 3MPBA 3TN93 1DQ0A 2H0VA 1V9U2 3A21A 1FMD2 1GZWB 2WZPP 2OVUA 4Y5SA 1PO23 2GC2A 4UBGA 3ZYRA 3OJBA 2VMHA 1LHUA 4CDUB 3NSTA 2QJVA 4KWJA 3E5UA 1EMOA 2J42A 4YT7L 1I6XA 2J1EA 2JE7A 5J09A 4FFFA 3VD9A 1RVF1 4IV1B 2AC1A 4IERA 1XYPA 4S2HA 1W2AX 1LAJA 1W8BL 2VVCK 2B7DL 2ES3A 4D6QA 2VJ3A 1PK6A 3EO6A 4XURA 1DGLA 4P02B 3ZOIA 2DTWA 2UWCA 4LOTA 2R042 5JB9E 2FDGA 1VBA3 2JD9A 2WFF2 3BKZA 4NIHA 4PLOA 1RMU2 1LU1A 1NCRA 2VVEA 3V56A 4DUWA 2VRSA 1RC6A 4GH4B 2MEV2 4YT6L 4PI2A 3PU3A 1ULFA 5FFOC 5FRAA 1QJX2 3U10A 3W21A 1IKQA 4A7YA 1OA4A 1LOGA 2Z5WA 1IQLL 4NWVA 4H7LA 2BFUS 4PQQA 4EZHA 2BGCA 4BDXA 2A6VA 1QNWA 5DMYA 3T2PA 1AVBA 5FBJA 1KITA 2D6MA 4CXYA 2BMGA 1RUG1 3BODA 3VDDA 1CIYA 2IXCA 1NY71 3F95A 5I0TA 3U4SA 4BXFA 2RS13 1K36A 4TTGA 2CHHA 5GLTA 4AK3A 3V0AB 2Y6LA 2JICA 5A3MA 3PUHA 1D4M2 2A70A 1PK6C 1ULOA 4LE3A 3O1PA 1V9U1 2AREA 2XLGA 1P0SL 5BY5A 4G9SB 1RUC1 1UW8A 4Q8LA 3ACLA 2K2TA 2UWOB 2G9ZA 2XR4A 2YC4A 3B69A 4B1MA 5JR2A 1AR92 2VM9A 5IYYA 2VO5A 4L11A 1DF0A 3S6PA 2QDNA 5ERLA 2D7FA 2LTNA 4UW3A 2PFWA 2FZ1A 1HAFA 1GR3A 2ZGKA 3AYEA 1OBNA 4D69A 2Z42A 3ZYJB 1QEXA 5JXJA 3NJPC 3OBRA 1OH3A 3LC5B 1OSGA 2PAEA 1I3HA 4MHUA 3ACGA 3GJAA 3KLSA 5JVZA 1Q8QA 5DQ0A 5GLZA 4E4SA 3UETA 5T5LA 3AKPA 2H9EL 2W95A 4IEXA 4ZU7A 5FOBB 4GKYA 4QXHA 3NJXA 3EGFA 3LTGD 2RJKA 2O0OA 3OEAA 3VDDC 3WD5A 3ZN5A 2R041 3HO5A 3D6EA 3SMHA 1OXCA 2WFF1 2AYLA 5T5JA 1GKBA 1LGBA 1RMU1 2LM3A 4HVOA 4NIDA 1WLTA 1FAXL 2VAUA 5J37A 2MEV1 2PLV2 1W6OB 2ARCA 2YV8A 1QJX1 2JD4A 2PHWA 2VZ3A 4Y7BB 3VL8A 2Y6GA 1W8FA 3UV9A 3KSCA 1VBB1 1ULGA 4PIXA 1RUJ3 4KWKA 1X33A 1S0GA 2VW2A 2WT0A 3HJRA 5I0UA 4E4DX 1QOSA 2FDKA 4KL1A 5FLHA 1XKBA 2FDJA 2BNMA 3LIWB 5L19A 1W8NA 2GP5A 2VJXA 4LIUA 1BCXA 1D4M1 4HN1A 1GWKA 1WLCA 1RUI3 1V6NA 5FZBA 4CU9A 1UZKA 1EAIC 4OYUA 4CDUC 1AR91 2X29A 4YVSB 4QB2A 4CCCA 1CQEA 5EIYB 2EAAA 5FP8A 1BLZA 4GALA 5L7OB 3ZO0B 1RJ7A 3R4DB 3GM8A 4IV1C 5I0RA 2VD7A 3PVEA 4TYSA 2HWE2 2ZGLA 2YU1A 4FT8A 5IK5A 4ZKTB 1OLQA 2SLIA 1F7EA 4GD4A 4RS5A 2YMZA 1VJ2A 4YRDA 5LA2A 4BQ4A 2A6ZA 4MH0E 1RYYA 1NLSA 3B94A 2BSFA 3KS7A 4FXKB 3KQEL 3T0BA 5AC92 1EQHA 4NIGA 3SC7X 4F83A 2PLV1 3DEMA 2WINB 4NPLA 1ZM1A 1HCGB 1YJLA 3N7MA 1SLBA 2DUOA 3DKWA 4CUGA 1NT0A 4C90A 5FOJB 1PHMA 3LAGA 1ZBE2 5FY1A 4HOOA 3FWEA 5F3IA 4D7TA 4P00B 1KKEA 4HKWA 3RMYA 2GNTA 5LZ6A 3NJYA 5FKBA 1AXYA 3AYDA 4M4RA 2JDAA 3GJBA 4KQ7A 4XETA 1XNDA 2ZA9A 2WIIB 3KQBL 2VQTA 3SKVA 1WMXA 4Q1PA 4EZ4A 5L9VA 5F2SA 3W59A 1UZPA 2ZMKA 3GBGA 4OFGA 4CEYB 4XDOA 3I3DA 3T08A 4Q1RA 4RGKA 2E63A 4B3NA 5CFDB 5CG8A 3N8VA 2HBUA 2HWF2 2QQPA 2C4XA 1Z6EL 3BB6A 4I3PA 1YFUA 3C9AC 1YCIA 2UWLB 3K51A 1ZBA2 4X8NA 4AR2A 4RHV2 2FHRA 4JGYA 3FLPA 5E6HA 5FZIA 3D8CA 5K4LA 5L2YL 2HWE1 4Y4RA 3WNPA 1UY0A 3JBG2 3WF3A 3P1IA 2PA7A 4UW4A 2YDEA 1HV1A 1ATBA 3JCIA 4Q4X3 3I2DA 4D7SA 4CCEA 5JCTA 4HANA 4COXA 1M1XB 1J84A 4LBOA 5FBZA 1WMDA 2Y60A 2YGQA 2BVBA 2V5YA 5AC91 4LHSA 4BXWA 1SHWB 1IGOA 3G6JB 1POV1 3JD72 4ASMB 1QOTA 4GIQA 2RM22 3B3QE 3NWKA 1ZBE1 2RS32 2ORXA 2AH2A 1URKA 3U11A 3ZPYA 4B4PA 2WFPA 3E6BA 2YB7A 3N9PA 2WABA 1W28A 1G9CA 5JZGB 1AXZA 2GMEA 4RYDA 5HPOA 4JGYC 3I2KA 1RIRA 3CLPA 2VH0B 5T3NA 5KBFA 3BIEA 1HXS2 1VBC3 3UJQA 5GALA 3GHMA 1EY2A 4YZUB 3POBA 2I9BA 1VAMA 4IEOA 4LOSA 1YXWA 1LECA 1JU4A 3KV4A 2HWF1 3AFGA 1TMF3 3FX3A 1F15A 4Z82A 1H1AA 5A6QA 1DVAL 3WG1A 3CEWA 2ZGQA 3PDQA 4RFRB 1T6BX 1D7PM 1ZBA1 1HREA 1AL0G 2QQJA 4RR3B 3WF0A 4RHV1 4AXOA 1KRIA 3LB9A 1EYBA 4YNIA 1HT8A 1C5HA 4P9WA 5C70A 2BGPA 2QQOA 1Y3TA 1UKRA 5K0UB 1GP5A 1V6KA 2YXSA 1YQCA 5A33B 2CTVA 3VBSB 4BLIA 1DGRN 2R063 2Y8KA 4P9XA 4E4HA 1QXJA 3LOIA 5F32A 4S2FA 4XFBA 3LN1A 4UFIA 1REDA 2XC5L 2XKOA 4RQPB 3V65B 4CCOA 2HWC2 2Y64A 3FN9A 3GZTB 3JD71 2VBBA 1PMIA 3SCGA 2JB8A 3WDVA 2EXIA 2RM21 4D0FA 1WA6X 4B29A 4ZZ5A 2RS31 4O9EA 1QIQA 3ACIA 2ZX0A 4XABA 4FCAA 1XBFA 4JAAA 4V1PA 1SFNA 1AYM2 1ND3A 1WKYA 2IZWA 3AMHA 4G3YC 1RUH2 3JQWA 5DAVA 2BPA2 1TG7A 3IAPA 3SCHA 5LY2A 1PIV1 1RJ8A 4QKDA 1HXS1 5BYNA 2A3XA 1F31A 3Q8BA 1TEIA 4P14A 2ET1A 3B7MA 5DXDA 2CDOA 4CCNA 3HT1A 2BTVC 5H9QA 5F9TA 3WDUA 3PMSA 2DVDA 3ZXEA 1KLOA 4ZU5A 1TQ5A 4XFCA 3CBNA 1W9YA 5L73A 2WPIE 1GOHA 4CP9B 4NUBA 5EZWA 4UW6A 4INDA 1LR5A 2W2QE 2EXHA 3BOWA 4LUMA 1S0IA 5A32B 4DINB 3U14A 5D21A 4LA2A 3PHMA 3AZZA 4XFHA 1US3A 5DZFA 3MDPA 2CGPA 4J25A 3UKVA 2VUAA 4NMIA 3H42B 3I2IA 2P3FL 3ZFFA 4A41A 1A34A 4DOUA 1OLMA 2VXJA 2X53S 3GCXA 1YQ8A 4EQVA 5C4WA 4QX7A 4S2DA 5T55A 1W90A 5JIUA 1JODA 3C3VA 3I3BA 2EICA 1F0RB 1BK0A 3VBRA 4N53B 4Y1VA 1G86A 2HWC1 2MHPA 2XQXA 3G7DA 1L3YA 2B39A 1HV0A 5C3QA 3GCWA 1VR3A 2IXJA 2W87A 2XUMA 4YYOA 4A2UA 4CXXA 1EMNA 1HRFA 4WM7B 5A33A 4F3JA 1GOGA 4HETA 1R083 2VVDA 1R092 3NNGA 2CAUA 1W8WA 1AYM1 5FPAA 5FYIA 1RUH1 4FFHA 3QLQA 4XTPA 2ADEA 5FWEA 5FLIA 1QJU3 2RR13 2YGLA 4N7UA 1NQDA 4KI5M 1Y9GA 4RQPA 4PBPA 5FYTA 1H2KA 4XLWA 1AR72 2W0XA 3CIHA 3ZFFC 2RDSA 2RS52 2OT7A 1O3QA 5EQUA 2W2ME 4FO9A 3QH6A 4XQWA 2VBDA 1EBVA 4XHBA 1PVXA 3UK9A 5IVFA 2WG4B 5KHIA 5I8YA 2VOTA 3ON7A 4E2SA 2X10A 1OKOA 1TE1B 1KDKA 2CNAA 3KF5A 3ZVXA 3UGGA 4PQ9A 3FHQA 5FZMA 4XFFA 3OYWA 2EXKA 2Q1JB 3VBUB 5IATA 5K0UC 4ISIL 4IE7A 3HWJA 1VB2A 2KA3A 5A7NA 4A3ZA 4GMP3 2JKBA 3VBSC 4KMQA 2VH9A 4GB32 1HDKA 5FY7A 1RXFA 3AZWA 1UU5A 4RGGA 2VNRA 1JH5A 1FPN3 1WZXA 3FCSB 3ES4A 2VCAA 4L92A 2XHKA 3GGLA 1ND2A 4COYA 5LK7B 1OH4A 1W0PA 2QDRA 2W5FA 2ZMNA 3HAGA 3MW2A 4CP9A 4RQPC 1HB2A 5KXEA 2CGOA 1AX1A 1PMJX 4I3GA 2Y34A 2ZEXA 1MZEA 1H1IA 2W94A 1IQML 2GD4A 4Y76B 3ZFGB 1LHVA 2XJRA 1JOJA 4LKDA 5FP4A 2D3PA 1W0NA 2Y38A 1Y43B 3GALA 5J1XA 3RPQA 2ZHNA 4O1ZA 3GHNA 1JYXA 4B7EA 5EGMB 3RI8A 2C26A 3FMGA 4K6BA 3LF7A 3PJYA 3C2UA 3THDA 3HEIA 3ZFGC 1TOZA 2YPDA 1LOBA 1RFNB 4PLMA 4CUEA 1AR71 2AYHA 2LS6A 2R1BA 2RS51 3TK5B 4GKXA 3KQDL 3FLRA 5BXXA 5A3TA 3SEPA 1CPNA 3I49A 4ONUA 4IEPA 2B9UA 3K4ZA 4MGIE 1ND2C 4ZS2A 3NV4A 2X05A 3K9XA 3MV11 2Q5TA 4WM7A 3W9AA 4LA3A 1NXMA 1EV12 1POV0 1QJY2 1WBLA 2A71A 2MHFA 1IQKL 2PR3B 3AC0A 4QPWA 3N8YB 3VDAA 4DS0A 2GP3A 4LEJA 3WZ1A 1ZRCA 4CVUA 1QMJA 4X8VL 4YM0A 1TVGA 2BQ6A 4AG4A 4OUMA 4AGRA 3BU0A 2UWAA 1AL23 4GB31 4QPGA 5JI7A 1OURA 2W3KB 2YY1A 4LNVA 3ZXGA 1JZ8A 1RUD2 1WCQA 2XH6A 4BZ4A 5LA0A 1VBE3 4UOJA 3SISA 3M37L 1A8DA 4Q4W3 3SNMA 4N53C 2VWNL 4QXCA 4XF0A 4UFKA 2WZR3 1DBNA 4G4FA 1OT5A 2WN2A 1A8MA 4JDMA 2A3YA 1PVC3 5FXZA 3QACA 4U2AA 4Y5TA 2SBAA 2WQ4A 3C7FA 1COV3 1UYYA 1RB8G 3KHBA 4WM7C 4I02A 4UT5A 4BLJA 1P9JA 2G9FA 4Z07A 4LO8A 4OLLA 1D2QA 2D1JB 4FOVA 4L0PA 2BWCA 2BNNA 4V2WA 4MX3A 3WNOA 4AVAA 2IVIB 3S5AA 3ZIWA 3V64A 3ILFA 1VRH3 1MS3A 3A7QA 3NRUA 3OPWA 4I0AA 1EGFA 4RS0A 2VZQA 4XQ4A 5FZ6A 4XUNA 4RRZA 4QB6A 2OX0A 5DUWA 3ZXAC 2M74A 3PVBB 5FMOS 4CCDA 1RVF3 1PX3A 1SACA 4LE4A 4AFDA 2RNLA 1IPKA 1HX6A 2HKXA 1N1YA 3PGHA 1FAYA 4BQ3A 4EN7B 5ACA2 2XQRA 4TZDA 1EV11 4Y1YA 1QJY1 3AMNA 3RZJA 1PMHX 2ZX2A 5FREA 3RNSA 2RVAA 1WBFA 1NOVA 1MS5A 4WZCA 5EHDA 2OW4A 1LULA 2P3YA 1Y4WA 2YZ4A 5FZ0A 2JWPA 5J98B 4BIOA 4IGOA 4ARXA 2XBVL 4Z6AL 3NL1A 4W50A 2FQPA 4LO7A 1LB2A 1HZ8A 4LK7A 1RUD1 3KT7A 4LBLA 3SLIA 4ATFA 3SH3A 3C7GA 5C71A
chains in the Genus database with same CATH topology
3ENRA 5BNOA 3VKOA 4Q4V2 1UCXA 4IETA 1FYUA 3B9IA 3VZNA 4K3UA 3KQCL 3N8YA 1H8TB 1XQNA 1RUG3 2GN7A 1WW6A 1MZFA 2IXKA 2C1FA 3P3NA 5HI0A 4DQAA 4A7IA 1D2SA 4PDWA 1V9U3 2CWMA 1FMD3 1GICA 3B01A 3GZUC 4P9YA 4AWDA 3WCSA 1MQ5L 3HPTA 1H9PA 4XW3A 1YYNA 2D3SA 5CFCA 2P37A 1NA1A 3AXEA 4J6GA 1XU1A 3RS6A 2W52A 2D6OX 4M0NA 1QY4A 4K9SA 2F9BL 5GLWA 3H0OA 1PO12 4XDQA 2UYBA 5EFUA 2JKHL 5ACA1 1H4HA 4U36A 4QM8A 5F5QA 1R1ZA 5DDJ2 3MIHA 2W08A 3ZFGB 4AVCA 3CENL 4R9BA 1NZIA 1AR83 3TWIA 3R05A 4YG6A 4B4RA 2VOVA 3QCWA 1BQPA 1DGWX 4BOWA 4CEWB 2E6VA 1A3PA 3IPVA 1XYOA 2F6BA 4FAHA 2VECA 1JBCA 3H5CB 4E9KA 1CAUA 1QJX3 3O7OA 4IEZA 5E8DA 4Q4V1 5I93A 4NGAL 2VUJA 1NA1C 4YW4A 2WA3A 2DV9A 4BHPA 4W6WA 4AVBA 2ZTNA 4BMBA 1RUF2 1F0SB 2ZAHA 4DY5A 1O3SA 3ZN4A 5JPMB 5F19A 4YZ4A 4JDOA 5KHGA 1W6MB 3OY8B 1HT5A 1UPIA 1KS4A 1D4M3 3VKFC 1PM7A 4M11A 3EBRA 1AJOA 2DU1A 1YUKB 2DCKA 1W6QA 4XHXA 2Y5HL 1YJKA 4AEMA 4R4XA 3LN0A 3TYJA 1ZRFA 3SH5A 1PO11 3AB0A 3H3UA 1ZA4A 3MIDA 4MXWA 3WG2A 2PHXA 3NV2A 4Y71B 1S0BA 2WYGB 5DDJ1 1TME2 1MS0A 4YFWA 1M06G 2YGMA 2VWLL 3VKMA 2XBO2 5E88A 1U12A 2OUHA 4JTNA 4OTYA 4QQOA 2GN3A 5F1RA 3O0VA 5JMCA 2OYEP 3AP9A 4OHVA 2VGDA 1QQP3 1Y9QA 1AX2A 4B8EA 5JOXA 4BXSA 2FLBL 1NCRB 2ZKLA 1H8TC 5CU1A 3RWNA 2Q0AA 3V0BA 1V00A 4FPFA 1J9CL 2Y0OA 4DRRA 4ZXYL 1WW4A 3FLTA 4AQTA 3U7UG 2W3IB 3QD6A 3R0RA 1IQHL 2VPVA 4YLZA 3AYCA 2P3FN 2LALA 3WP4A 3IITB 3TNPB 1DDXA 3H50A 3VDDB 2ZJCA 1VIWB 2P17A 1FFMA 5CKMA 3AJYA 2VWOL 2YROA 3ZSKA 3T2TA 3GCXE 4FPLA 4AHZA 2ZBJA 2ARXA 1HW5A 4QD2A 1GNZA 1IZ3A 3BT1A 4ITCA 4XBNA 2XWJB 4ZXXL 4FQZA 4KGQA 3A0NA 4YW2A 3ZFGC 4XMAA 2XBO1 2P3JA 3GCWE 3ZXLA 2CWSA 5TSWA 3ZMNA 3SOQA 1EPZA 4MVTA 2ZX1A 1GZ9A 4DFSA 1GNHA 1CEJA 4Q4Y3 5AC93 4CEWC 1RUC2 4NOTA 4YVWA 5KXCA 3EJKA 1CVUA 2R073 3TGFA 1LKNA 3RSJA 4CUDA 3J8F2 2WPKE 1YFYA 1DQ4A 2N7GA 1CAXA 3ZXJA 4DPNA 3ATGA 3HO4A 3IJEB 1WHFA 2CGNA 4S2GA 1JYIA 2VH6B 1DYKA 4XEZA 2QZ2A 4TSVA 1BVP1 4HPKA 2ZX3A 2D6PA 3M7AA 1WLWA 5GZCA 1CD3G 2XJVA 2ZGTA 4YW1A 1IGZA 4E2GA 2B8MA 4OULA 1JN2P 1MEC3 2A6XA 2D3RA 1K5MA 3NV1A 1G6NA 2A75A 1KJRA 1IOXA 1ZBA3 5EV7A 3UKNA 3MW3A 4N7IA 3LA7A 3OD4A 3TBDA 5JPNB 2ZCWA 4AHXA 1VBB2 1I1EA 1IP0A 3JBG3 2FBEA 3ZSEA 2P3IA 3CS7L 3A4UA 4AFAA 2CV6A 4NVPA 3IIAA 4AI1A 3EQEA 4MV2A 2V73A 4G1MB 2Z69A 1BBT3 2MPFA 3WT3A 1XKAL 1C3HA 4P5HA 3VKLA 1CCFA 5GZDA 4ATEA 5D8AB 2IXLA 4RS5B 4QPYA 3J8F1 3VHRA 1WD3A 1NCRC 5JAXA 3NAPA 2RS33 4WV8A 1KFXL 1IJQA 5HCFA 3M3OA 1GSLA 2WT2A 2P2KA 1Q43A 4XFAA 4FOQA 2D6KA 4E4ZA 1VP6A 2QKDA 2E53A 2VVUL 5JI9A 4XBLA 3SCFA 3BIWE 3HBZA 5E8AA 4C1XA 2NLRA 2AENA 1RUNA 3ZFEA 1J58A 1DFQA 2RHPA 1N47A 3WG4A 1H4GA 1UPSA 1W6NB 2XGXA 1ZREA 3RMXA 3PNAA 1TNFA 3AYAA 2Y80B 4Q0UA 2DTYA 4XF9A 2I74A 4YM2A 4YARA 1LHWA 3M8LA 4M0HA 4K40A 4JGYB 4MXVA 4E2QA 3WHTA 4WVMB 3M3IA 4FPHA 4JQRA 2I9AA 3DPRA 4HK8A 1YUGA 4K1YA 2HWD1 4Q29A 1ZAQA 1VBD3 2PHUA 2VG9A 5AVPA 2FLRL 1DDLA 2DWRA 1ZZBA 1QHDA 3H7JA 4YGEA 1V6IA 1EZQB 2ZACA 5CVRA 1O3RA 4XJZA 3ZFEC 2EI7B 2CAVA 4Z2WA 3THTA 1Q8VA 4EROA 4R52A 4GWMA 1UD1A 4A7ZA 4R4ZA 4LO6B 1R1A2 3WQ1A 2OUJA 1IOEL 4RGAA 4KGGA 3WW2A 1FV3A 5D8AA 4FPOB 1SLIA 3CFWA 3VBHB 3KT1A 1RTVA 5HCBA 1NFXB 3M3CA 2XVGA 1HRI2 1EAH3 3NO8A 4OZXA 2NMOA 4QX5A 4QQHA 2P3TA 5EWSA 1QDCA 1S2BA 4L2NA 1A3KA 4K7JA 4M3CB 3DL3A 4EJRA 2Z79A 1REEA 2R49A 1DZQA 1ADXA 1S0CA 2QE3A 3DV8A 3SHRA 2VW0A 4CTEA 1GANA 2P28B 3VV1A 3ZX7A 1GFF2 1X82A 1H30A 2ZX4A 1TNRA 2B42B 1OB1C 1MS4A 4XYXA 1Q56A 4H7MA 1OLRA 1QWRA 4H14A 5D8AC 4COZA 4RS5C 1V3XB 1KJLA 1W6NA 2BYVE 3FFGL 2FZZL 2DF7A 3HR9A 1LHNA 3SOBB 1EPHA 4ORFA 1LOFA 4A94C 3CJIA 3ZXKA 4BTUA 1MACA 4FBFA 2GZWA 1FF7A 1FNZA 1R093 1WMFA 2EI6B 5IK4A 4WVMA 2NM1A 2EVXA 3WDTA 3LSDA 4CRQA 3HT2A 1OPMA 1R1A1 1QGLA 2A73B 4ISQA 4KH9A 2D40A 4XJWA 1OMIA 1SMVA 4IQPA 1YIPA 1ND3B 1SLTA 2TBVA 2CJIB 4W6XA 4Z07A 2EALA 1V6JA 2EF6A 2GU9A 4FPKA 3WDVA 4YZ3A 3WY6A 4CP2A 2DDUA 4LHNA 1HRI1 1WCDJ 4QPIA 4Y20B 1U5IA 5IKQA 5B2GB 1AR63 4GWNA 4NPRA 4FPGA 2C0ZA 1S1AA 4AI3A 1NFUB 1XFEA 1RUE3 1URXA 2QZ3A 2ZGRA 2XB6C 4HLTA 3CJIC 1N1SA 4OTJA 3E5QA 4RRXA 2V09A 3VBHA 1KLIL 1QH7A 4GB33 2WYJB 1PIV2 2C5DA 2DVAA 2RS12 2VQ0A 4PIYA 2A7AA 1RHI1 3TN91 4DRVA 2I45A 1FE2A 4Q0VA 1ATAA 3USSA 3ZFFB 5I46L 1HQLA 1CR7A 2ZOEB 4E1GA 5C4WB 5KXDA 4D90A 3WNXA 1Q8SA 1X8EA 5BPXA 1NPEB 1BK1A 4M3CA 4WVWA 3VBRB 1S0FA 1PZ8A 1G8WA 2DVBA 2WKKA 2OZ6A 2AGSA 4TGFA 2WS93 3MDLA 2Q4SA 2Q8OA 3WDYA 1C8M3 1UN1A 1ZZ7A 1LESA 2B7YA 3VBHC 1BF9A 3USUA 4N43A 4HZFA 1NCQA 2IC1A 1ENXA 5GKAC 3EXUA 3O5SA 2BNOA 4Y1ZA 5E1RA 2UURA 5E89A 1YO8A 2RA0L 2VNGA 2NZ9A 1SEFA 3VBFA 1ULEA 2NQYA 3MPPG 4GA9A 3LA2A 2VNOA 2ZAAA 3U07A 2P26A 1QH6A 2BQPA 3KCXA 5T50A 1HJ7A 4C91A 1RUJ2 1GBGA 4Y6DB 2D93A 3Q3KB 3RRDA 1UF2C 2D44A 1IS4A 3E5XA 3I54A 3OYWB 2PUQL 2RS11 2WWSA 1OFSA 1RUD3 3SXWA 1ZZCA 2GH8A 5J3UA 4XXAA 5FPZA 4BH9A 3VBOB 4Y20A 1Q4GA 1LMJA 4I01A 2VY0A 1RUI2 3FBYA 2EAKA 1OHFA 4N43C 4N90A 2P16L 1AYN3 1NCQC 1ND2B 3L9JT 1MS1A 2HJIA 2ARBA 3LAQA 4YRDA 3ENSA 4LUKA 1Z7S3 2PHBB 5JB8E 1ATDA 2BBVA 3LGRA 1RUOA 3VBFC 1B35A 5EXOA 1VAKA 1OI6A 2Y81B 1LENA 2YGPA 1FSBA 2VQAA 1NQJA 4YW5A 2OYUP 1ND3C 2BZ6L 1ZVFA 3TH3L 3M70A 4J1XA 4E27A 5KHHA 4LLOA 2XJPA 1CJPA 2XKPA 4X8SL 3A0KA 1QDOA 3MEPA 1ALYA 2K2SB 3AP4A 1KXGA 3KCCA 3ZIXA 4YG0A 1C5IA 2XJSA 5I0SA 3MQEA 1LEDA 3AJZA 4D7YA 3U4XA 1W2UA 1QU0A 2J38B 1RUJ1 1XE7A 4L97A 3FBMA 4JV4A 3APBA 2BFUL 4JC1A 3MW4A 4DZGA 3ELAL 4JVAA 4IXLA 4JZFL 1HIXA 1EPIA 1UKGA 2NYYA 3MIBA 4QPGB 1G9DA 4O02B 1RUI1 2JX9A 2VMGA 5EJ3A 1Q8PA 5C4WC 4YW3A 2ZGOA 1IS6A 3JB8A 1OOPA 1SBDA 1ZYBA 1UZYA 1VLNA 2ENRA 4HVQA 1G1SA 3QH0A 3VBRC 4JGZA 5JBBE 3WQ7A 3AZVA 2CL2A 3WQ0A 1I5ZA 4K20A 1NXD1 5CKQA 2PHLA 2BQWA 1ATEA 3AP5A 4OHWA 3VBOA 1C8NA 3OPZA 4Q4X2 4QQLA 4XBMA 1DQ2A 5IT6A 5CNAA 3N8WA 1CAWA 4LBQD 1SLAA 3ROUA 4META 1CESA 4K8FA 3AKSA 1PO13 4AYUA 1N1TA 4OHXA 1N3PA 3NKTA 3ECQA 4B7KA 3KK6A 1SLCA 3MLJA 4X8PA 4B4QA 3HN1A 2P93L 5LEJA 4ISHL 2G00L 1O4YA 2VMIA 4IEWA 4JTOA 4JGZC 1JTZX 1X7NA 1ZRRA 1BVVA 1TPGA 5JOWA 1VBC2 1GQHA 4LO5B 2K2SA 3VBOC 4AE2A 1CX2A 2R1DA 4OI2A 3POYA 2NPIA 3TAYA 4FPYA 2PQQA 5BNOB 1RUF3 4AGGA 4BM8A 1WHEA 5FAXA 2VXRA 1N7DA 1JV2B 3I59A 3CF6E 5GLVA 3NV3A 4EN9B 2Q1MA 1VAVA 1BYHA 2ZHLA 4LHLA 1QOOA 4Q4X1 4AEJA 4PDWB 3TB0A 3PTYA 4QQPA 4XJUA 3RYKA 1EPWA 4I30A 2FZ2A 3I8TA 1BEV3 1CPMA 4RL7A 4Y5Z0 5CFCB 1G9AA 4WBBA 3FFZA 5DZGA 2XG3A 1NA1B 4ZHAB 2PELA 1TME3 2D5HA 4TLFA 4RUTA 5DUXA 1ZZ8A 4CZSA 3OD0A 5J36A 2GH2A 1IGXA 3LTFB 1ASJ3 4P9JA 4AW7A 2YUEA 2PHDA 3RR3A 2XBWL 4KWLA 1VBC1 5CB7A 1CAVA 1DGWA 2ILMA 4N9IA 2H6CA 4CDQB 5I8SA 3ME2A 1D0HA 2GC3A 1NQLB 4QPGC 2DCJA 4AVSA 3KGZA 3IPVB 3NW4A 3J26N 5CADA 4XMIA 1N3OA 1JYCA 1BXHA 1TMF1 1UU6A 1CAUB 5JVVA 6COXA 3E97A 1BZWA 4YFZA 3INAA 1OFNA 1CQ9A 1FOD2 3AMMA 1U67A 2E7QA 3AMPA 1ENQA 3FUQA 5F1AA 1LEMA 2DFCA 1KD7A 4XJ9A 4GQ7A 2D98A 3JUUA 1AXKA 4R9AA 3CNAA 5C8CA 4DMIA 2R061 3VZMA 1MS9A 1L5GB 2VVVL 4XFIA 3S6XA 5C8WA 1W0OA 4FTSA 3WUDA 2P94L 1CIWA 3V64C 2D97A 1W6QB 5JW1A 1YFWA 1A6CA 2EA7A 2X5IA 5CA6A 4CEYA 4Z1VA 2HEVF 2UU8A 5E16A 4PJYA 2IWGB 2HYKA 4KBBA 2O1QA 4MMXB 4XOGA 3F1SB 1DZRA 4QGLA 3NVCA 4MXWB 1DQ1A 2JE9A 3WW3A 3HIFA 5K7PA 1RUC3 3UL2A 5ABJB 1CX4A 3ZXDA 2RR12 3AKTA 1FATA 4XBQA 2BVVA 1S0JA 1B09A 1H1MA 4ES8A 5GZFA 4LO4B 2Z2SB 1PGEA 5J96B 1PFXL 2TEPA 3IDBB 2FD6A 5BNOC 4AQ6A 2YGOA 2UY9A 4FQ4A 4IEVA 3JQXA 2WPJE 3MGUA 1FOD1 2ZZJA 3V0BB 1IS3A 3U0ZA 5I91A 2ZKNA 1MVQA 2J94B 4HK9A 3CL1A 2FMYA 2R043 4DXZA 4CDQA 4P9IA 3MIFA 2WFF3 1DHKB 3WLUA 1MQTA 4NO4A 3HS7A 1RMU3 2JG9A 4WM8A 4PDWC 3LSEA 5BUVA 2JG8A 2MEV3 2NMNA 2DVFA 4AEDA 5C9AA 1J1TA 2KV4A 1RITA 3HMYA 2E7AA 1M4WA 1XDTR 4XL1A 2RJLA 5CFCC 1UZZA 2HWB2 1ULCA 1VBB3 4LBKA 2MGRA 4H3WA 3MF9A 4NHKA 4W6YA 3AP6A 3KMHA 4M3CE 3ZYPA 4Y1XA 3N7JA 1UL9A 3MF6A 1YUFA 3R6SA 2J34B 2WNVB 1YHFA 3D0SA 4Q2FA 3KB5A 2RR11 3MLKA 2DFBA 4J1WA 4CDQC 1AR93 3QH7A 1XRUA 4KNCA 1BJQA 2JG9C 4XF1A 1LJ7A 4YVWB 2BEOA 1S55A 4AEDC 3JZVA 2I07B 4LBJA