1IJQA

Crystal structure of the ldl receptor ywtd-egf domain pair
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
316
structure length
308
Chain Sequence
IAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid transport
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
publication title Implications for familial hypercholesterolemia from the structure of the LDL receptor YWTD-EGF domain pair.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 308
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1ijqA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 1ijqA01
3IITB 4D90A 2GVXA 2P28B 5GTQA 1FE2A 2FLBL 4GNAA 2RHPA 2XBWL 4OTJA 4XLWA 3HO5A 1BF9A 4GN7A 1HAEA 1HX2A 2V91A 2VAQA 2G8SA 4Q1UA 1ATAA 2FD6A 5GX2A 3FCSB 2OYEP 3N8ZA 2HQSA 1MQ6L 4ZH8B 4YT6L 2UWPB 4A7IA 2WPIE 1EMOA 3CENL 1G2MB 2NPRA 3R05A 4RRZA 5F19A 3KQEL 1QFKL 2W26B 1CEJA 1HAFA 1F7EA 2W2ME 3KRKA 3LTFB 5CKQA 1L5GB 5EX7A 5K0HB 1NFYB 3HO3A 5KIRA 2GVUA 3EGFA 2GD4A 4CSYA 1NQLB 4Z6AL 2AYLA 1XFEA 2VWNL 4HW6A 2P3FN 3HO4A 1TLEA 1APQA 3FVZA 2M74A 2VH6B 3ASIA 1OB1C 2FPBA 2BQWA 2KV4A 1EPGA 1FJSL 4BTUA 4ISHL 2Y82B 3S8ZA 1NFWB 4ZLRA 1A3PA 4D0FA 2Y7XB 1HJ7A 2W2NE 5I46L 2FP9A 5GX5A 1IP0A 3LC5B 3PGHA 2W3IB 2EI6B 2DDUA 3TC9A 1C5MF 3TK5B 4ZHAB 1RWLA 4CUEA 3LN0A 3Q3KB 2WYGB 2VWMK 3G4EA 3SRGA 3SOBB 1CVUA 4RRWA 1MQ5L 1CCFA 1EMNA 3FBYA 3M36L 6COXA 3HLIA 1F0RB 1V3XB 1K36A 2WFXB 3LI3A 3V64C 1Q4GA 4MMYB 2RA0L 3HS7A 3ZYGA 2DSOA 2TGFA 5D9BA 2B7DL 1HCGB 5JBBE 5L2YL 2K2TA 2VVVL 1M1XB 2XBVL 4NG9L 4X8SL 3HS6A 3QMOA 2IAQA 2GVVA 1EZQB 2W3KB 2VVUL 4BXSA 1SZBA 3FW0A 2J95B 1H6LA 4GN8A 3MDLA 3O4PA 1KLIL 1Z6EL 5E8DA 2J34B 1UZKA 4ZXXL 1P0SL 1NPEB 1KLOA 2Y38A 1PRHA 3RR3A 1IQNL 1CQ1A 2Y5GL 2P3FL 4Y7AB 4O1ZA 2PHBB 2BOHA 2BQ7A 1IGXA 4O02B 4X8UL 4X8VL 4YZUB 3Q6PA 3GCWE 2WPKE 5IKQA 2Y81B 1G1TA 3KGGA 1NFUB 2XC0L 2XC4L 3NT1A 3BYCA 1FAXL 1URKA 4JYUL 4RS0A 1EBVA 4CUDA 1JV2B 3SOQA 3DR2A 3KL6B 3OLUA 1LPZA 4NA9L 4XBMA 1DQBA 4RUTA 1CRZA 2IASA 1DX5I 1TOZA 1CX2A 3AMRA 5CKNA 1XDTR 2MGPA 1AUTL 3K9XA 1NZIA 2OJHA 2J4IB 3V65B 5FDQA 4RRYA 3S8VA 2FLGA 2BOXA 5CKMA 2JKHL 2IARA 3IAXA 1YUGA 2ISMA 2YGOA 2W8BA 4BTIA 1EQHA 2W2OE 4IMBA 1UZJA 1P9JA 3HS5A 1PGEA 1IQJL 2K2SB 3U7UG 2W86A 2F9BL 4PH9A 3ZYIB 2GHSA 1HREA 2MHPA 1JBUL 4LORA 2DG1A 2IAVA 3LN1A 1L3YA 4FM5A 2P94L 1CQEA 1G2LB 5IKRA 1COUA 2EI8B 1YO8A 5COXA 2W8BB 2WPME 5EGMB 1PFXL 3F6UL 3LIWB 4COXA 2W2PE 1RWIA 2FPCA 1ZAQA 3U0SA 1IQGL 1V04A 5GX3A 3SREA 1PJXA 2BOUA 1KIGL 3AMSA 4Y7BB 3F1SB 3NTBA 1CCVA 4LMFA 4JZFL 3ZYJB 2POOA 2WG4B 1DIYA 4NGAL 1NPEA 3LTGD 3TK6B 4GNBA 2P3TA 3HLHA 1IOEL 1ATEA 4O5TA 1ADXA 2ADXA 1U8CB 1HT5A 4BTTA 1C9UA 1LMJA 2P93L 3N8YA 2IVZA 3KQBL 4Y76B 3LC3B 2Y5FL 2G00L 4AQTA 3CA7A 5GX1A 1U67A 2FLRL 2PUQL 2QE8A 3A9GA 3QH0A 4G1MB 4BXWA 1CRUA 1NT0A 5CISA 3WW9A 3KQDL 2IAWA 1FAKL 3TGFA 2Y5HL 1Q7FA 1YUFA 3N8YB 4XL1A 1E1AA 4BDXA 3KYAA 1TPGA 3BPSE 4M11A 1RFNB 2Q1JB 2WPLE 1C5KA 4HHQA 4OTYA 1EPIA 2WPHE 1ATDA 3Q6KA 2FP8A 4JZEL 3A9HA 3N8WB 2P4OA 1WU1B 4M10A 5GX4A 5F1AA 5KN5C 1I0UA 2PR3B 4PWZA 1K37A 1F7MA 5IKVA 2BO2A 3GISX 2XBXL 4Y71B 3LI4A 3TH3L 2J2UB 3TBDA 3P5BL 1EQGA 1IQML 1EGFA 2VH0B 1HZ8A 1JL9A 3S94A 4R40A 1EPHA 4C16A 3QCWA 1HRFA 3HRPA 3SOVA 1ATBA 4IYGA 2D1JB 4ISIL 1QLGA 1DVAL 3WWAA 2UWOB 1WHFA 2P26A 2KB9A 1EAIC 2P95L 3KCGL 2RNLA 2XBYL 3Q7DA 5JBCE 4YT7L 3G4HA 4Y6DB 1IQKL 4RRXA 3POYA 2IAOA 2EI7B 1G1QA 4Z0KB 3GCXE 1IGZA 4Z0LA 3HPTA 4DG6A 1PXXA 1PTHA 3CS7L 1IQEL 4O5SA 1YUKB 4ZAEB 2W2QE 2BQ6A 4BDWA 1IQHL 1UZPA 2J38B 1O5DL 1POOA 2OYUP 3ENSA 3NTGA 2UWLB 3NJPC 5JB8E 2VJ3A 3E5ZA 3FFGL 3ELAL 4Y79B 2I9BA 2MGRA 1APOA 1IVOC 1KSNB 5L30L 1Z6CA 3BT1A 1B9WA 1F0SB 1XKAL 1GK5A 3TZIA 5FWWA 1WHEA 5JVZA 2IATA 2IAXA 3DASA 4ZXYL 5L2ZL 4HHOA 4D0EA 1W7XL 3BT2A 3SW2A 4X8TL 1YGCL 1HT8A 3C9AC 3KK6A 3M37L 1W8BL 2YGPA 1X7AL 2VVCK 1XKBA 4TGFA 4GN9A 3U73A 4MMZB 1UZQA 2IAPA 1IQLL 2WFTA 3MQEA 1MOXC 4E1GA 2WG3C 2VWOL 1IQFL 4JMLA 1G1SA 1CVWL 2Y7ZB 2Y80B 3LAQA 1IQIL 1LPKA 3N8VA 1FF7A 4GNCA 3N8WA 2CJIB 3V1SA 2FZZL 4A0PA 1EPJA 1LQDA 4JZDL 1J9CL 5JB9E 3S2KA 1FSBA 3KQCL 2XC5L 1G1RA 1DDXA 3OLTA 1CVMA 2DG0A 1KLJL 3N8XA 1NFXB 2H9EL 2BOKL 1N7DA 2WPJE 4JYVL 3Q6TA 1QBIA 2VWLL 5JBAE 2IAUA 1IJQA 3LI5A 1N1IA 3H5CB 2GVWA 2WYJB 4CUFA 3I1CA 3CFWA 5D9CA 5IKTA 3IJEB 1IOXA 5D9DA 2I9AA 1FFMA 2BMGA 5JVYA 2J94B 2P3UA 5JW1A 1LPGA 2BZ6L 3DEMA 2P16L 2KL7A 4MMXB
chains in the Genus database with same CATH superfamily
3IITB 4D90A 3O9JA 2GVXA 2P28B 2AGSA 5GTQA 4YW1A 1FE2A 4JF7A 2FLBL 4XJAA 4GNAA 2RHPA 2XBWL 3VNGA 1W0PA 4OTJA 4XLWA 3HO5A 5FZJA 1BF9A 4GN7A 1HAEA 1HX2A 2V91A 2VAQA 4FOQA 2X9MA 2G8SA 4Q1UA 1ATAA 2FD6A 5H47A 5GX2A 3FCSB 2OYEP 1BJIA 3N8ZA 1K32A 2HQSA 1MQ6L 4XHBA 4K1HA 3SLIA 4ZH8B 4YT6L 2XZJA 2QWCA 2UWPB 4A7IA 2WPIE 1EMOA 2H9EC 4FPYA 3L6VA 3TI5A 3CENL 1G2MB 4FP2A 2NPRA 3R05A 4RRZA 5F19A 2BT8A 3KQEL 1W1XA 4MWQA 1QFKL 2W26B 1CEJA 1HAFA 1N1YA 2QWKA 1F7EA 2W2ME 3KRKA 4FPCA 1INHA 4QN3A 4FVKA 3LTFB 5CKQA 1L5GB 5EX7A 1A14N 1N1VA 5K0HB 1NFYB 4KS3A 4B7NA 4N1BA 3HO3A 5KIRA 2GVUA 2VK5A 3EGFA 4UOUA 2GD4A 4CSYA 1NQLB 4Z6AL 2AYLA 1VCUA 1XFEA 2VWNL 5HUKA 4HW6A 1IVCA 1Z4ZA 1MS3A 4YW5A 3CYEA 2P3FN 3HO4A 1TLEA 4HZWA 1APQA 3FVZA 2M74A 2VWDA 2VH6B 3ASIA 3D11A 4KS4A 1OB1C 2FPBA 2BQWA 2QWGA 3NN9A 4QNPA 4C1YA 2KV4A 4HZYA 1INGA 1EPGA 1FJSL 4BTUA 4J9TA 3TI6A 4ISHL 2Y82B 4MWLA 1NFWB 3S8ZA 4ZLRA 1A3PA 4D0FA 4XJ9A 2Y7XB 1HJ7A 2W2NE 5I46L 1Z4XA 2FP9A 3BEQA 1IP0A 1MS4A 3LC5B 3PGHA 4FOVA 4CHBA 1USXA 4YZ2A 2W3IB 2EI6B 2DDUA 3TC9A 4CPMA 1C5MF 3TK5B 1E8VA 1V0FA 2HTYA 4FPFA 4ZHAB 1RWLA 2HU4A 4CUEA 3GVLA 4GZXA 3LN0A 2HORA 1NNCA 3Q3KB 2WYGB 2VWMK 1W8NA 3G4EA 3SRGA 3SOBB 4B7MA 1IUBA 3TIAA 1X2RA 3K36A 1CVUA 2KNIA 4RRWA 2W38A 5FNQA 4L7CA 2BT7A 1MQ5L 1CCFA 1EMNA 3FBYA 3M36L 6COXA 1INFA 3HLIA 4GZPA 1F0RB 1V3XB 1K36A 2B8HA 3A72A 1V1HA 4CSDA 2WFXB 1DILA 3LI3A 4GZSA 3V64C 1Q4GA 4MMYB 4XIOA 1LMMA 4D52B 2RA0L 3HS7A 3ZYGA 2DSOA 1N6EA 4M4NA 2H2NA 2TGFA 4FQ4A 5D9BA 2B7DL 1HCGB 5JBBE 5L2YL 1NSDA 4MZEA 2K2TA 2VVVL 4MJUA 1M1XB 4QN6A 2XBVL 4NG9L 4X8SL 2YGQA 3HS6A 3QMOA 2IAQA 2GVVA 1EZQB 2QWJA 1W20A 2W3KB 2VVUL 4BXSA 1SZBA 1W8OA 3FW0A 1V1IA 2J95B 1H6LA 4GN8A 4M4UA 3MDLA 4XIKA 4XJ8A 3O4PA 4CPLA 1KLIL 1Z6EL 5E8DA 1USRA 2J34B 1UZKA 2HOXA 4ZXXL 3INBA 2AH2A 1P0SL 1NPEB 1KLOA 2Y38A 1PRHA 4FPHA 3RR3A 1IQNL 1CQ1A 2Y5GL 2P3FL 2QWIA 4Y7AB 4O1ZA 4MJVA 1IVEA 2PHBB 4X6KA 3ADEA 4D4UA 4GZWA 2BOHA 2SIMA 1B9SA 4MWJA 3UC1A 1INWA 5FNTA 2BQ7A 4MWWA 7NN9A 1IGXA 4O02B 4X8UL 1INXA 1OFZA 4X8VL 4GEZA 4YZUB 2BERA 1EUTA 3Q6PA 3GCWE 2WPKE 5IKQA 2SILA 2Y81B 1G1TA 3KGGA 1NFUB 2XC0L 2XC4L 3NT1A 2HTVA 3BYCA 3H6JA 1FAXL 1KKEA 1URKA 4JYUL 1V0ZA 1VCJA 2XZIA 4RS0A 4KS2A 4YW4A 4B7QA 1V3BA 1NCDN 1EBVA 4CUDA 1SUUA 1JV2B 4XJRA 4XMAA 3SOQA 5HUGA 2F12A 3DR2A 4IFLX 4XJQA 3SILA 3KL6B 3OLUA 1LPZA 1NSBA 4NA9L 4XBMA 1DQBA 4WEGA 3TI3A 1MS9A 4BBWA 4RUTA 3A71A 1CRZA 2IASA 4Q6KA 1DX5I 1TOZA 1NNBA 1CX2A 3AMRA 4FZHA 3K38A 1NN2A 5CKNA 1Z4VA 1XDTR 2VRSA 2MGPA 2VW2A 1AUTL 1W0OA 3K9XA 4H53A 3OPZA 1NZIA 5HX0A 2OJHA 1U6DX 2J4IB 1EUSA 3V65B 3TICA 1MR5A 5FDQA 1V2IA 4RRYA 3S8VA 4IN4A 2FLGA 2BOXA 5CKMA 2JKHL 1SO7A 2IARA 1NCBN 3IAXA 1YUGA 2ISMA 2YGOA 2BSFA 2W8BA 1Z4YA 4QN4A 4BTIA 1EQHA 4SLIA 1NNAA 4QN7A 2W2OE 4IMBA 4K3YA 1UZJA 1P9JA 4GB1A 3HS5A 1PGEA 1E8UA 1WCQA 2W20A 2VK6A 1IQJL 2K2SB 3U7UG 2W86A 2F9BL 4PH9A 3ZYIB 2BF6A 4GU3A 1B9VA 2GHSA 4HZVA 1V3EA 1HREA 1B9TA 1Z50A 2MHPA 1JBUL 4LORA 2DG1A 2IAVA 1IVDA 4I00A 4X47A 3LN1A 1L3YA 4FM5A 4WA5A 2P94L 1CQEA 1G2LB 1L7GA 2BATA 5IKRA 2F24A 5JYYA 1COUA 2EI8B 1YO8A 5COXA 1NCCN 2ZW9A 4IFJA 4ZY3A 2W8BB 4GJTA 4XYXA 2QWFA 1INVA 2F0ZA 1IUCA 1S18A 4XOGA 2WPME 5EO7A 5EGMB 4MX0A 1PFXL 3F6UL 2ZZKA 3LIWB 1IVBA 4IFNX 4D52A 2AEQA 5HUNA 4K1KA 4COXA 4HZZA 2W2PE 1RWIA 5F72C 2FPCA 5F9TA 1ZAQA 4MWYA 1N6FA 1V3CA 4MC7A 3CL2A 4K1JA 3U0SA 2ZB6A 1IQGL 1MWEA 1V04A 3CL0A 4XJUA 3SREA 5GX3A 1PJXA 2VW0A 2BOUA 3O9KA 1KIGL 5CGJA 4MWRA 3II7A 2CMLA 3AMSA 2QWHA 2XCYA 3JU4A 4Y7BB 1SNTA 3F1SB 3NTBA 1CCVA 2XN4A 4LMFA 3K39A 4JZFL 3ZYJB 3T1EA 4YW3A 2C4LA 1V3DA 2POOA 4FPLA 4NN9A 2WG4B 1SLIA 1DIYA 4NGAL 2C4AA 5EO8A 1NPEA 1XOEA 4GZOA 3LTGD 3TK6B 4GNBA 1WP5A 2P3TA 2FLUX 2W5OA 1IOEL 1ATEA 3HLHA 1ADXA 4O5TA 5M1ZA 1S0JA 2ADXA 1IVFA 1U8CB 1HT5A 4X49A 4BTTA 1C9UA 1LMJA 1ZI0A 2QWDA 4G3NA 3K37A 3SANA 2P93L 3N8YA 1NCAN 2IVZA 3W09A 3KQBL 4FPGA 4Y76B 1SLLA 1MZ6A 3LC3B 2Y5FL 2WZPP 2G00L 4AQTA 3CA7A 5GX1A 2F13A 1U67A 2VW1A 3TIBA 4MWVA 2FLRL 3S6XA 1QIUA 2PUQL 4YZ4A 2QE8A 1ZGKA 4YW2A 2W5NA 3A9GA 1L7HA 2QWBA 3QH0A 4G1MB 1LK9A 4GZTA 4BXWA 1NMCA 1CRUA 3WDZA 4WA4A 1NT0A 5CISA 3WW9A 3KQDL 2IAWA 2HTQA 4FPJA 1FAKL 1W21A 4CPYA 3TGFA 2Y5HL 1Q7FA 1YUFA 3N8YB 4XL1A 4XHXA 1E1AA 4BDXA 1MS1A 3KYAA 1TPGA 4A94C 2HU0A 4GU4A 3BPSE 4M11A 1NMBN 1DIMA 4KS1A 1RFNB 2Q1JB 2WPLE 1C5KA 2YA5A 4HIZA 4XILA 4HHQA 4OTYA 4FP3A 1EPIA 4KS5A 2VSMA 1XOGA 2WPHE 1ATDA 3Q6KA 2FP8A 4JZEL 3A9HA 3N8WB 5FNUA 2P4OA 1WU1B 4D52C 3K3AA 4M10A 2BZDA 5GX4A 2JJLA 5F1AA 5KN5C 4X4AA 1I0UA 2PR3B 2FHRA 2QWAA 4PWZA 1K37A 5FZNA 4FJ6A 1F7MA 5IKVA 4GDJA 2BO2A 3GISX 2XBXL 2YA7A 4Y71B 3LI4A 3TH3L 2F28A 2J2UB 3TBDA 3P5BL 1EQGA 1A4GA 1IQML 4M4VA 1EGFA 2VH0B 2YA4A 1HZ8A 2HTRA 1JL9A 1F8EA 2VSKA 4ZGCA 1NMAN 4FPEA 4MZAA 3S94A 4MWXA 4R40A 4B7JA 1EPHA 1WCSA 4C16A 3SALA 3QCWA 1HRFA 2JKBA 1V0EA 2A75A 3HRPA 3SOVA 1ATBA 4B7RA 4FOWA 4IYGA 1N1TA 1N6DA 3H71A 2D1JB 4ISIL 1QLGA 2HTWA 2F25A 1DVAL 4AH4A 4CPOA 3WWAA 3VNHA 2UWOB 1INYA 1WHFA 4WEFA 1MS5A 2P26A 2KB9A 1EAIC 2P95L 3KCGL 2RNLA 2XBYL 3Q7DA 5JBCE 4YT7L 2Z32A 3G4HA 4Y6DB 1IQKL 3CKZA 4RRXA 3POYA 2IAOA 2EI7B 1G1QA 2AEPA 4Z0KB 3GCXE 1IGZA 4Z0LA 3HPTA 4DG6A 5B2DA 2F27A 3ZGCA 1N1SA 1PXXA 1PTHA 4GZQA 4D8SA 3CS7L 1IQEL 4L7DA 4O5SA 4HZXA 2HT5A 2WOZA 1YUKB 4ZAEB 1F8BA 2W2QE 2BQ6A 3NSSA 4QN5A 4BDWA 1IQHL 1MZ5A 2HT8A 1UZPA 2J38B 4UF7A 1MS0A 1O5DL 1POOA 2OYUP 3ENSA 3NTGA 4L7BA 2ZB5A 4XJZA 2UWLB 4YZ5A 3NJPC 5JB8E 2VJ3A 3E5ZA 3GVKA 4AGIA 3FFGL 2YA6A 1S0IA 3ELAL 4Y79B 2I9BA 2MGRA 1APOA 5HUMA 1IVOC 1KSNB 5L30L 4CPNA 5NN9A 1Z6CA 3BT1A 1B9WA 1E8TA 4IQKA 4CH9A 1S1DA 4AGTA 1F0SB 5B2CA 1XKAL 2DYHA 1GK5A 3TZIA 5FWWA 1WHEA 2F10A 5JVZA 1MS8A 2IATA 2IAXA 3DASA 4XE9A 4ZXYL 5L2ZL 4AHAA 4XJWA 4HHOA 4D0EA 1W7XL 2VPJA 3BT2A 4FPOB 3SW2A 4X8TL 4NCSA 1YGCL 4M3MA 2F11A 3TI4A 1HT8A 2QWEA 4DGRA 3C9AC 3KK6A 3M37L 4FOYA 6NN9A 1W8BL 2YGPA 1X7AL 1IVGA 2VVCK 4WA3A 3PJQA 4CPZA 2VK7A 1XKBA 5FNRA 1KITA 4TGFA 4C1YB 4GN9A 3TI8A 3U73A 4MMZB 1UZQA 1EUUA 2IAPA 1IQLL 2WFTA 2YDTA 4H52A 3MQEA 1MOXC 4E1GA 2WG3C 2VWOL 1IQFL 4JMLA 2RKCA 1G1SA 1CVWL 2Y7ZB 2Y80B 3LAQA 1IQIL 3H72A 1LPKA 3N8VA 4MWUA 1FF7A 2XZKA 4GNCA 3N8WA 3ALWA 4XMIA 2CJIB 1Z4WA 3V1SA 3ALXA 2FZZL 2VVZA 3D12A 4A0PA 1EPJA 4GDIA 1LQDA 4JZDL 4K1IA 1J9CL 2YA8A 5JB9E 3S2KA 2SLIA 1FSBA 3KQCL 2XC5L 1G1RA 3B69A 1DDXA 3OLTA 1CVMA 2DG0A 3GVJA 2ZWAA 1KLJL 1X2JA 3N8XA 1NFXB 2HTUA 3WN7A 4YY8A 2H9EL 1F8CA 3ZGDA 1A4QA 2BOKL 1F8DA 2HT7A 1N7DA 2WPJE 4JYVL 3H73A 1NSCA 3Q6TA 1QBIA 2VWLL 5JBAE 2IAUA 1EURA 1IJQA 2YDPA 1N1IA 3LI5A 4FPKA 3H5CB 2GVWA 2WYJB 2H2UA 3NO0A 4CUFA 3I1CA 3CFWA 4NC5A 5D9CA 5IKTA 5GX5A 3IJEB 4YZ3A 1IOXA 5FNSA 5D9DA 2I9AA 1FFMA 2BMGA 2F26A 4ASCA 3B7EA 5JVYA 2J94B 2P3UA 5JW1A 1LPGA 2BZ6L 3DEMA 2F29A 4XMBA 4YZ1A 2P16L 2KL7A 1L7FA 4MMXB
chains in the Genus database with same CATH topology
3IITB 4D90A 2GVXA 2P28B 5GTQA 1FE2A 2FLBL 4GNAA 2RHPA 2XBWL 4OTJA 4XLWA 3HO5A 1BF9A 4GN7A 1HAEA 1HX2A 2V91A 2VAQA 2G8SA 4Q1UA 1ATAA 2FD6A 5GX2A 3FCSB 2OYEP 3N8ZA 2HQSA 1MQ6L 4ZH8B 4YT6L 2UWPB 4A7IA 2WPIE 1EMOA 2H9EC 3CENL 1G2MB 2NPRA 3R05A 4RRZA 5F19A 3KQEL 1QFKL 2W26B 1CEJA 1HAFA 1F7EA 2W2ME 3KRKA 3LTFB 5CKQA 1L5GB 5EX7A 5K0HB 1NFYB 3HO3A 5KIRA 2GVUA 3EGFA 2GD4A 4CSYA 1NQLB 4Z6AL 2AYLA 1XFEA 2VWNL 4HW6A 2P3FN 3HO4A 1TLEA 1APQA 3FVZA 2M74A 2VH6B 3ASIA 1OB1C 2FPBA 2BQWA 2KV4A 1EPGA 1FJSL 4BTUA 4ISHL 2Y82B 3S8ZA 1NFWB 4ZLRA 1A3PA 4D0FA 2Y7XB 1HJ7A 2W2NE 5I46L 2FP9A 5GX5A 1IP0A 3LC5B 3PGHA 2W3IB 2EI6B 2DDUA 3TC9A 1C5MF 3TK5B 4ZHAB 1RWLA 4CUEA 3LN0A 3Q3KB 2WYGB 2VWMK 3G4EA 3SRGA 3SOBB 1CVUA 2KNIA 4RRWA 1MQ5L 1CCFA 1EMNA 3FBYA 3M36L 6COXA 3HLIA 1F0RB 1V3XB 1K36A 2WFXB 3LI3A 3V64C 1Q4GA 4MMYB 1LMMA 2RA0L 3HS7A 3ZYGA 2DSOA 2TGFA 5D9BA 2B7DL 1HCGB 5JBBE 5L2YL 2K2TA 2VVVL 1M1XB 2XBVL 4NG9L 4X8SL 2YGQA 3HS6A 3QMOA 2IAQA 2GVVA 1EZQB 2W3KB 2VVUL 4BXSA 1SZBA 3FW0A 2J95B 1H6LA 4GN8A 3MDLA 3O4PA 1KLIL 1Z6EL 5E8DA 2J34B 1UZKA 4ZXXL 1P0SL 1NPEB 1KLOA 2Y38A 1PRHA 3RR3A 1IQNL 1CQ1A 2Y5GL 2P3FL 4Y7AB 4O1ZA 2PHBB 2BOHA 2BQ7A 1IGXA 4O02B 4X8UL 4X8VL 4YZUB 3Q6PA 3GCWE 2WPKE 5IKQA 2Y81B 1G1TA 3KGGA 1NFUB 2XC0L 2XC4L 3NT1A 3BYCA 1FAXL 1URKA 4JYUL 4RS0A 1EBVA 4CUDA 1JV2B 3SOQA 3DR2A 3KL6B 3OLUA 1LPZA 4NA9L 4XBMA 1DQBA 4RUTA 1CRZA 2IASA 1DX5I 1TOZA 1CX2A 3AMRA 5CKNA 1XDTR 2MGPA 1AUTL 3K9XA 1NZIA 2OJHA 2J4IB 3V65B 5FDQA 4RRYA 3S8VA 2FLGA 2BOXA 5CKMA 2JKHL 2IARA 3IAXA 1YUGA 2ISMA 2YGOA 2W8BA 4BTIA 1EQHA 2W2OE 4IMBA 1UZJA 1P9JA 3HS5A 1PGEA 1IQJL 2K2SB 3U7UG 2W86A 2F9BL 4PH9A 3ZYIB 2GHSA 1HREA 2MHPA 1JBUL 4LORA 2DG1A 2IAVA 3LN1A 1L3YA 4FM5A 2P94L 1CQEA 1G2LB 5IKRA 1COUA 2EI8B 1YO8A 5COXA 2W8BB 2WPME 5EGMB 1PFXL 3F6UL 3LIWB 4COXA 2W2PE 1RWIA 2FPCA 1ZAQA 3U0SA 1IQGL 1V04A 5GX3A 3SREA 1PJXA 2BOUA 1KIGL 3AMSA 4Y7BB 3F1SB 3NTBA 1CCVA 4LMFA 4JZFL 3ZYJB 2POOA 2WG4B 1DIYA 4NGAL 1NPEA 3LTGD 3TK6B 4GNBA 2P3TA 3HLHA 1IOEL 1ATEA 4O5TA 1ADXA 2ADXA 1U8CB 1HT5A 4BTTA 1C9UA 1LMJA 2P93L 3N8YA 2IVZA 3KQBL 4Y76B 3LC3B 2Y5FL 2WZPP 2G00L 4AQTA 3CA7A 5GX1A 1U67A 2FLRL 3S6XA 2PUQL 2QE8A 3A9GA 3QH0A 4G1MB 4BXWA 1CRUA 1NT0A 5CISA 3WW9A 3KQDL 2IAWA 1FAKL 3TGFA 2Y5HL 1Q7FA 1YUFA 3N8YB 4XL1A 1E1AA 4BDXA 3KYAA 1TPGA 4A94C 3BPSE 4M11A 1RFNB 2Q1JB 2WPLE 1C5KA 4HHQA 4OTYA 1EPIA 2WPHE 1ATDA 3Q6KA 2FP8A 4JZEL 3A9HA 3N8WB 2P4OA 1WU1B 4M10A 5GX4A 5F1AA 5KN5C 1I0UA 2PR3B 4PWZA 1K37A 1F7MA 5IKVA 2BO2A 3GISX 2XBXL 4Y71B 3LI4A 3TH3L 2J2UB 3TBDA 3P5BL 1EQGA 1IQML 1EGFA 2VH0B 1HZ8A 1JL9A 3S94A 4R40A 1EPHA 4C16A 3QCWA 1HRFA 3HRPA 3SOVA 1ATBA 4IYGA 2D1JB 4ISIL 1QLGA 1DVAL 3WWAA 2UWOB 1WHFA 2P26A 2KB9A 1EAIC 2P95L 3KCGL 2RNLA 2XBYL 3Q7DA 5JBCE 4YT7L 3G4HA 4Y6DB 1IQKL 4RRXA 3POYA 2IAOA 2EI7B 1G1QA 4Z0KB 3GCXE 1IGZA 4Z0LA 3HPTA 4DG6A 1PXXA 1PTHA 3CS7L 1IQEL 4O5SA 1YUKB 4ZAEB 2W2QE 2BQ6A 4BDWA 1IQHL 1UZPA 2J38B 1O5DL 1POOA 2OYUP 3ENSA 3NTGA 2UWLB 3NJPC 5JB8E 2VJ3A 3E5ZA 3FFGL 3ELAL 4Y79B 2I9BA 2MGRA 1APOA 1IVOC 1KSNB 5L30L 1Z6CA 3BT1A 1B9WA 1F0SB 1XKAL 1GK5A 3TZIA 5FWWA 1WHEA 5JVZA 2IATA 2IAXA 3DASA 4ZXYL 5L2ZL 4HHOA 4D0EA 1W7XL 3BT2A 3SW2A 4X8TL 1YGCL 1HT8A 3C9AC 3KK6A 3M37L 1W8BL 2YGPA 1X7AL 2VVCK 1XKBA 4TGFA 4GN9A 3U73A 4MMZB 1UZQA 2IAPA 1IQLL 2WFTA 3MQEA 1MOXC 4E1GA 2WG3C 2VWOL 1IQFL 4JMLA 1G1SA 1CVWL 2Y7ZB 2Y80B 3LAQA 1IQIL 1LPKA 3N8VA 1FF7A 4GNCA 3N8WA 2CJIB 3V1SA 2FZZL 4A0PA 1EPJA 1LQDA 4JZDL 1J9CL 5JB9E 3S2KA 1FSBA 3KQCL 2XC5L 1G1RA 1DDXA 3OLTA 1CVMA 2DG0A 1KLJL 3N8XA 1NFXB 2H9EL 2BOKL 1N7DA 2WPJE 4JYVL 3Q6TA 1QBIA 2VWLL 5JBAE 2IAUA 1IJQA 3LI5A 1N1IA 3H5CB 2GVWA 2WYJB 4CUFA 3I1CA 3CFWA 5D9CA 5IKTA 3IJEB 1IOXA 5D9DA 2I9AA 1FFMA 2BMGA 5JVYA 2J94B 2P3UA 5JW1A 1LPGA 2BZ6L 3DEMA 2P16L 2KL7A 4MMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIT B;  4D90 A;  2GVX A;  2P28 B;  5GTQ A;  1FE2 A;  2FLB L;  4GNA A;  2RHP A;  2XBW L;  4OTJ A;  4XLW A;  3HO5 A;  1BF9 A;  4GN7 A;  1HAE A;  1HX2 A;  2V91 A;  2VAQ A;  2G8S A;  4Q1U A;  1ATA A;  2FD6 A;  5GX2 A;  3FCS B;  2OYE P;  3N8Z A;  2HQS A;  1MQ6 L;  4ZH8 B;  4YT6 L;  2UWP B;  4A7I A;  2WPI E;  1EMO A;  3CEN L;  1G2M B;  2NPR A;  3R05 A;  4RRZ A;  5F19 A;  3KQE L;  1QFK L;  2W26 B;  1CEJ A;  1HAF A;  1F7E A;  2W2M E;  3KRK A;  3LTF B;  5CKQ A;  1L5G B;  5EX7 A;  5K0H B;  1NFY B;  3HO3 A;  5KIR A;  2GVU A;  3EGF A;  2GD4 A;  4CSY A;  1NQL B;  4Z6A L;  2AYL A;  1XFE A;  2VWN L;  4HW6 A;  2P3F N;  3HO4 A;  1TLE A;  1APQ A;  3FVZ A;  2M74 A;  2VH6 B;  3ASI A;  1OB1 C;  2FPB A;  2BQW A;  2KV4 A;  1EPG A;  1FJS L;  4BTU A;  4ISH L;  2Y82 B;  3S8Z A;  1NFW B;  4ZLR A;  1A3P A;  4D0F A;  2Y7X B;  1HJ7 A;  2W2N E;  5I46 L;  2FP9 A;  5GX5 A;  1IP0 A;  3LC5 B;  3PGH A;  2W3I B;  2EI6 B;  2DDU A;  3TC9 A;  1C5M F;  3TK5 B;  4ZHA B;  1RWL A;  4CUE A;  3LN0 A;  3Q3K B;  2WYG B;  2VWM K;  3G4E A;  3SRG A;  3SOB B;  1CVU A;  4RRW A;  1MQ5 L;  1CCF A;  1EMN A;  3FBY A;  3M36 L;  6COX A;  3HLI A;  1F0R B;  1V3X B;  1K36 A;  2WFX B;  3LI3 A;  3V64 C;  1Q4G A;  4MMY B;  2RA0 L;  3HS7 A;  3ZYG A;  2DSO A;  2TGF A;  5D9B A;  2B7D L;  1HCG B;  5JBB E;  5L2Y L;  2K2T A;  2VVV L;  1M1X B;  2XBV L;  4NG9 L;  4X8S L;  3HS6 A;  3QMO A;  2IAQ A;  2GVV A;  1EZQ B;  2W3K B;  2VVU L;  4BXS A;  1SZB A;  3FW0 A;  2J95 B;  1H6L A;  4GN8 A;  3MDL A;  3O4P A;  1KLI L;  1Z6E L;  5E8D A;  2J34 B;  1UZK A;  4ZXX L;  1P0S L;  1NPE B;  1KLO A;  2Y38 A;  1PRH A;  3RR3 A;  1IQN L;  1CQ1 A;  2Y5G L;  2P3F L;  4Y7A B;  4O1Z A;  2PHB B;  2BOH A;  2BQ7 A;  1IGX A;  4O02 B;  4X8U L;  4X8V L;  4YZU B;  3Q6P A;  3GCW E;  2WPK E;  5IKQ A;  2Y81 B;  1G1T A;  3KGG A;  1NFU B;  2XC0 L;  2XC4 L;  3NT1 A;  3BYC A;  1FAX L;  1URK A;  4JYU L;  4RS0 A;  1EBV A;  4CUD A;  1JV2 B;  3SOQ A;  3DR2 A;  3KL6 B;  3OLU A;  1LPZ A;  4NA9 L;  4XBM A;  1DQB A;  4RUT A;  1CRZ A;  2IAS A;  1DX5 I;  1TOZ A;  1CX2 A;  3AMR A;  5CKN A;  1XDT R;  2MGP A;  1AUT L;  3K9X A;  1NZI A;  2OJH A;  2J4I B;  3V65 B;  5FDQ A;  4RRY A;  3S8V A;  2FLG A;  2BOX A;  5CKM A;  2JKH L;  2IAR A;  3IAX A;  1YUG A;  2ISM A;  2YGO A;  2W8B A;  4BTI A;  1EQH A;  2W2O E;  4IMB A;  1UZJ A;  1P9J A;  3HS5 A;  1PGE A;  1IQJ L;  2K2S B;  3U7U G;  2W86 A;  2F9B L;  4PH9 A;  3ZYI B;  2GHS A;  1HRE A;  2MHP A;  1JBU L;  4LOR A;  2DG1 A;  2IAV A;  3LN1 A;  1L3Y A;  4FM5 A;  2P94 L;  1CQE A;  1G2L B;  5IKR A;  1COU A;  2EI8 B;  1YO8 A;  5COX A;  2W8B B;  2WPM E;  5EGM B;  1PFX L;  3F6U L;  3LIW B;  4COX A;  2W2P E;  1RWI A;  2FPC A;  1ZAQ A;  3U0S A;  1IQG L;  1V04 A;  5GX3 A;  3SRE A;  1PJX A;  2BOU A;  1KIG L;  3AMS A;  4Y7B B;  3F1S B;  3NTB A;  1CCV A;  4LMF A;  4JZF L;  3ZYJ B;  2POO A;  2WG4 B;  1DIY A;  4NGA L;  1NPE A;  3LTG D;  3TK6 B;  4GNB A;  2P3T A;  3HLH A;  1IOE L;  1ATE A;  4O5T A;  1ADX A;  2ADX A;  1U8C B;  1HT5 A;  4BTT A;  1C9U A;  1LMJ A;  2P93 L;  3N8Y A;  2IVZ A;  3KQB L;  4Y76 B;  3LC3 B;  2Y5F L;  2G00 L;  4AQT A;  3CA7 A;  5GX1 A;  1U67 A;  2FLR L;  2PUQ L;  2QE8 A;  3A9G A;  3QH0 A;  4G1M B;  4BXW A;  1CRU A;  1NT0 A;  5CIS A;  3WW9 A;  3KQD L;  2IAW A;  1FAK L;  3TGF A;  2Y5H L;  1Q7F A;  1YUF A;  3N8Y B;  4XL1 A;  1E1A A;  4BDX A;  3KYA A;  1TPG A;  3BPS E;  4M11 A;  1RFN B;  2Q1J B;  2WPL E;  1C5K A;  4HHQ A;  4OTY A;  1EPI A;  2WPH E;  1ATD A;  3Q6K A;  2FP8 A;  4JZE L;  3A9H A;  3N8W B;  2P4O A;  1WU1 B;  4M10 A;  5GX4 A;  5F1A A;  5KN5 C;  1I0U A;  2PR3 B;  4PWZ A;  1K37 A;  1F7M A;  5IKV A;  2BO2 A;  3GIS X;  2XBX L;  4Y71 B;  3LI4 A;  3TH3 L;  2J2U B;  3TBD A;  3P5B L;  1EQG A;  1IQM L;  1EGF A;  2VH0 B;  1HZ8 A;  1JL9 A;  3S94 A;  4R40 A;  1EPH A;  4C16 A;  3QCW A;  1HRF A;  3HRP A;  3SOV A;  1ATB A;  4IYG A;  2D1J B;  4ISI L;  1QLG A;  1DVA L;  3WWA A;  2UWO B;  1WHF A;  2P26 A;  2KB9 A;  1EAI C;  2P95 L;  3KCG L;  2RNL A;  2XBY L;  3Q7D A;  5JBC E;  4YT7 L;  3G4H A;  4Y6D B;  1IQK L;  4RRX A;  3POY A;  2IAO A;  2EI7 B;  1G1Q A;  4Z0K B;  3GCX E;  1IGZ A;  4Z0L A;  3HPT A;  4DG6 A;  1PXX A;  1PTH A;  3CS7 L;  1IQE L;  4O5S A;  1YUK B;  4ZAE B;  2W2Q E;  2BQ6 A;  4BDW A;  1IQH L;  1UZP A;  2J38 B;  1O5D L;  1POO A;  2OYU P;  3ENS A;  3NTG A;  2UWL B;  3NJP C;  5JB8 E;  2VJ3 A;  3E5Z A;  3FFG L;  3ELA L;  4Y79 B;  2I9B A;  2MGR A;  1APO A;  1IVO C;  1KSN B;  5L30 L;  1Z6C A;  3BT1 A;  1B9W A;  1F0S B;  1XKA L;  1GK5 A;  3TZI A;  5FWW A;  1WHE A;  5JVZ A;  2IAT A;  2IAX A;  3DAS A;  4ZXY L;  5L2Z L;  4HHO A;  4D0E A;  1W7X L;  3BT2 A;  3SW2 A;  4X8T L;  1YGC L;  1HT8 A;  3C9A C;  3KK6 A;  3M37 L;  1W8B L;  2YGP A;  1X7A L;  2VVC K;  1XKB A;  4TGF A;  4GN9 A;  3U73 A;  4MMZ B;  1UZQ A;  2IAP A;  1IQL L;  2WFT A;  3MQE A;  1MOX C;  4E1G A;  2WG3 C;  2VWO L;  1IQF L;  4JML A;  1G1S A;  1CVW L;  2Y7Z B;  2Y80 B;  3LAQ A;  1IQI L;  1LPK A;  3N8V A;  1FF7 A;  4GNC A;  3N8W A;  2CJI B;  3V1S A;  2FZZ L;  4A0P A;  1EPJ A;  1LQD A;  4JZD L;  1J9C L;  5JB9 E;  3S2K A;  1FSB A;  3KQC L;  2XC5 L;  1G1R A;  1DDX A;  3OLT A;  1CVM A;  2DG0 A;  1KLJ L;  3N8X A;  1NFX B;  2H9E L;  2BOK L;  1N7D A;  2WPJ E;  4JYV L;  3Q6T A;  1QBI A;  2VWL L;  5JBA E;  2IAU A;  1IJQ A;  3LI5 A;  1N1I A;  3H5C B;  2GVW A;  2WYJ B;  4CUF A;  3I1C A;  3CFW A;  5D9C A;  5IKT A;  3IJE B;  1IOX A;  5D9D A;  2I9A A;  1FFM A;  2BMG A;  5JVY A;  2J94 B;  2P3U A;  5JW1 A;  1LPG A;  2BZ6 L;  3DEM A;  2P16 L;  2KL7 A;  4MMX B; 
#chains in the Genus database with same CATH topology
 3IIT B;  4D90 A;  3O9J A;  2GVX A;  2P28 B;  2AGS A;  5GTQ A;  4YW1 A;  1FE2 A;  4JF7 A;  2FLB L;  4XJA A;  4GNA A;  2RHP A;  2XBW L;  3VNG A;  1W0P A;  4OTJ A;  4XLW A;  3HO5 A;  5FZJ A;  1BF9 A;  4GN7 A;  1HAE A;  1HX2 A;  2V91 A;  2VAQ A;  4FOQ A;  2X9M A;  2G8S A;  4Q1U A;  1ATA A;  2FD6 A;  5H47 A;  5GX2 A;  3FCS B;  2OYE P;  1BJI A;  3N8Z A;  1K32 A;  2HQS A;  1MQ6 L;  4XHB A;  4K1H A;  3SLI A;  4ZH8 B;  4YT6 L;  2XZJ A;  2QWC A;  2UWP B;  4A7I A;  2WPI E;  1EMO A;  2H9E C;  4FPY A;  3L6V A;  3TI5 A;  3CEN L;  1G2M B;  4FP2 A;  2NPR A;  3R05 A;  4RRZ A;  5F19 A;  2BT8 A;  3KQE L;  1W1X A;  4MWQ A;  1QFK L;  2W26 B;  1CEJ A;  1HAF A;  1N1Y A;  2QWK A;  1F7E A;  2W2M E;  3KRK A;  4FPC A;  1INH A;  4QN3 A;  4FVK A;  3LTF B;  5CKQ A;  1L5G B;  5EX7 A;  1A14 N;  1N1V A;  5K0H B;  1NFY B;  4KS3 A;  4B7N A;  4N1B A;  3HO3 A;  5KIR A;  2GVU A;  2VK5 A;  3EGF A;  4UOU A;  2GD4 A;  4CSY A;  1NQL B;  4Z6A L;  2AYL A;  1VCU A;  1XFE A;  2VWN L;  5HUK A;  4HW6 A;  1IVC A;  1Z4Z A;  1MS3 A;  4YW5 A;  3CYE A;  2P3F N;  3HO4 A;  1TLE A;  4HZW A;  1APQ A;  3FVZ A;  2M74 A;  2VWD A;  2VH6 B;  3ASI A;  3D11 A;  4KS4 A;  1OB1 C;  2FPB A;  2BQW A;  2QWG A;  3NN9 A;  4QNP A;  4C1Y A;  2KV4 A;  4HZY A;  1ING A;  1EPG A;  1FJS L;  4BTU A;  4J9T A;  3TI6 A;  4ISH L;  2Y82 B;  4MWL A;  1NFW B;  3S8Z A;  4ZLR A;  1A3P A;  4D0F A;  4XJ9 A;  2Y7X B;  1HJ7 A;  2W2N E;  5I46 L;  1Z4X A;  2FP9 A;  3BEQ A;  1IP0 A;  1MS4 A;  3LC5 B;  3PGH A;  4FOV A;  4CHB A;  1USX A;  4YZ2 A;  2W3I B;  2EI6 B;  2DDU A;  3TC9 A;  4CPM A;  1C5M F;  3TK5 B;  1E8V A;  1V0F A;  2HTY A;  4FPF A;  4ZHA B;  1RWL A;  2HU4 A;  4CUE A;  3GVL A;  4GZX A;  3LN0 A;  2HOR A;  1NNC A;  3Q3K B;  2WYG B;  2VWM K;  1W8N A;  3G4E A;  3SRG A;  3SOB B;  4B7M A;  1IUB A;  3TIA A;  1X2R A;  3K36 A;  1CVU A;  2KNI A;  4RRW A;  2W38 A;  5FNQ A;  4L7C A;  2BT7 A;  1MQ5 L;  1CCF A;  1EMN A;  3FBY A;  3M36 L;  6COX A;  1INF A;  3HLI A;  4GZP A;  1F0R B;  1V3X B;  1K36 A;  2B8H A;  3A72 A;  1V1H A;  4CSD A;  2WFX B;  1DIL A;  3LI3 A;  4GZS A;  3V64 C;  1Q4G A;  4MMY B;  4XIO A;  1LMM A;  4D52 B;  2RA0 L;  3HS7 A;  3ZYG A;  2DSO A;  1N6E A;  4M4N A;  2H2N A;  2TGF A;  4FQ4 A;  5D9B A;  2B7D L;  1HCG B;  5JBB E;  5L2Y L;  1NSD A;  4MZE A;  2K2T A;  2VVV L;  4MJU A;  1M1X B;  4QN6 A;  2XBV L;  4NG9 L;  4X8S L;  2YGQ A;  3HS6 A;  3QMO A;  2IAQ A;  2GVV A;  1EZQ B;  2QWJ A;  1W20 A;  2W3K B;  2VVU L;  4BXS A;  1SZB A;  1W8O A;  3FW0 A;  1V1I A;  2J95 B;  1H6L A;  4GN8 A;  4M4U A;  3MDL A;  4XIK A;  4XJ8 A;  3O4P A;  4CPL A;  1KLI L;  1Z6E L;  5E8D A;  1USR A;  2J34 B;  1UZK A;  2HOX A;  4ZXX L;  3INB A;  2AH2 A;  1P0S L;  1NPE B;  1KLO A;  2Y38 A;  1PRH A;  4FPH A;  3RR3 A;  1IQN L;  1CQ1 A;  2Y5G L;  2P3F L;  2QWI A;  4Y7A B;  4O1Z A;  4MJV A;  1IVE A;  2PHB B;  4X6K A;  3ADE A;  4D4U A;  4GZW A;  2BOH A;  2SIM A;  1B9S A;  4MWJ A;  3UC1 A;  1INW A;  5FNT A;  2BQ7 A;  4MWW A;  7NN9 A;  1IGX A;  4O02 B;  4X8U L;  1INX A;  1OFZ A;  4X8V L;  4GEZ A;  4YZU B;  2BER A;  1EUT A;  3Q6P A;  3GCW E;  2WPK E;  5IKQ A;  2SIL A;  2Y81 B;  1G1T A;  3KGG A;  1NFU B;  2XC0 L;  2XC4 L;  3NT1 A;  2HTV A;  3BYC A;  3H6J A;  1FAX L;  1KKE A;  1URK A;  4JYU L;  1V0Z A;  1VCJ A;  2XZI A;  4RS0 A;  4KS2 A;  4YW4 A;  4B7Q A;  1V3B A;  1NCD N;  1EBV A;  4CUD A;  1SUU A;  1JV2 B;  4XJR A;  4XMA A;  3SOQ A;  5HUG A;  2F12 A;  3DR2 A;  4IFL X;  4XJQ A;  3SIL A;  3KL6 B;  3OLU A;  1LPZ A;  1NSB A;  4NA9 L;  4XBM A;  1DQB A;  4WEG A;  3TI3 A;  1MS9 A;  4BBW A;  4RUT A;  3A71 A;  1CRZ A;  2IAS A;  4Q6K A;  1DX5 I;  1TOZ A;  1NNB A;  1CX2 A;  3AMR A;  4FZH A;  3K38 A;  1NN2 A;  5CKN A;  1Z4V A;  1XDT R;  2VRS A;  2MGP A;  2VW2 A;  1AUT L;  1W0O A;  3K9X A;  4H53 A;  3OPZ A;  1NZI A;  5HX0 A;  2OJH A;  1U6D X;  2J4I B;  1EUS A;  3V65 B;  3TIC A;  1MR5 A;  5FDQ A;  1V2I A;  4RRY A;  3S8V A;  4IN4 A;  2FLG A;  2BOX A;  5CKM A;  2JKH L;  1SO7 A;  2IAR A;  1NCB N;  3IAX A;  1YUG A;  2ISM A;  2YGO A;  2BSF A;  2W8B A;  1Z4Y A;  4QN4 A;  4BTI A;  1EQH A;  4SLI A;  1NNA A;  4QN7 A;  2W2O E;  4IMB A;  4K3Y A;  1UZJ A;  1P9J A;  4GB1 A;  3HS5 A;  1PGE A;  1E8U A;  1WCQ A;  2W20 A;  2VK6 A;  1IQJ L;  2K2S B;  3U7U G;  2W86 A;  2F9B L;  4PH9 A;  3ZYI B;  2BF6 A;  4GU3 A;  1B9V A;  2GHS A;  4HZV A;  1V3E A;  1HRE A;  1B9T A;  1Z50 A;  2MHP A;  1JBU L;  4LOR A;  2DG1 A;  2IAV A;  1IVD A;  4I00 A;  4X47 A;  3LN1 A;  1L3Y A;  4FM5 A;  4WA5 A;  2P94 L;  1CQE A;  1G2L B;  1L7G A;  2BAT A;  5IKR A;  2F24 A;  5JYY A;  1COU A;  2EI8 B;  1YO8 A;  5COX A;  1NCC N;  2ZW9 A;  4IFJ A;  4ZY3 A;  2W8B B;  4GJT A;  4XYX A;  2QWF A;  1INV A;  2F0Z A;  1IUC A;  1S18 A;  4XOG A;  2WPM E;  5EO7 A;  5EGM B;  4MX0 A;  1PFX L;  3F6U L;  2ZZK A;  3LIW B;  1IVB A;  4IFN X;  4D52 A;  2AEQ A;  5HUN A;  4K1K A;  4COX A;  4HZZ A;  2W2P E;  1RWI A;  5F72 C;  2FPC A;  5F9T A;  1ZAQ A;  4MWY A;  1N6F A;  1V3C A;  4MC7 A;  3CL2 A;  4K1J A;  3U0S A;  2ZB6 A;  1IQG L;  1MWE A;  1V04 A;  3CL0 A;  4XJU A;  3SRE A;  5GX3 A;  1PJX A;  2VW0 A;  2BOU A;  3O9K A;  1KIG L;  5CGJ A;  4MWR A;  3II7 A;  2CML A;  3AMS A;  2QWH A;  2XCY A;  3JU4 A;  4Y7B B;  1SNT A;  3F1S B;  3NTB A;  1CCV A;  2XN4 A;  4LMF A;  3K39 A;  4JZF L;  3ZYJ B;  3T1E A;  4YW3 A;  2C4L A;  1V3D A;  2POO A;  4FPL A;  4NN9 A;  2WG4 B;  1SLI A;  1DIY A;  4NGA L;  2C4A A;  5EO8 A;  1NPE A;  1XOE A;  4GZO A;  3LTG D;  3TK6 B;  4GNB A;  1WP5 A;  2P3T A;  2FLU X;  2W5O A;  1IOE L;  1ATE A;  3HLH A;  1ADX A;  4O5T A;  5M1Z A;  1S0J A;  2ADX A;  1IVF A;  1U8C B;  1HT5 A;  4X49 A;  4BTT A;  1C9U A;  1LMJ A;  1ZI0 A;  2QWD A;  4G3N A;  3K37 A;  3SAN A;  2P93 L;  3N8Y A;  1NCA N;  2IVZ A;  3W09 A;  3KQB L;  4FPG A;  4Y76 B;  1SLL A;  1MZ6 A;  3LC3 B;  2Y5F L;  2WZP P;  2G00 L;  4AQT A;  3CA7 A;  5GX1 A;  2F13 A;  1U67 A;  2VW1 A;  3TIB A;  4MWV A;  2FLR L;  3S6X A;  1QIU A;  2PUQ L;  4YZ4 A;  2QE8 A;  1ZGK A;  4YW2 A;  2W5N A;  3A9G A;  1L7H A;  2QWB A;  3QH0 A;  4G1M B;  1LK9 A;  4GZT A;  4BXW A;  1NMC A;  1CRU A;  3WDZ A;  4WA4 A;  1NT0 A;  5CIS A;  3WW9 A;  3KQD L;  2IAW A;  2HTQ A;  4FPJ A;  1FAK L;  1W21 A;  4CPY A;  3TGF A;  2Y5H L;  1Q7F A;  1YUF A;  3N8Y B;  4XL1 A;  4XHX A;  1E1A A;  4BDX A;  1MS1 A;  3KYA A;  1TPG A;  4A94 C;  2HU0 A;  4GU4 A;  3BPS E;  4M11 A;  1NMB N;  1DIM A;  4KS1 A;  1RFN B;  2Q1J B;  2WPL E;  1C5K A;  2YA5 A;  4HIZ A;  4XIL A;  4HHQ A;  4OTY A;  4FP3 A;  1EPI A;  4KS5 A;  2VSM A;  1XOG A;  2WPH E;  1ATD A;  3Q6K A;  2FP8 A;  4JZE L;  3A9H A;  3N8W B;  5FNU A;  2P4O A;  1WU1 B;  4D52 C;  3K3A A;  4M10 A;  2BZD A;  5GX4 A;  2JJL A;  5F1A A;  5KN5 C;  4X4A A;  1I0U A;  2PR3 B;  2FHR A;  2QWA A;  4PWZ A;  1K37 A;  5FZN A;  4FJ6 A;  1F7M A;  5IKV A;  4GDJ A;  2BO2 A;  3GIS X;  2XBX L;  2YA7 A;  4Y71 B;  3LI4 A;  3TH3 L;  2F28 A;  2J2U B;  3TBD A;  3P5B L;  1EQG A;  1A4G A;  1IQM L;  4M4V A;  1EGF A;  2VH0 B;  2YA4 A;  1HZ8 A;  2HTR A;  1JL9 A;  1F8E A;  2VSK A;  4ZGC A;  1NMA N;  4FPE A;  4MZA A;  3S94 A;  4MWX A;  4R40 A;  4B7J A;  1EPH A;  1WCS A;  4C16 A;  3SAL A;  3QCW A;  1HRF A;  2JKB A;  1V0E A;  2A75 A;  3HRP A;  3SOV A;  1ATB A;  4B7R A;  4FOW A;  4IYG A;  1N1T A;  1N6D A;  3H71 A;  2D1J B;  4ISI L;  1QLG A;  2HTW A;  2F25 A;  1DVA L;  4AH4 A;  4CPO A;  3WWA A;  3VNH A;  2UWO B;  1INY A;  1WHF A;  4WEF A;  1MS5 A;  2P26 A;  2KB9 A;  1EAI C;  2P95 L;  3KCG L;  2RNL A;  2XBY L;  3Q7D A;  5JBC E;  4YT7 L;  2Z32 A;  3G4H A;  4Y6D B;  1IQK L;  3CKZ A;  4RRX A;  3POY A;  2IAO A;  2EI7 B;  1G1Q A;  2AEP A;  4Z0K B;  3GCX E;  1IGZ A;  4Z0L A;  3HPT A;  4DG6 A;  5B2D A;  2F27 A;  3ZGC A;  1N1S A;  1PXX A;  1PTH A;  4GZQ A;  4D8S A;  3CS7 L;  1IQE L;  4L7D A;  4O5S A;  4HZX A;  2HT5 A;  2WOZ A;  1YUK B;  4ZAE B;  1F8B A;  2W2Q E;  2BQ6 A;  3NSS A;  4QN5 A;  4BDW A;  1IQH L;  1MZ5 A;  2HT8 A;  1UZP A;  2J38 B;  4UF7 A;  1MS0 A;  1O5D L;  1POO A;  2OYU P;  3ENS A;  3NTG A;  4L7B A;  2ZB5 A;  4XJZ A;  2UWL B;  4YZ5 A;  3NJP C;  5JB8 E;  2VJ3 A;  3E5Z A;  3GVK A;  4AGI A;  3FFG L;  2YA6 A;  1S0I A;  3ELA L;  4Y79 B;  2I9B A;  2MGR A;  1APO A;  5HUM A;  1IVO C;  1KSN B;  5L30 L;  4CPN A;  5NN9 A;  1Z6C A;  3BT1 A;  1B9W A;  1E8T A;  4IQK A;  4CH9 A;  1S1D A;  4AGT A;  1F0S B;  5B2C A;  1XKA L;  2DYH A;  1GK5 A;  3TZI A;  5FWW A;  1WHE A;  2F10 A;  5JVZ A;  1MS8 A;  2IAT A;  2IAX A;  3DAS A;  4XE9 A;  4ZXY L;  5L2Z L;  4AHA A;  4XJW A;  4HHO A;  4D0E A;  1W7X L;  2VPJ A;  3BT2 A;  4FPO B;  3SW2 A;  4X8T L;  4NCS A;  1YGC L;  4M3M A;  2F11 A;  3TI4 A;  1HT8 A;  2QWE A;  4DGR A;  3C9A C;  3KK6 A;  3M37 L;  4FOY A;  6NN9 A;  1W8B L;  2YGP A;  1X7A L;  1IVG A;  2VVC K;  4WA3 A;  3PJQ A;  4CPZ A;  2VK7 A;  1XKB A;  5FNR A;  1KIT A;  4TGF A;  4C1Y B;  4GN9 A;  3TI8 A;  3U73 A;  4MMZ B;  1UZQ A;  1EUU A;  2IAP A;  1IQL L;  2WFT A;  2YDT A;  4H52 A;  3MQE A;  1MOX C;  4E1G A;  2WG3 C;  2VWO L;  1IQF L;  4JML A;  2RKC A;  1G1S A;  1CVW L;  2Y7Z B;  2Y80 B;  3LAQ A;  1IQI L;  3H72 A;  1LPK A;  3N8V A;  4MWU A;  1FF7 A;  2XZK A;  4GNC A;  3N8W A;  3ALW A;  4XMI A;  2CJI B;  1Z4W A;  3V1S A;  3ALX A;  2FZZ L;  2VVZ A;  3D12 A;  4A0P A;  1EPJ A;  4GDI A;  1LQD A;  4JZD L;  4K1I A;  1J9C L;  2YA8 A;  5JB9 E;  3S2K A;  2SLI A;  1FSB A;  3KQC L;  2XC5 L;  1G1R A;  3B69 A;  1DDX A;  3OLT A;  1CVM A;  2DG0 A;  3GVJ A;  2ZWA A;  1KLJ L;  1X2J A;  3N8X A;  1NFX B;  2HTU A;  3WN7 A;  4YY8 A;  2H9E L;  1F8C A;  3ZGD A;  1A4Q A;  2BOK L;  1F8D A;  2HT7 A;  1N7D A;  2WPJ E;  4JYV L;  3H73 A;  1NSC A;  3Q6T A;  1QBI A;  2VWL L;  5JBA E;  2IAU A;  1EUR A;  1IJQ A;  2YDP A;  1N1I A;  3LI5 A;  4FPK A;  3H5C B;  2GVW A;  2WYJ B;  2H2U A;  3NO0 A;  4CUF A;  3I1C A;  3CFW A;  4NC5 A;  5D9C A;  5IKT A;  5GX5 A;  3IJE B;  4YZ3 A;  1IOX A;  5FNS A;  5D9D A;  2I9A A;  1FFM A;  2BMG A;  2F26 A;  4ASC A;  3B7E A;  5JVY A;  2J94 B;  2P3U A;  5JW1 A;  1LPG A;  2BZ6 L;  3DEM A;  2F29 A;  4XMB A;  4YZ1 A;  2P16 L;  2KL7 A;  1L7F A;  4MMX B; 
#chains in the Genus database with same CATH homology
 3IIT B;  4D90 A;  2GVX A;  2P28 B;  5GTQ A;  1FE2 A;  2FLB L;  4GNA A;  2RHP A;  2XBW L;  4OTJ A;  4XLW A;  3HO5 A;  1BF9 A;  4GN7 A;  1HAE A;  1HX2 A;  2V91 A;  2VAQ A;  2G8S A;  4Q1U A;  1ATA A;  2FD6 A;  5GX2 A;  3FCS B;  2OYE P;  3N8Z A;  2HQS A;  1MQ6 L;  4ZH8 B;  4YT6 L;  2UWP B;  4A7I A;  2WPI E;  1EMO A;  2H9E C;  3CEN L;  1G2M B;  2NPR A;  3R05 A;  4RRZ A;  5F19 A;  3KQE L;  1QFK L;  2W26 B;  1CEJ A;  1HAF A;  1F7E A;  2W2M E;  3KRK A;  3LTF B;  5CKQ A;  1L5G B;  5EX7 A;  5K0H B;  1NFY B;  3HO3 A;  5KIR A;  2GVU A;  3EGF A;  2GD4 A;  4CSY A;  1NQL B;  4Z6A L;  2AYL A;  1XFE A;  2VWN L;  4HW6 A;  2P3F N;  3HO4 A;  1TLE A;  1APQ A;  3FVZ A;  2M74 A;  2VH6 B;  3ASI A;  1OB1 C;  2FPB A;  2BQW A;  2KV4 A;  1EPG A;  1FJS L;  4BTU A;  4ISH L;  2Y82 B;  3S8Z A;  1NFW B;  4ZLR A;  1A3P A;  4D0F A;  2Y7X B;  1HJ7 A;  2W2N E;  5I46 L;  2FP9 A;  5GX5 A;  1IP0 A;  3LC5 B;  3PGH A;  2W3I B;  2EI6 B;  2DDU A;  3TC9 A;  1C5M F;  3TK5 B;  4ZHA B;  1RWL A;  4CUE A;  3LN0 A;  3Q3K B;  2WYG B;  2VWM K;  3G4E A;  3SRG A;  3SOB B;  1CVU A;  2KNI A;  4RRW A;  1MQ5 L;  1CCF A;  1EMN A;  3FBY A;  3M36 L;  6COX A;  3HLI A;  1F0R B;  1V3X B;  1K36 A;  2WFX B;  3LI3 A;  3V64 C;  1Q4G A;  4MMY B;  1LMM A;  2RA0 L;  3HS7 A;  3ZYG A;  2DSO A;  2TGF A;  5D9B A;  2B7D L;  1HCG B;  5JBB E;  5L2Y L;  2K2T A;  2VVV L;  1M1X B;  2XBV L;  4NG9 L;  4X8S L;  2YGQ A;  3HS6 A;  3QMO A;  2IAQ A;  2GVV A;  1EZQ B;  2W3K B;  2VVU L;  4BXS A;  1SZB A;  3FW0 A;  2J95 B;  1H6L A;  4GN8 A;  3MDL A;  3O4P A;  1KLI L;  1Z6E L;  5E8D A;  2J34 B;  1UZK A;  4ZXX L;  1P0S L;  1NPE B;  1KLO A;  2Y38 A;  1PRH A;  3RR3 A;  1IQN L;  1CQ1 A;  2Y5G L;  2P3F L;  4Y7A B;  4O1Z A;  2PHB B;  2BOH A;  2BQ7 A;  1IGX A;  4O02 B;  4X8U L;  4X8V L;  4YZU B;  3Q6P A;  3GCW E;  2WPK E;  5IKQ A;  2Y81 B;  1G1T A;  3KGG A;  1NFU B;  2XC0 L;  2XC4 L;  3NT1 A;  3BYC A;  1FAX L;  1URK A;  4JYU L;  4RS0 A;  1EBV A;  4CUD A;  1JV2 B;  3SOQ A;  3DR2 A;  3KL6 B;  3OLU A;  1LPZ A;  4NA9 L;  4XBM A;  1DQB A;  4RUT A;  1CRZ A;  2IAS A;  1DX5 I;  1TOZ A;  1CX2 A;  3AMR A;  5CKN A;  1XDT R;  2MGP A;  1AUT L;  3K9X A;  1NZI A;  2OJH A;  2J4I B;  3V65 B;  5FDQ A;  4RRY A;  3S8V A;  2FLG A;  2BOX A;  5CKM A;  2JKH L;  2IAR A;  3IAX A;  1YUG A;  2ISM A;  2YGO A;  2W8B A;  4BTI A;  1EQH A;  2W2O E;  4IMB A;  1UZJ A;  1P9J A;  3HS5 A;  1PGE A;  1IQJ L;  2K2S B;  3U7U G;  2W86 A;  2F9B L;  4PH9 A;  3ZYI B;  2GHS A;  1HRE A;  2MHP A;  1JBU L;  4LOR A;  2DG1 A;  2IAV A;  3LN1 A;  1L3Y A;  4FM5 A;  2P94 L;  1CQE A;  1G2L B;  5IKR A;  1COU A;  2EI8 B;  1YO8 A;  5COX A;  2W8B B;  2WPM E;  5EGM B;  1PFX L;  3F6U L;  3LIW B;  4COX A;  2W2P E;  1RWI A;  2FPC A;  1ZAQ A;  3U0S A;  1IQG L;  1V04 A;  5GX3 A;  3SRE A;  1PJX A;  2BOU A;  1KIG L;  3AMS A;  4Y7B B;  3F1S B;  3NTB A;  1CCV A;  4LMF A;  4JZF L;  3ZYJ B;  2POO A;  2WG4 B;  1DIY A;  4NGA L;  1NPE A;  3LTG D;  3TK6 B;  4GNB A;  2P3T A;  3HLH A;  1IOE L;  1ATE A;  4O5T A;  1ADX A;  2ADX A;  1U8C B;  1HT5 A;  4BTT A;  1C9U A;  1LMJ A;  2P93 L;  3N8Y A;  2IVZ A;  3KQB L;  4Y76 B;  3LC3 B;  2Y5F L;  2WZP P;  2G00 L;  4AQT A;  3CA7 A;  5GX1 A;  1U67 A;  2FLR L;  3S6X A;  2PUQ L;  2QE8 A;  3A9G A;  3QH0 A;  4G1M B;  4BXW A;  1CRU A;  1NT0 A;  5CIS A;  3WW9 A;  3KQD L;  2IAW A;  1FAK L;  3TGF A;  2Y5H L;  1Q7F A;  1YUF A;  3N8Y B;  4XL1 A;  1E1A A;  4BDX A;  3KYA A;  1TPG A;  4A94 C;  3BPS E;  4M11 A;  1RFN B;  2Q1J B;  2WPL E;  1C5K A;  4HHQ A;  4OTY A;  1EPI A;  2WPH E;  1ATD A;  3Q6K A;  2FP8 A;  4JZE L;  3A9H A;  3N8W B;  2P4O A;  1WU1 B;  4M10 A;  5GX4 A;  5F1A A;  5KN5 C;  1I0U A;  2PR3 B;  4PWZ A;  1K37 A;  1F7M A;  5IKV A;  2BO2 A;  3GIS X;  2XBX L;  4Y71 B;  3LI4 A;  3TH3 L;  2J2U B;  3TBD A;  3P5B L;  1EQG A;  1IQM L;  1EGF A;  2VH0 B;  1HZ8 A;  1JL9 A;  3S94 A;  4R40 A;  1EPH A;  4C16 A;  3QCW A;  1HRF A;  3HRP A;  3SOV A;  1ATB A;  4IYG A;  2D1J B;  4ISI L;  1QLG A;  1DVA L;  3WWA A;  2UWO B;  1WHF A;  2P26 A;  2KB9 A;  1EAI C;  2P95 L;  3KCG L;  2RNL A;  2XBY L;  3Q7D A;  5JBC E;  4YT7 L;  3G4H A;  4Y6D B;  1IQK L;  4RRX A;  3POY A;  2IAO A;  2EI7 B;  1G1Q A;  4Z0K B;  3GCX E;  1IGZ A;  4Z0L A;  3HPT A;  4DG6 A;  1PXX A;  1PTH A;  3CS7 L;  1IQE L;  4O5S A;  1YUK B;  4ZAE B;  2W2Q E;  2BQ6 A;  4BDW A;  1IQH L;  1UZP A;  2J38 B;  1O5D L;  1POO A;  2OYU P;  3ENS A;  3NTG A;  2UWL B;  3NJP C;  5JB8 E;  2VJ3 A;  3E5Z A;  3FFG L;  3ELA L;  4Y79 B;  2I9B A;  2MGR A;  1APO A;  1IVO C;  1KSN B;  5L30 L;  1Z6C A;  3BT1 A;  1B9W A;  1F0S B;  1XKA L;  1GK5 A;  3TZI A;  5FWW A;  1WHE A;  5JVZ A;  2IAT A;  2IAX A;  3DAS A;  4ZXY L;  5L2Z L;  4HHO A;  4D0E A;  1W7X L;  3BT2 A;  3SW2 A;  4X8T L;  1YGC L;  1HT8 A;  3C9A C;  3KK6 A;  3M37 L;  1W8B L;  2YGP A;  1X7A L;  2VVC K;  1XKB A;  4TGF A;  4GN9 A;  3U73 A;  4MMZ B;  1UZQ A;  2IAP A;  1IQL L;  2WFT A;  3MQE A;  1MOX C;  4E1G A;  2WG3 C;  2VWO L;  1IQF L;  4JML A;  1G1S A;  1CVW L;  2Y7Z B;  2Y80 B;  3LAQ A;  1IQI L;  1LPK A;  3N8V A;  1FF7 A;  4GNC A;  3N8W A;  2CJI B;  3V1S A;  2FZZ L;  4A0P A;  1EPJ A;  1LQD A;  4JZD L;  1J9C L;  5JB9 E;  3S2K A;  1FSB A;  3KQC L;  2XC5 L;  1G1R A;  1DDX A;  3OLT A;  1CVM A;  2DG0 A;  1KLJ L;  3N8X A;  1NFX B;  2H9E L;  2BOK L;  1N7D A;  2WPJ E;  4JYV L;  3Q6T A;  1QBI A;  2VWL L;  5JBA E;  2IAU A;  1IJQ A;  3LI5 A;  1N1I A;  3H5C B;  2GVW A;  2WYJ B;  4CUF A;  3I1C A;  3CFW A;  5D9C A;  5IKT A;  3IJE B;  1IOX A;  5D9D A;  2I9A A;  1FFM A;  2BMG A;  5JVY A;  2J94 B;  2P3U A;  5JW1 A;  1LPG A;  2BZ6 L;  3DEM A;  2P16 L;  2KL7 A;  4MMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...