1XDTR

Complex of diphtheria toxin and heparin-binding epidermal growth factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
41
structure length
41
Chain Sequence
PCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the complex of diphtheria toxin with an extracellular fragment of its receptor.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Complex (toxin/growth factor)
molecule keywords DIPHTHERIA TOXIN
total genus 8
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1997-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1xdtR00
2JKHL 5KIRA 2UWOB 1IQNL 1JBUL 4X8TL 1URKA 3POYA 3NT1A 1U8CB 1K37A 3R05A 4LORA 2WPIE 4CUEA 1N7DA 2WFTA 3N8YA 2BOXA 2KB9A 1PGEA 1IQHL 1FJSL 1ATBA 5IKTA 3LTGD 4YT7L 1FFMA 2XBWL 4ZXYL 3QMOA 3OLTA 1X7AL 1IQEL 2J2UB 2GD4A 2Y38A 4NGAL 4TGFA 1G1TA 2UWLB 3TGFA 1IQIL 1HX2A 3LN1A 1XDTR 3EGFA 2G00L 2P3UA 3NJPC 4O02B 2Y82B 1LMJA 3Q7DA 3KRKA 3MDLA 1N1IA 2J95B 1FAXL 4FM5A 1XKBA 2XBVL 4JYUL 2W86A 2Y81B 3HS7A 1G1SA 2WG3C 2BO2A 1IQLL 1IQJL 4BTUA 5KN5C 1EPGA 1Z6CA 3TK5B 3SOQA 1IVOC 5F19A 1FF7A 1DIYA 3KQDL 4YT6L 3P5BL 2W26B 5IKQA 2W3IB 4CUDA 3LC3B 1TLEA 3N8WA 4BXWA 1L3YA 1IGZA 1CCVA 1IJQA 1KSNB 1NFWB 2EI8B 1HJ7A 2WPHE 3KQBL 5CKNA 2FLGA 2WPME 1ATEA 1UZQA 2OYUP 3CENL 1Z6EL 3IJEB 1EPJA 1JL9A 5JVZA 1CCFA 4OTJA 4Y6DB 2Y5FL 1KIGL 3NTBA 1LPKA 5COXA 1APQA 2FLRL 3BPSE 1G1RA 3LTFB 2WFXB 3ASIA 3HO3A 1W8BL 1BF9A 2CJIB 1YUFA 3BT2A 1YUKB 1PXXA 4BDXA 3LIWB 2VVCK 5JB9E 1EAIC 1IQFL 1ATDA 2K2SB 2WYGB 1YUGA 1HT8A 2WYJB 4BDWA 1UZKA 2J34B 4M10A 4ISIL 3Q3KB 3KQCL 4NG9L 5IKRA 2Y80B 1HRFA 2VH6B 2EI6B 3MQEA 2J94B 1PRHA 2F9BL 3LAQA 2I9AA 4ZHAB 3CFWA 4RUTA 2P3FN 1DDXA 3OLUA 1EQHA 1HREA 4COXA 1I0UA 2RA0L 4XBMA 3ZYGA 1NT0A 4XL1A 3RR3A 4C16A 5IKVA 5JBCE 4D90A 5I46L 2OYEP 1OB1C 5L2YL 2KL7A 2J38B 1G2MB 1WU1B 4A7IA 4Y7BB 4Z6AL 6COXA 2VWOL 2BOUA 1G2LB 4NA9L 3ELAL 3HO5A 3M36L 1DX5I 1K36A 4PH9A 2DDUA 1COUA 2BZ6L 2P94L 1LPGA 4CSYA 2MGRA 3C9AC 3SOBB 2VJ3A 2BQWA 1LQDA 1DQBA 1FSBA 1NZIA 1IOEL 2W2OE 5K0HB 2XBXL 1TPGA 1F7EA 2W2PE 2Y7ZB 1EPHA 2FD6A 1U67A 3ZYJB 2FZZL 2Y5GL 2ADXA 1WHEA 4ZXXL 2BQ7A 2P28B 2PHBB 1IOXA 4MMXB 2YGPA 1EQGA 2K2TA 1EBVA 1ADXA 2P95L 1J9CL 3ZYIB 1AUTL 3FFGL 4E1GA 4JZDL 1UZJA 2W3KB 1F0RB 2W2NE 1CVWL 1G1QA 2MGPA 2B7DL 1O5DL 4X8SL 4CUFA 2WPKE 5CISA 4MMYB 1MOXC 4D0EA 3HS5A 5E8DA 4Y76B 2NPRA 1F7MA 1KLIL 2VWMK 4ZH8B 2KV4A 1NFXB 3GCXE 4Z0LA 3TZIA 1TOZA 2VVUL 1NPEB 5JBAE 5JW1A 1EGFA 1RFNB 4RRXA 1L5GB 1M1XB 3HPTA 5CKMA 4Z0KB 3U73A 1CX2A 2P16L 2XC0L 3GCWE 3N8VA 1KLJL 1EMOA 3KQEL 5F1AA 4Y71B 4X8UL 1XFEA 3SW2A 2UWPB 5L2ZL 4BTTA 1PFXL 4Y7AB 1F0SB 3N8WB 2Y7XB 2P3TA 2RHPA 2VWLL 4JZEL 3V64C 3FBYA 1P9JA 2EI7B 2BMGA 1EPIA 3N8XA 5JBBE 1XKAL 4Y79B 3F1SB 4JZFL 1MQ5L 1SZBA 3F6UL 3SOVA 1YGCL 1IP0A 1LPZA 3TK6B 4BXSA 2PR3B 3CA7A 1ATAA 3GISX 3KL6B 4BTIA 4LMFA 2VH0B 3QH0A 5L30L 3M37L 4YZUB 3U7UG 3DEMA 5JVYA 2WPJE 2XC4L 2BQ6A 1NFUB 1DVAL 4MMZB 1WHFA 1IQML 4ISHL 1IQKL 1NFYB 1APOA 1CVUA 2FLBL 2Q1JB 4G1MB 4RS0A 2VVVL 1Q4GA 1CQEA 3N8ZA 1MQ6L 3K9XA 2W2QE 2XBYL 3PGHA 4JYVL 2P93L 1UZPA 1HAFA 4RRZA 3N8YB 2M74A 1HZ8A 4O1ZA 3HS6A 2WPLE 3H5CB 1A3PA 2BOKL 2BOHA 1EMNA 3KCGL 2YGOA 3TH3L 1JV2B 3CS7L 2Y5HL 4RRYA 1W7XL 2RNLA 1B9WA 2W2ME 3BT1A 3TBDA 1P0SL 1HT5A 1ZAQA 4OTYA 2VWNL 3IITB 2D1JB 3KK6A 4ZAEB 2MHPA 1NQLB 3QCWA 4AQTA 3HO4A 2H9EL 3LC5B 1QFKL 4RRWA 5CKQA 3LN0A 1V3XB 1HAEA 2TGFA 4M11A 3NTGA 1HCGB 1CEJA 1EZQB 1GK5A 1IQGL 1IGXA 2PUQL 3ENSA 1PTHA 5FDQA 4XLWA 3V65B 5EGMB 4D0FA 5JB8E 1FAKL 1FE2A 1KLOA 4X8VL 2I9BA 1C5MF 3FCSB 1YO8A 2J4IB 2AYLA 2P26A 2P3FL 2XC5L 2WG4B
chains in the Genus database with same CATH superfamily
2HORA 2JKHL 5KIRA 2UWOB 1IQNL 1JBUL 4X8TL 1URKA 3POYA 3NT1A 1U8CB 1K37A 3R05A 4LORA 2WPIE 4CUEA 1N7DA 2WFTA 3N8YA 2BOXA 2KB9A 1PGEA 1IQHL 2H9EC 1FJSL 2KNIA 1ATBA 5IKTA 3LTGD 4YT7L 1FFMA 2XBWL 4ZXYL 3QMOA 3OLTA 1X7AL 1IQEL 2J2UB 2GD4A 2Y38A 4NGAL 4TGFA 1V1HA 1G1TA 2UWLB 3TGFA 1IQIL 1HX2A 3LN1A 1XDTR 3EGFA 2G00L 2P3UA 3NJPC 4O02B 2Y82B 1LMJA 3Q7DA 3KRKA 3MDLA 1N1IA 2J95B 1FAXL 4FM5A 1XKBA 2XBVL 4JYUL 2W86A 3HS7A 2Y81B 1G1SA 2WG3C 2BO2A 1IQLL 1IQJL 4BTUA 5KN5C 1EPGA 1Z6CA 3TK5B 3SOQA 1IVOC 1LK9A 5F19A 1FF7A 4A94C 1DIYA 3KQDL 4YT6L 3P5BL 2W26B 5IKQA 2W3IB 4CUDA 3LC3B 1TLEA 3N8WA 4BXWA 1L3YA 1IGZA 1CCVA 1IJQA 1KSNB 1NFWB 2EI8B 1HJ7A 2WPHE 3KQBL 5CKNA 2FLGA 2WPME 1ATEA 1UZQA 2OYUP 3CENL 1Z6EL 3IJEB 1EPJA 1JL9A 5JVZA 1CCFA 4OTJA 4Y6DB 2Y5FL 1KIGL 3NTBA 1LPKA 5COXA 2JJLA 1APQA 2FLRL 3BPSE 1G1RA 3LTFB 2WFXB 3ASIA 3HO3A 1W8BL 1BF9A 2CJIB 1YUFA 3BT2A 1YUKB 1PXXA 4BDXA 3LIWB 2VVCK 5JB9E 2HOXA 1EAIC 1IQFL 1ATDA 2K2SB 2WYGB 1YUGA 1HT8A 2WYJB 4BDWA 1UZKA 2J34B 4M10A 4ISIL 2WZPP 3Q3KB 3KQCL 4NG9L 5IKRA 2Y80B 1HRFA 2VH6B 2EI6B 3MQEA 2J94B 1PRHA 2F9BL 3LAQA 2I9AA 4ZHAB 3CFWA 4RUTA 2P3FN 1KKEA 1DDXA 3OLUA 1EQHA 1HREA 4COXA 1I0UA 2RA0L 4XBMA 3ZYGA 1NT0A 4XL1A 3RR3A 4C16A 5IKVA 5JBCE 4D90A 5I46L 2OYEP 1OB1C 5L2YL 2KL7A 2J38B 1G2MB 1WU1B 4A7IA 4Y7BB 4Z6AL 6COXA 2VWOL 2BOUA 1G2LB 3ELAL 3HO5A 4NA9L 3M36L 1DX5I 1K36A 4PH9A 2DDUA 1COUA 2BZ6L 1QIUA 2P94L 1LPGA 4CSYA 2MGRA 3C9AC 3SOBB 2VJ3A 2BQWA 1LQDA 1DQBA 1FSBA 1NZIA 1IOEL 2W2OE 5K0HB 2XBXL 1TPGA 1F7EA 2W2PE 2Y7ZB 1EPHA 2FD6A 1U67A 3ZYJB 2FZZL 2Y5GL 2ADXA 1WHEA 4ZXXL 2BQ7A 2P28B 2PHBB 1IOXA 4MMXB 2YGPA 1EQGA 2K2TA 1EBVA 1ADXA 2P95L 1J9CL 3ZYIB 1AUTL 3FFGL 4E1GA 4JZDL 1UZJA 2W3KB 1F0RB 2W2NE 1CVWL 1G1QA 2MGPA 2B7DL 1O5DL 4X8SL 4CUFA 2WPKE 5CISA 4MMYB 1MOXC 4D0EA 3HS5A 5E8DA 4Y76B 2NPRA 1F7MA 3S6XA 1KLIL 2VWMK 4ZH8B 2KV4A 1NFXB 3GCXE 4Z0LA 3TZIA 1TOZA 2VVUL 1NPEB 5JBAE 5JW1A 1V1IA 1EGFA 1RFNB 4RRXA 2BT7A 1L5GB 1M1XB 3HPTA 5CKMA 4Z0KB 3U73A 1CX2A 2P16L 2XC0L 3GCWE 3N8VA 1KLJL 1EMOA 3KQEL 5F1AA 4Y71B 4X8UL 1XFEA 3SW2A 2UWPB 5L2ZL 4BTTA 1PFXL 2YGQA 1F0SB 3N8WB 4Y7AB 2Y7XB 2P3TA 2RHPA 2VWLL 4JZEL 3V64C 3FBYA 1P9JA 2EI7B 2BMGA 2BSFA 1EPIA 3N8XA 5JBBE 1XKAL 4Y79B 3F1SB 4JZFL 1MQ5L 1SZBA 3F6UL 3SOVA 4GU4A 1YGCL 1IP0A 1LPZA 3TK6B 4BXSA 2PR3B 3CA7A 1ATAA 3GISX 3KL6B 4BTIA 1LMMA 4LMFA 2VH0B 3QH0A 5L30L 3M37L 4YZUB 3U7UG 3DEMA 5JVYA 2WPJE 2XC4L 2BQ6A 1NFUB 1DVAL 4MMZB 1WHFA 1IQML 4ISHL 1IQKL 1NFYB 1APOA 1CVUA 2FLBL 2Q1JB 4G1MB 4RS0A 2VVVL 1Q4GA 1CQEA 3N8ZA 1MQ6L 3K9XA 2W2QE 2XBYL 3PGHA 4JYVL 2P93L 1UZPA 1HAFA 4RRZA 3N8YB 2M74A 1HZ8A 4O1ZA 3HS6A 2WPLE 3H5CB 1A3PA 2BOKL 2BOHA 1EMNA 3KCGL 2YGOA 3TH3L 1JV2B 3CS7L 2Y5HL 4RRYA 1W7XL 2RNLA 1B9WA 4GU3A 2W2ME 3BT1A 3TBDA 1P0SL 1HT5A 1ZAQA 4OTYA 2VWNL 3IITB 2D1JB 3KK6A 4ZAEB 2MHPA 1NQLB 3QCWA 4AQTA 3HO4A 2H9EL 3LC5B 1QFKL 4RRWA 5CKQA 2BT8A 3LN0A 1V3XB 1HAEA 2TGFA 4M11A 3NTGA 1HCGB 1CEJA 1EZQB 1GK5A 1IQGL 2VRSA 1IGXA 2PUQL 3ENSA 1PTHA 5FDQA 4XLWA 3V65B 5EGMB 4D0FA 5JB8E 1FAKL 1FE2A 1KLOA 4X8VL 2I9BA 1C5MF 3FCSB 1YO8A 2J4IB 2AYLA 2P26A 2P3FL 2XC5L 2WG4B
chains in the Genus database with same CATH topology
2JKHL 5KIRA 2UWOB 1IQNL 1JBUL 4X8TL 1URKA 3POYA 3NT1A 1U8CB 1K37A 3R05A 4LORA 2WPIE 4CUEA 1N7DA 2WFTA 3N8YA 2BOXA 2KB9A 1PGEA 1IQHL 2H9EC 1FJSL 2KNIA 1ATBA 5IKTA 3LTGD 4YT7L 1FFMA 2XBWL 4ZXYL 3QMOA 3OLTA 1X7AL 1IQEL 2J2UB 2GD4A 2Y38A 4NGAL 4TGFA 1G1TA 2UWLB 3TGFA 1IQIL 1HX2A 3LN1A 1XDTR 3EGFA 2G00L 2P3UA 3NJPC 4O02B 2Y82B 1LMJA 3Q7DA 3KRKA 3MDLA 1N1IA 2J95B 1FAXL 4FM5A 1XKBA 2XBVL 4JYUL 2W86A 2Y81B 3HS7A 1G1SA 2WG3C 2BO2A 1IQLL 1IQJL 4BTUA 5KN5C 1EPGA 1Z6CA 3TK5B 3SOQA 1IVOC 5F19A 1FF7A 4A94C 1DIYA 3KQDL 4YT6L 3P5BL 2W26B 5IKQA 2W3IB 4CUDA 3LC3B 1TLEA 3N8WA 4BXWA 1L3YA 1IGZA 1CCVA 1IJQA 1KSNB 1NFWB 2EI8B 1HJ7A 2WPHE 3KQBL 5CKNA 2FLGA 2WPME 1ATEA 1UZQA 2OYUP 3CENL 1Z6EL 3IJEB 1EPJA 1JL9A 5JVZA 1CCFA 4OTJA 4Y6DB 2Y5FL 1KIGL 3NTBA 1LPKA 5COXA 1APQA 2FLRL 3BPSE 1G1RA 3LTFB 2WFXB 3ASIA 3HO3A 1W8BL 1BF9A 2CJIB 1YUFA 3BT2A 1YUKB 1PXXA 4BDXA 3LIWB 2VVCK 5JB9E 1EAIC 1IQFL 1ATDA 2K2SB 2WYGB 1YUGA 1HT8A 2WYJB 4BDWA 1UZKA 2J34B 4M10A 4ISIL 2WZPP 3Q3KB 3KQCL 4NG9L 5IKRA 2Y80B 1HRFA 2VH6B 2EI6B 3MQEA 2J94B 1PRHA 2F9BL 3LAQA 2I9AA 4ZHAB 3CFWA 4RUTA 2P3FN 1DDXA 3OLUA 1EQHA 1HREA 4COXA 1I0UA 2RA0L 4XBMA 3ZYGA 1NT0A 4XL1A 3RR3A 4C16A 5IKVA 5JBCE 4D90A 5I46L 2OYEP 1OB1C 5L2YL 2KL7A 2J38B 1G2MB 1WU1B 4A7IA 4Y7BB 4Z6AL 6COXA 2VWOL 2BOUA 1G2LB 4NA9L 3ELAL 3HO5A 3M36L 1DX5I 1K36A 4PH9A 2DDUA 1COUA 2BZ6L 2P94L 1LPGA 4CSYA 2MGRA 3C9AC 3SOBB 2VJ3A 2BQWA 1LQDA 1DQBA 1FSBA 1NZIA 1IOEL 2W2OE 5K0HB 2XBXL 1TPGA 1F7EA 2W2PE 2Y7ZB 1EPHA 2FD6A 1U67A 3ZYJB 2FZZL 2Y5GL 2ADXA 1WHEA 4ZXXL 2BQ7A 2P28B 2PHBB 1IOXA 4MMXB 2YGPA 1EQGA 2K2TA 1EBVA 1ADXA 2P95L 1J9CL 3ZYIB 1AUTL 3FFGL 4E1GA 4JZDL 1UZJA 2W3KB 1F0RB 2W2NE 1CVWL 1G1QA 2MGPA 2B7DL 1O5DL 4X8SL 4CUFA 2WPKE 5CISA 4MMYB 1MOXC 4D0EA 3HS5A 5E8DA 4Y76B 2NPRA 1F7MA 3S6XA 1KLIL 2VWMK 4ZH8B 2KV4A 1NFXB 3GCXE 4Z0LA 3TZIA 1TOZA 2VVUL 1NPEB 5JBAE 5JW1A 1EGFA 1RFNB 4RRXA 1L5GB 1M1XB 3HPTA 5CKMA 4Z0KB 3U73A 1CX2A 2P16L 2XC0L 3GCWE 3N8VA 1KLJL 1EMOA 3KQEL 5F1AA 4Y71B 4X8UL 1XFEA 3SW2A 2UWPB 5L2ZL 4BTTA 1PFXL 2YGQA 1F0SB 3N8WB 4Y7AB 2Y7XB 2P3TA 2RHPA 2VWLL 4JZEL 3V64C 3FBYA 1P9JA 2EI7B 2BMGA 1EPIA 3N8XA 5JBBE 1XKAL 4Y79B 3F1SB 4JZFL 1MQ5L 1SZBA 3F6UL 3SOVA 1YGCL 1IP0A 1LPZA 3TK6B 4BXSA 2PR3B 3CA7A 1ATAA 3GISX 3KL6B 4BTIA 1LMMA 4LMFA 2VH0B 3QH0A 5L30L 3M37L 4YZUB 3U7UG 3DEMA 5JVYA 2WPJE 2XC4L 2BQ6A 1NFUB 1DVAL 4MMZB 1WHFA 1IQML 4ISHL 1IQKL 1NFYB 1APOA 1CVUA 2FLBL 2Q1JB 4G1MB 4RS0A 2VVVL 1Q4GA 1CQEA 3N8ZA 1MQ6L 3K9XA 2W2QE 2XBYL 3PGHA 4JYVL 2P93L 1UZPA 1HAFA 4RRZA 3N8YB 2M74A 1HZ8A 4O1ZA 3HS6A 2WPLE 3H5CB 1A3PA 2BOKL 2BOHA 1EMNA 3KCGL 2YGOA 3TH3L 1JV2B 3CS7L 2Y5HL 4RRYA 1W7XL 2RNLA 1B9WA 2W2ME 3BT1A 3TBDA 1P0SL 1HT5A 1ZAQA 4OTYA 2VWNL 3IITB 2D1JB 3KK6A 4ZAEB 2MHPA 1NQLB 3QCWA 4AQTA 3HO4A 2H9EL 3LC5B 1QFKL 4RRWA 5CKQA 3LN0A 1V3XB 1HAEA 2TGFA 4M11A 3NTGA 1HCGB 1CEJA 1EZQB 1GK5A 1IQGL 1IGXA 2PUQL 3ENSA 1PTHA 5FDQA 4XLWA 3V65B 5EGMB 4D0FA 5JB8E 1FAKL 1FE2A 1KLOA 4X8VL 2I9BA 1C5MF 3FCSB 1YO8A 2J4IB 2AYLA 2P26A 2P3FL 2XC5L 2WG4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKH L;  5KIR A;  2UWO B;  1IQN L;  1JBU L;  4X8T L;  1URK A;  3POY A;  3NT1 A;  1U8C B;  1K37 A;  3R05 A;  4LOR A;  2WPI E;  4CUE A;  1N7D A;  2WFT A;  3N8Y A;  2BOX A;  2KB9 A;  1PGE A;  1IQH L;  1FJS L;  1ATB A;  5IKT A;  3LTG D;  4YT7 L;  1FFM A;  2XBW L;  4ZXY L;  3QMO A;  3OLT A;  1X7A L;  1IQE L;  2J2U B;  2GD4 A;  2Y38 A;  4NGA L;  4TGF A;  1G1T A;  2UWL B;  3TGF A;  1IQI L;  1HX2 A;  3LN1 A;  1XDT R;  3EGF A;  2G00 L;  2P3U A;  3NJP C;  4O02 B;  2Y82 B;  1LMJ A;  3Q7D A;  3KRK A;  3MDL A;  1N1I A;  2J95 B;  1FAX L;  4FM5 A;  1XKB A;  2XBV L;  4JYU L;  2W86 A;  2Y81 B;  3HS7 A;  1G1S A;  2WG3 C;  2BO2 A;  1IQL L;  1IQJ L;  4BTU A;  5KN5 C;  1EPG A;  1Z6C A;  3TK5 B;  3SOQ A;  1IVO C;  5F19 A;  1FF7 A;  1DIY A;  3KQD L;  4YT6 L;  3P5B L;  2W26 B;  5IKQ A;  2W3I B;  4CUD A;  3LC3 B;  1TLE A;  3N8W A;  4BXW A;  1L3Y A;  1IGZ A;  1CCV A;  1IJQ A;  1KSN B;  1NFW B;  2EI8 B;  1HJ7 A;  2WPH E;  3KQB L;  5CKN A;  2FLG A;  2WPM E;  1ATE A;  1UZQ A;  2OYU P;  3CEN L;  1Z6E L;  3IJE B;  1EPJ A;  1JL9 A;  5JVZ A;  1CCF A;  4OTJ A;  4Y6D B;  2Y5F L;  1KIG L;  3NTB A;  1LPK A;  5COX A;  1APQ A;  2FLR L;  3BPS E;  1G1R A;  3LTF B;  2WFX B;  3ASI A;  3HO3 A;  1W8B L;  1BF9 A;  2CJI B;  1YUF A;  3BT2 A;  1YUK B;  1PXX A;  4BDX A;  3LIW B;  2VVC K;  5JB9 E;  1EAI C;  1IQF L;  1ATD A;  2K2S B;  2WYG B;  1YUG A;  1HT8 A;  2WYJ B;  4BDW A;  1UZK A;  2J34 B;  4M10 A;  4ISI L;  3Q3K B;  3KQC L;  4NG9 L;  5IKR A;  2Y80 B;  1HRF A;  2VH6 B;  2EI6 B;  3MQE A;  2J94 B;  1PRH A;  2F9B L;  3LAQ A;  2I9A A;  4ZHA B;  3CFW A;  4RUT A;  2P3F N;  1DDX A;  3OLU A;  1EQH A;  1HRE A;  4COX A;  1I0U A;  2RA0 L;  4XBM A;  3ZYG A;  1NT0 A;  4XL1 A;  3RR3 A;  4C16 A;  5IKV A;  5JBC E;  4D90 A;  5I46 L;  2OYE P;  1OB1 C;  5L2Y L;  2KL7 A;  2J38 B;  1G2M B;  1WU1 B;  4A7I A;  4Y7B B;  4Z6A L;  6COX A;  2VWO L;  2BOU A;  1G2L B;  4NA9 L;  3ELA L;  3HO5 A;  3M36 L;  1DX5 I;  1K36 A;  4PH9 A;  2DDU A;  1COU A;  2BZ6 L;  2P94 L;  1LPG A;  4CSY A;  2MGR A;  3C9A C;  3SOB B;  2VJ3 A;  2BQW A;  1LQD A;  1DQB A;  1FSB A;  1NZI A;  1IOE L;  2W2O E;  5K0H B;  2XBX L;  1TPG A;  1F7E A;  2W2P E;  2Y7Z B;  1EPH A;  2FD6 A;  1U67 A;  3ZYJ B;  2FZZ L;  2Y5G L;  2ADX A;  1WHE A;  4ZXX L;  2BQ7 A;  2P28 B;  2PHB B;  1IOX A;  4MMX B;  2YGP A;  1EQG A;  2K2T A;  1EBV A;  1ADX A;  2P95 L;  1J9C L;  3ZYI B;  1AUT L;  3FFG L;  4E1G A;  4JZD L;  1UZJ A;  2W3K B;  1F0R B;  2W2N E;  1CVW L;  1G1Q A;  2MGP A;  2B7D L;  1O5D L;  4X8S L;  4CUF A;  2WPK E;  5CIS A;  4MMY B;  1MOX C;  4D0E A;  3HS5 A;  5E8D A;  4Y76 B;  2NPR A;  1F7M A;  1KLI L;  2VWM K;  4ZH8 B;  2KV4 A;  1NFX B;  3GCX E;  4Z0L A;  3TZI A;  1TOZ A;  2VVU L;  1NPE B;  5JBA E;  5JW1 A;  1EGF A;  1RFN B;  4RRX A;  1L5G B;  1M1X B;  3HPT A;  5CKM A;  4Z0K B;  3U73 A;  1CX2 A;  2P16 L;  2XC0 L;  3GCW E;  3N8V A;  1KLJ L;  1EMO A;  3KQE L;  5F1A A;  4Y71 B;  4X8U L;  1XFE A;  3SW2 A;  2UWP B;  5L2Z L;  4BTT A;  1PFX L;  4Y7A B;  1F0S B;  3N8W B;  2Y7X B;  2P3T A;  2RHP A;  2VWL L;  4JZE L;  3V64 C;  3FBY A;  1P9J A;  2EI7 B;  2BMG A;  1EPI A;  3N8X A;  5JBB E;  1XKA L;  4Y79 B;  3F1S B;  4JZF L;  1MQ5 L;  1SZB A;  3F6U L;  3SOV A;  1YGC L;  1IP0 A;  1LPZ A;  3TK6 B;  4BXS A;  2PR3 B;  3CA7 A;  1ATA A;  3GIS X;  3KL6 B;  4BTI A;  4LMF A;  2VH0 B;  3QH0 A;  5L30 L;  3M37 L;  4YZU B;  3U7U G;  3DEM A;  5JVY A;  2WPJ E;  2XC4 L;  2BQ6 A;  1NFU B;  1DVA L;  4MMZ B;  1WHF A;  1IQM L;  4ISH L;  1IQK L;  1NFY B;  1APO A;  1CVU A;  2FLB L;  2Q1J B;  4G1M B;  4RS0 A;  2VVV L;  1Q4G A;  1CQE A;  3N8Z A;  1MQ6 L;  3K9X A;  2W2Q E;  2XBY L;  3PGH A;  4JYV L;  2P93 L;  1UZP A;  1HAF A;  4RRZ A;  3N8Y B;  2M74 A;  1HZ8 A;  4O1Z A;  3HS6 A;  2WPL E;  3H5C B;  1A3P A;  2BOK L;  2BOH A;  1EMN A;  3KCG L;  2YGO A;  3TH3 L;  1JV2 B;  3CS7 L;  2Y5H L;  4RRY A;  1W7X L;  2RNL A;  1B9W A;  2W2M E;  3BT1 A;  3TBD A;  1P0S L;  1HT5 A;  1ZAQ A;  4OTY A;  2VWN L;  3IIT B;  2D1J B;  3KK6 A;  4ZAE B;  2MHP A;  1NQL B;  3QCW A;  4AQT A;  3HO4 A;  2H9E L;  3LC5 B;  1QFK L;  4RRW A;  5CKQ A;  3LN0 A;  1V3X B;  1HAE A;  2TGF A;  4M11 A;  3NTG A;  1HCG B;  1CEJ A;  1EZQ B;  1GK5 A;  1IQG L;  1IGX A;  2PUQ L;  3ENS A;  1PTH A;  5FDQ A;  4XLW A;  3V65 B;  5EGM B;  4D0F A;  5JB8 E;  1FAK L;  1FE2 A;  1KLO A;  4X8V L;  2I9B A;  1C5M F;  3FCS B;  1YO8 A;  2J4I B;  2AYL A;  2P26 A;  2P3F L;  2XC5 L;  2WG4 B; 
#chains in the Genus database with same CATH topology
 2HOR A;  2JKH L;  5KIR A;  2UWO B;  1IQN L;  1JBU L;  4X8T L;  1URK A;  3POY A;  3NT1 A;  1U8C B;  1K37 A;  3R05 A;  4LOR A;  2WPI E;  4CUE A;  1N7D A;  2WFT A;  3N8Y A;  2BOX A;  2KB9 A;  1PGE A;  1IQH L;  2H9E C;  1FJS L;  2KNI A;  1ATB A;  5IKT A;  3LTG D;  4YT7 L;  1FFM A;  2XBW L;  4ZXY L;  3QMO A;  3OLT A;  1X7A L;  1IQE L;  2J2U B;  2GD4 A;  2Y38 A;  4NGA L;  4TGF A;  1V1H A;  1G1T A;  2UWL B;  3TGF A;  1IQI L;  1HX2 A;  3LN1 A;  1XDT R;  3EGF A;  2G00 L;  2P3U A;  3NJP C;  4O02 B;  2Y82 B;  1LMJ A;  3Q7D A;  3KRK A;  3MDL A;  1N1I A;  2J95 B;  1FAX L;  4FM5 A;  1XKB A;  2XBV L;  4JYU L;  2W86 A;  3HS7 A;  2Y81 B;  1G1S A;  2WG3 C;  2BO2 A;  1IQL L;  1IQJ L;  4BTU A;  5KN5 C;  1EPG A;  1Z6C A;  3TK5 B;  3SOQ A;  1IVO C;  1LK9 A;  5F19 A;  1FF7 A;  4A94 C;  1DIY A;  3KQD L;  4YT6 L;  3P5B L;  2W26 B;  5IKQ A;  2W3I B;  4CUD A;  3LC3 B;  1TLE A;  3N8W A;  4BXW A;  1L3Y A;  1IGZ A;  1CCV A;  1IJQ A;  1KSN B;  1NFW B;  2EI8 B;  1HJ7 A;  2WPH E;  3KQB L;  5CKN A;  2FLG A;  2WPM E;  1ATE A;  1UZQ A;  2OYU P;  3CEN L;  1Z6E L;  3IJE B;  1EPJ A;  1JL9 A;  5JVZ A;  1CCF A;  4OTJ A;  4Y6D B;  2Y5F L;  1KIG L;  3NTB A;  1LPK A;  5COX A;  2JJL A;  1APQ A;  2FLR L;  3BPS E;  1G1R A;  3LTF B;  2WFX B;  3ASI A;  3HO3 A;  1W8B L;  1BF9 A;  2CJI B;  1YUF A;  3BT2 A;  1YUK B;  1PXX A;  4BDX A;  3LIW B;  2VVC K;  5JB9 E;  2HOX A;  1EAI C;  1IQF L;  1ATD A;  2K2S B;  2WYG B;  1YUG A;  1HT8 A;  2WYJ B;  4BDW A;  1UZK A;  2J34 B;  4M10 A;  4ISI L;  2WZP P;  3Q3K B;  3KQC L;  4NG9 L;  5IKR A;  2Y80 B;  1HRF A;  2VH6 B;  2EI6 B;  3MQE A;  2J94 B;  1PRH A;  2F9B L;  3LAQ A;  2I9A A;  4ZHA B;  3CFW A;  4RUT A;  2P3F N;  1KKE A;  1DDX A;  3OLU A;  1EQH A;  1HRE A;  4COX A;  1I0U A;  2RA0 L;  4XBM A;  3ZYG A;  1NT0 A;  4XL1 A;  3RR3 A;  4C16 A;  5IKV A;  5JBC E;  4D90 A;  5I46 L;  2OYE P;  1OB1 C;  5L2Y L;  2KL7 A;  2J38 B;  1G2M B;  1WU1 B;  4A7I A;  4Y7B B;  4Z6A L;  6COX A;  2VWO L;  2BOU A;  1G2L B;  3ELA L;  3HO5 A;  4NA9 L;  3M36 L;  1DX5 I;  1K36 A;  4PH9 A;  2DDU A;  1COU A;  2BZ6 L;  1QIU A;  2P94 L;  1LPG A;  4CSY A;  2MGR A;  3C9A C;  3SOB B;  2VJ3 A;  2BQW A;  1LQD A;  1DQB A;  1FSB A;  1NZI A;  1IOE L;  2W2O E;  5K0H B;  2XBX L;  1TPG A;  1F7E A;  2W2P E;  2Y7Z B;  1EPH A;  2FD6 A;  1U67 A;  3ZYJ B;  2FZZ L;  2Y5G L;  2ADX A;  1WHE A;  4ZXX L;  2BQ7 A;  2P28 B;  2PHB B;  1IOX A;  4MMX B;  2YGP A;  1EQG A;  2K2T A;  1EBV A;  1ADX A;  2P95 L;  1J9C L;  3ZYI B;  1AUT L;  3FFG L;  4E1G A;  4JZD L;  1UZJ A;  2W3K B;  1F0R B;  2W2N E;  1CVW L;  1G1Q A;  2MGP A;  2B7D L;  1O5D L;  4X8S L;  4CUF A;  2WPK E;  5CIS A;  4MMY B;  1MOX C;  4D0E A;  3HS5 A;  5E8D A;  4Y76 B;  2NPR A;  1F7M A;  3S6X A;  1KLI L;  2VWM K;  4ZH8 B;  2KV4 A;  1NFX B;  3GCX E;  4Z0L A;  3TZI A;  1TOZ A;  2VVU L;  1NPE B;  5JBA E;  5JW1 A;  1V1I A;  1EGF A;  1RFN B;  4RRX A;  2BT7 A;  1L5G B;  1M1X B;  3HPT A;  5CKM A;  4Z0K B;  3U73 A;  1CX2 A;  2P16 L;  2XC0 L;  3GCW E;  3N8V A;  1KLJ L;  1EMO A;  3KQE L;  5F1A A;  4Y71 B;  4X8U L;  1XFE A;  3SW2 A;  2UWP B;  5L2Z L;  4BTT A;  1PFX L;  2YGQ A;  1F0S B;  3N8W B;  4Y7A B;  2Y7X B;  2P3T A;  2RHP A;  2VWL L;  4JZE L;  3V64 C;  3FBY A;  1P9J A;  2EI7 B;  2BMG A;  2BSF A;  1EPI A;  3N8X A;  5JBB E;  1XKA L;  4Y79 B;  3F1S B;  4JZF L;  1MQ5 L;  1SZB A;  3F6U L;  3SOV A;  4GU4 A;  1YGC L;  1IP0 A;  1LPZ A;  3TK6 B;  4BXS A;  2PR3 B;  3CA7 A;  1ATA A;  3GIS X;  3KL6 B;  4BTI A;  1LMM A;  4LMF A;  2VH0 B;  3QH0 A;  5L30 L;  3M37 L;  4YZU B;  3U7U G;  3DEM A;  5JVY A;  2WPJ E;  2XC4 L;  2BQ6 A;  1NFU B;  1DVA L;  4MMZ B;  1WHF A;  1IQM L;  4ISH L;  1IQK L;  1NFY B;  1APO A;  1CVU A;  2FLB L;  2Q1J B;  4G1M B;  4RS0 A;  2VVV L;  1Q4G A;  1CQE A;  3N8Z A;  1MQ6 L;  3K9X A;  2W2Q E;  2XBY L;  3PGH A;  4JYV L;  2P93 L;  1UZP A;  1HAF A;  4RRZ A;  3N8Y B;  2M74 A;  1HZ8 A;  4O1Z A;  3HS6 A;  2WPL E;  3H5C B;  1A3P A;  2BOK L;  2BOH A;  1EMN A;  3KCG L;  2YGO A;  3TH3 L;  1JV2 B;  3CS7 L;  2Y5H L;  4RRY A;  1W7X L;  2RNL A;  1B9W A;  4GU3 A;  2W2M E;  3BT1 A;  3TBD A;  1P0S L;  1HT5 A;  1ZAQ A;  4OTY A;  2VWN L;  3IIT B;  2D1J B;  3KK6 A;  4ZAE B;  2MHP A;  1NQL B;  3QCW A;  4AQT A;  3HO4 A;  2H9E L;  3LC5 B;  1QFK L;  4RRW A;  5CKQ A;  2BT8 A;  3LN0 A;  1V3X B;  1HAE A;  2TGF A;  4M11 A;  3NTG A;  1HCG B;  1CEJ A;  1EZQ B;  1GK5 A;  1IQG L;  2VRS A;  1IGX A;  2PUQ L;  3ENS A;  1PTH A;  5FDQ A;  4XLW A;  3V65 B;  5EGM B;  4D0F A;  5JB8 E;  1FAK L;  1FE2 A;  1KLO A;  4X8V L;  2I9B A;  1C5M F;  3FCS B;  1YO8 A;  2J4I B;  2AYL A;  2P26 A;  2P3F L;  2XC5 L;  2WG4 B; 
#chains in the Genus database with same CATH homology
 2JKH L;  5KIR A;  2UWO B;  1IQN L;  1JBU L;  4X8T L;  1URK A;  3POY A;  3NT1 A;  1U8C B;  1K37 A;  3R05 A;  4LOR A;  2WPI E;  4CUE A;  1N7D A;  2WFT A;  3N8Y A;  2BOX A;  2KB9 A;  1PGE A;  1IQH L;  2H9E C;  1FJS L;  2KNI A;  1ATB A;  5IKT A;  3LTG D;  4YT7 L;  1FFM A;  2XBW L;  4ZXY L;  3QMO A;  3OLT A;  1X7A L;  1IQE L;  2J2U B;  2GD4 A;  2Y38 A;  4NGA L;  4TGF A;  1G1T A;  2UWL B;  3TGF A;  1IQI L;  1HX2 A;  3LN1 A;  1XDT R;  3EGF A;  2G00 L;  2P3U A;  3NJP C;  4O02 B;  2Y82 B;  1LMJ A;  3Q7D A;  3KRK A;  3MDL A;  1N1I A;  2J95 B;  1FAX L;  4FM5 A;  1XKB A;  2XBV L;  4JYU L;  2W86 A;  2Y81 B;  3HS7 A;  1G1S A;  2WG3 C;  2BO2 A;  1IQL L;  1IQJ L;  4BTU A;  5KN5 C;  1EPG A;  1Z6C A;  3TK5 B;  3SOQ A;  1IVO C;  5F19 A;  1FF7 A;  4A94 C;  1DIY A;  3KQD L;  4YT6 L;  3P5B L;  2W26 B;  5IKQ A;  2W3I B;  4CUD A;  3LC3 B;  1TLE A;  3N8W A;  4BXW A;  1L3Y A;  1IGZ A;  1CCV A;  1IJQ A;  1KSN B;  1NFW B;  2EI8 B;  1HJ7 A;  2WPH E;  3KQB L;  5CKN A;  2FLG A;  2WPM E;  1ATE A;  1UZQ A;  2OYU P;  3CEN L;  1Z6E L;  3IJE B;  1EPJ A;  1JL9 A;  5JVZ A;  1CCF A;  4OTJ A;  4Y6D B;  2Y5F L;  1KIG L;  3NTB A;  1LPK A;  5COX A;  1APQ A;  2FLR L;  3BPS E;  1G1R A;  3LTF B;  2WFX B;  3ASI A;  3HO3 A;  1W8B L;  1BF9 A;  2CJI B;  1YUF A;  3BT2 A;  1YUK B;  1PXX A;  4BDX A;  3LIW B;  2VVC K;  5JB9 E;  1EAI C;  1IQF L;  1ATD A;  2K2S B;  2WYG B;  1YUG A;  1HT8 A;  2WYJ B;  4BDW A;  1UZK A;  2J34 B;  4M10 A;  4ISI L;  2WZP P;  3Q3K B;  3KQC L;  4NG9 L;  5IKR A;  2Y80 B;  1HRF A;  2VH6 B;  2EI6 B;  3MQE A;  2J94 B;  1PRH A;  2F9B L;  3LAQ A;  2I9A A;  4ZHA B;  3CFW A;  4RUT A;  2P3F N;  1DDX A;  3OLU A;  1EQH A;  1HRE A;  4COX A;  1I0U A;  2RA0 L;  4XBM A;  3ZYG A;  1NT0 A;  4XL1 A;  3RR3 A;  4C16 A;  5IKV A;  5JBC E;  4D90 A;  5I46 L;  2OYE P;  1OB1 C;  5L2Y L;  2KL7 A;  2J38 B;  1G2M B;  1WU1 B;  4A7I A;  4Y7B B;  4Z6A L;  6COX A;  2VWO L;  2BOU A;  1G2L B;  4NA9 L;  3ELA L;  3HO5 A;  3M36 L;  1DX5 I;  1K36 A;  4PH9 A;  2DDU A;  1COU A;  2BZ6 L;  2P94 L;  1LPG A;  4CSY A;  2MGR A;  3C9A C;  3SOB B;  2VJ3 A;  2BQW A;  1LQD A;  1DQB A;  1FSB A;  1NZI A;  1IOE L;  2W2O E;  5K0H B;  2XBX L;  1TPG A;  1F7E A;  2W2P E;  2Y7Z B;  1EPH A;  2FD6 A;  1U67 A;  3ZYJ B;  2FZZ L;  2Y5G L;  2ADX A;  1WHE A;  4ZXX L;  2BQ7 A;  2P28 B;  2PHB B;  1IOX A;  4MMX B;  2YGP A;  1EQG A;  2K2T A;  1EBV A;  1ADX A;  2P95 L;  1J9C L;  3ZYI B;  1AUT L;  3FFG L;  4E1G A;  4JZD L;  1UZJ A;  2W3K B;  1F0R B;  2W2N E;  1CVW L;  1G1Q A;  2MGP A;  2B7D L;  1O5D L;  4X8S L;  4CUF A;  2WPK E;  5CIS A;  4MMY B;  1MOX C;  4D0E A;  3HS5 A;  5E8D A;  4Y76 B;  2NPR A;  1F7M A;  3S6X A;  1KLI L;  2VWM K;  4ZH8 B;  2KV4 A;  1NFX B;  3GCX E;  4Z0L A;  3TZI A;  1TOZ A;  2VVU L;  1NPE B;  5JBA E;  5JW1 A;  1EGF A;  1RFN B;  4RRX A;  1L5G B;  1M1X B;  3HPT A;  5CKM A;  4Z0K B;  3U73 A;  1CX2 A;  2P16 L;  2XC0 L;  3GCW E;  3N8V A;  1KLJ L;  1EMO A;  3KQE L;  5F1A A;  4Y71 B;  4X8U L;  1XFE A;  3SW2 A;  2UWP B;  5L2Z L;  4BTT A;  1PFX L;  2YGQ A;  1F0S B;  3N8W B;  4Y7A B;  2Y7X B;  2P3T A;  2RHP A;  2VWL L;  4JZE L;  3V64 C;  3FBY A;  1P9J A;  2EI7 B;  2BMG A;  1EPI A;  3N8X A;  5JBB E;  1XKA L;  4Y79 B;  3F1S B;  4JZF L;  1MQ5 L;  1SZB A;  3F6U L;  3SOV A;  1YGC L;  1IP0 A;  1LPZ A;  3TK6 B;  4BXS A;  2PR3 B;  3CA7 A;  1ATA A;  3GIS X;  3KL6 B;  4BTI A;  1LMM A;  4LMF A;  2VH0 B;  3QH0 A;  5L30 L;  3M37 L;  4YZU B;  3U7U G;  3DEM A;  5JVY A;  2WPJ E;  2XC4 L;  2BQ6 A;  1NFU B;  1DVA L;  4MMZ B;  1WHF A;  1IQM L;  4ISH L;  1IQK L;  1NFY B;  1APO A;  1CVU A;  2FLB L;  2Q1J B;  4G1M B;  4RS0 A;  2VVV L;  1Q4G A;  1CQE A;  3N8Z A;  1MQ6 L;  3K9X A;  2W2Q E;  2XBY L;  3PGH A;  4JYV L;  2P93 L;  1UZP A;  1HAF A;  4RRZ A;  3N8Y B;  2M74 A;  1HZ8 A;  4O1Z A;  3HS6 A;  2WPL E;  3H5C B;  1A3P A;  2BOK L;  2BOH A;  1EMN A;  3KCG L;  2YGO A;  3TH3 L;  1JV2 B;  3CS7 L;  2Y5H L;  4RRY A;  1W7X L;  2RNL A;  1B9W A;  2W2M E;  3BT1 A;  3TBD A;  1P0S L;  1HT5 A;  1ZAQ A;  4OTY A;  2VWN L;  3IIT B;  2D1J B;  3KK6 A;  4ZAE B;  2MHP A;  1NQL B;  3QCW A;  4AQT A;  3HO4 A;  2H9E L;  3LC5 B;  1QFK L;  4RRW A;  5CKQ A;  3LN0 A;  1V3X B;  1HAE A;  2TGF A;  4M11 A;  3NTG A;  1HCG B;  1CEJ A;  1EZQ B;  1GK5 A;  1IQG L;  1IGX A;  2PUQ L;  3ENS A;  1PTH A;  5FDQ A;  4XLW A;  3V65 B;  5EGM B;  4D0F A;  5JB8 E;  1FAK L;  1FE2 A;  1KLO A;  4X8V L;  2I9B A;  1C5M F;  3FCS B;  1YO8 A;  2J4I B;  2AYL A;  2P26 A;  2P3F L;  2XC5 L;  2WG4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...