1IJQA

Crystal structure of the ldl receptor ywtd-egf domain pair
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
316
structure length
308
Chain Sequence
b'IAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
publication title Implications for familial hypercholesterolemia from the structure of the LDL receptor YWTD-EGF domain pair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 74
structure length 308
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1ijqA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 1ijqA01
2IAXA 4PWZA 3SOBB 2FD6A 4Y7AB 1DQBA 3Q6KA 1NT0A 1WHEA 1G2LB 1PGEA 3SRGA 1NFYB 1NPEB 3CS7L 1NPEA 3ZYJB 1JBUL 1QBIA 1F7MA 1DDXA 3NT1A 2FPBA 2AYLA 4RRXA 1PJXA 1EQHA 5E8DA 4DG6A 3BYCA 3CA7A 4CUEA 2I9AA 5L2YL 2DG1A 3LN0A 2XC4L 1CVWL 4Y79B 1YUGA 4BTIA 4Y7BB 1YUFA 1EGFA 2EI8B 5F19A 1L5GB 3GCWE 3WW9A 5GX3A 3TK6B 1IOXA 1BF9A 2P3TA 1EMOA 4YT6L 1IQIL 4YT7L 3FCSB 1MOXC 4MMZB 4FM5A 3CENL 1K37A 4M11A 2J34B 4COXA 1G1SA 1K36A 4CUDA 3KQBL 1IQML 1CQEA 2BQ7A 2W2OE 4X8UL 3QCWA 1U8CB 1DX5I 1GK5A 2Y38A 1APQA 2Y81B 2UWLB 2Y82B 5D9BA 2CJIB 1PTHA 1C9UA 5GX5A 2WYJB 1LPKA 1IQHL 5JB9E 4Y6DB 3N8ZA 4OTYA 1EPGA 1O5DL 2MGPA 1CRUA 2VH0B 3KGGA 2IAQA 2NPRA 4RUTA 4ZH8B 4IYGA 2QE8A 3I1CA 1WU1B 2WPLE 3GISX 2DG0A 1V3XB 2GVXA 4JZEL 3N8YB 1CCVA 3KYAA 5JW1A 3N8YA 1IQNL 3KK6A 3ENSA 3BT1A 1EQGA 3Q7DA 1J9CL 1KSNB 2K2SB 4HHOA 1ATDA 4BDWA 3E5ZA 1XFEA 2VVCK 5JBCE 3HPTA 2RNLA 1HZ8A 3V64C 2RHPA 5L30L 4HW6A 2VJ3A 5FDQA 2J4IB 5JBAE 2VWNL 4ZXXL 4XL1A 1UZJA 2WPKE 4ISHL 2V91A 1CCFA 2G00L 1Q4GA 3HO3A 2P28B 4BXWA 2IAOA 3F6UL 1MQ5L 3N8WB 2ISMA 5CKMA 1G1RA 3LC3B 3N8VA 3N8WA 2PUQL 3HO4A 1LMJA 1DVAL 1W8BL 5KIRA 5GTQA 4XLWA 1V04A 1FSBA 1NFUB 2WPHE 4CUFA 2IVZA 1E1AA 4GNCA 2IARA 1RWLA 1IGZA 3IITB 4AQTA 4CSYA 3G4HA 2P3FL 3A9GA 2P4OA 1APOA 2OJHA 1EPJA 2EI6B 3HS6A 2W8BB 3AMRA 3SREA 2BOKL 2W8BA 4LMFA 2Y5HL 1LPGA 1PFXL 1PXXA 2WYGB 3DASA 4JYVL 1IQFL 4JYUL 1FE2A 3BPSE 3SOVA 4IMBA 2MGRA 1IJQA 2YGPA 1IGXA 2WFTA 4NG9L 2VAQA 1TOZA 1TLEA 4GN9A 3O4PA 4LORA 2FP9A 1CRZA 1RFNB 1IVOC 1PRHA 2P95L 3MQEA 2XBVL 2Y7ZB 2G8SA 1HX2A 3MDLA 2FLGA 4Z6AL 1HCGB 3FW0A 1XDTR 1NQLB 2J94B 1M1XB 4GNAA 2Q1JB 2IASA 5COXA 2GHSA 1IQKL 1DIYA 3HS5A 4BTTA 6COXA 2MHPA 1HT8A 2XBXL 2FPCA 3V1SA 3LC5B 4BTUA 5CKQA 4X8VL 2GVVA 3TC9A 2J2UB 3POYA 3S8ZA 2RA0L 3HLHA 3C9AC 1HREA 2DDUA 2GD4A 2KB9A 5K0HB 3LI4A 3KQCL 3ZYIB 1ATEA 4O02B 2W86A 1EPIA 3LAQA 1C5KA 1HT5A 1LPZA 1CVMA 2VVVL 3HRPA 3F1SB 4TGFA 3SOQA 2W2PE 3SW2A 1KLIL 3EGFA 2BOXA 3TGFA 3LI5A 3KL6B 2Y7XB 1IQJL 2XC0L 4G1MB 1CVUA 2BQ6A 2WG3C 3WWAA 1CEJA 4XBMA 3FVZA 2IATA 1N1IA 3KRKA 3QMOA 2FP8A 3P5BL 4RRYA 1WHFA 2P3UA 4JZDL 2D1JB 4RS0A 4A7IA 2H9EL 2W2NE 3A9HA 2EI7B 4GNBA 4MMYB 2VH6B 3AMSA 2XBYL 3S94A 3U7UG 2K2TA 3S8VA 5CISA 2J38B 3NTGA 4PH9A 1NFXB 1UZKA 5GX2A 3NJPC 1FFMA 1JL9A 3BT2A 3R05A 4Q1UA 4MMXB 4JMLA 2F9BL 2PHBB 1L3YA 2P93L 3TZIA 2Y5FL 4ZXYL 1QLGA 3LI3A 2TGFA 4E1GA 5JBBE 4NA9L 2KL7A 2W3KB 3ZYGA 2VVUL 5KN5C 1UZPA 1IQEL 1KLJL 3LN1A 1H6LA 3CFWA 1W7XL 3HS7A 3NTBA 2HQSA 3ELAL 1X7AL 1F0SB 1ATBA 2PR3B 3QH0A 4D0EA 1POOA 4ZLRA 3TH3L 5D9DA 2POOA 4O5SA 1YGCL 1IP0A 2W26B 3U0SA 1KIGL 2WPJE 3KCGL 1EPHA 3LIWB 2IAWA 4YZUB 1YUKB 2WFXB 3K9XA 2FLBL 1HAFA 1F7EA 1RWIA 1G1TA 1ADXA 1EAIC 2P26A 3N8XA 1URKA 3KQEL 3FBYA 1FJSL 3LTFB 1SZBA 1G2MB 1NZIA 2Y80B 4OTJA 1TPGA 1FAKL 5F1AA 3M36L 1ZAQA 5FWWA 4C16A 4BDXA 4X8SL 3FFGL 1EMNA 1XKAL 3OLUA 4O1ZA 3LTGD 3Q6TA 5IKTA 4GN8A 1IQLL 2GVUA 1OB1C 2BOHA 1HJ7A 1NFWB 3IJEB 1JV2B 3V65B 2BMGA 1UZQA 3DEMA 2VWMK 2WPIE 1YO8A 3U73A 2BO2A 2J95B 2BZ6L 2Y5GL 4X8TL 1CX2A 1AUTL 1G1QA 2OYUP 2W2QE 2UWPB 2W3IB 4D90A 2BOUA 1Q7FA 3Q6PA 2XBWL 3HO5A 1MQ6L 4A0PA 3HLIA 4ZHAB 1A3PA 4HHQA 1FF7A 3TBDA 1LQDA 4BXSA 2FLRL 5JB8E 1QFKL 4Z0KB 3TK5B 1Z6EL 2VWLL 2W2ME 2JKHL 5GX4A 5EGMB 3M37L 1B9WA 2UWOB 1COUA 2KV4A 5IKVA 1Z6CA 1F0RB 1C5MF 3ASIA 2IAPA 3GCXE 1I0UA 1EBVA 2IAUA 2P3FN 5JVZA 4ISIL 2YGOA 1IOEL 3KQDL 3H5CB 3Q3KB 1ATAA 1P9JA 4RRWA 3IAXA 3DR2A 1IQGL 5CKNA 4O5TA 4NGAL 4ZAEB 4D0FA 2WG4B 4R40A 2I9BA 5EX7A 2BQWA 1KLOA 2OYEP 5GX1A 4GN7A 2B7DL 4RRZA 1CQ1A 2XC5L 4Y71B 5I46L 1HAEA 4Y76B 3G4EA 3RR3A 5JVYA 2FZZL 3PGHA 1HRFA 5IKRA 2M74A 2ADXA 2GVWA 3OLTA 1N7DA 4M10A 1FAXL 1P0SL 2VWOL 5D9CA 3S2KA 2WPME 2P16L 1U67A 5IKQA 2DSOA 4JZFL 4Z0LA 1EZQB 2P94L 2IAVA 5L2ZL 1XKBA
chains in the Genus database with same CATH superfamily
2IAXA 4PWZA 3SOBB 2BT7A 4GDIA 2FD6A 2VW2A 4Y7AB 1DQBA 2XZJA 3Q6KA 5JYYA 5HUMA 4GZQA 3UC1A 1NT0A 1WHEA 2HTQA 2QWBA 2VW0A 1G2LB 2XN4A 1PGEA 3SRGA 1NFYB 1WCSA 4GB1A 5H47A 3ADEA 1NPEB 3CS7L 4KS3A 4WEFA 4H53A 2F29A 1NPEA 3ZYJB 4J9TA 1NSDA 2F10A 1JBUL 3B7EA 1W21A 1QBIA 1F7MA 4L7CA 1DDXA 3NT1A 1V0EA 2F27A 2AYLA 4RRXA 2FPBA 4SLIA 1PJXA 1EQHA 5E8DA 1N1TA 4YW1A 4DG6A 2W38A 3JU4A 4M4VA 2VK6A 3BYCA 3CA7A 4CUEA 2H9EC 2I9AA 4FPOB 2QWKA 5L2YL 3TI8A 3H6JA 2DG1A 3LN0A 2XC4L 1CVWL 4Y79B 1YUGA 2HT5A 4BTIA 2VRSA 4Y7BB 1NN2A 1YUFA 1EGFA 2H2UA 4UOUA 2H2NA 2EI8B 5F19A 4XJWA 1L5GB 3GCWE 3WW9A 1INWA 5GX3A 3TK6B 4FP3A 4GZOA 4MJUA 2FLUX 1U6DX 4K1HA 1IOXA 1V3CA 2AEQA 1BF9A 2P3TA 1EMOA 4FQ4A 4HZYA 5FNQA 1WCQA 4YT6L 1IQIL 4YT7L 4IQKA 3FCSB 1MOXC 4MMZB 4FM5A 5CGJA 3D12A 3CENL 4K1JA 4AH4A 1V3BA 4IFLX 1K37A 4M11A 2J34B 5HUKA 4COXA 1G1SA 1K36A 2RKCA 3CYEA 4CUDA 3KQBL 1DILA 1IQML 1CQEA 5M1ZA 2XCYA 2BQ7A 2W2OE 4X8UL 4FVKA 2YGQA 4QN5A 3QCWA 1U8CB 1DX5I 1GK5A 3VNHA 2Y38A 1APQA 1IVDA 1VCUA 2Y81B 2UWLB 1L7GA 3CL2A 2Y82B 2F0ZA 2YA6A 5D9BA 2CJIB 3H72A 1PTHA 1C9UA 1L7HA 5GX5A 2WYJB 4MWJA 1LPKA 1IQHL 5JB9E 4Y6DB 3N8ZA 1V0ZA 1IVBA 4OTYA 5FNRA 2VK5A 4AGTA 1EPGA 1B9VA 1O5DL 2MGPA 1CRUA 2VH0B 3KGGA 2IAQA 1S1DA 1INFA 1MS9A 4A94C 2NPRA 1NCCN 1MS0A 4XHXA 4CSDA 4RUTA 4XYXA 4ZH8B 3WN7A 4IYGA 2QE8A 2ZZKA 1INVA 1Z4XA 3I1CA 1WU1B 2C4AA 2QWFA 1IVEA 2WPLE 3GISX 2YA5A 2DG0A 4YZ4A 4FP2A 1V3XB 2GVXA 4JZEL 3N8YB 1CCVA 2HTVA 3KYAA 3VNGA 5JW1A 3N8YA 1MS5A 1IQNL 1A4QA 4M4NA 3KK6A 3ENSA 2HOXA 3BT1A 4KS2A 1EQGA 4HZWA 3TI5A 3Q7DA 4QN6A 4L7DA 1N1VA 1J9CL 2VW1A 1KSNB 1MZ6A 1NNBA 2K2SB 3K36A 4HHOA 3GVJA 1ATDA 4BDWA 3E5ZA 4FPGA 1XFEA 2VVCK 2HTYA 5JBCE 4ASCA 3HPTA 2RNLA 4YZ3A 1HZ8A 1SLLA 1MZ5A 4QN4A 3V64C 4XHBA 1X2JA 2BF6A 3A72A 2VWDA 2RHPA 5L30L 4HW6A 4XIKA 2VJ3A 4FPCA 5EO7A 5FDQA 2J4IB 4FOQA 5JBAE 4QN7A 2VWNL 4ZXXL 4XL1A 1UZJA 2WPKE 4ISHL 2V91A 4GZSA 1CCFA 4IN4A 2G00L 1Q4GA 3HO3A 4MZEA 2P28B 3INBA 4BXWA 2F12A 4B7JA 2IAOA 4YZ1A 4FPYA 3F6UL 4MJVA 1MQ5L 3SANA 3N8WB 2ISMA 5CKMA 1G1RA 3LC3B 3N8VA 1MS1A 3N8WA 4ZY3A 2PUQL 3HO4A 1LMJA 1DVAL 1W8BL 5KIRA 1VCJA 3TI6A 5GTQA 4XLWA 2HTWA 1W8NA 1V04A 1FSBA 1NFUB 2WPHE 4CUFA 1MR5A 2IVZA 2ZB6A 4IFNX 1E1AA 4HZZA 4GNCA 2IARA 4K3YA 4FOYA 1RWLA 1EURA 1IUBA 1IGZA 4FPKA 4H52A 3IITB 4AQTA 4CSYA 3G4HA 2P3FL 4GZPA 3A9GA 2P4OA 1APOA 2OJHA 2AH2A 1EPJA 4FPLA 4K1IA 2EI6B 3HS6A 1INGA 2W8BB 3AMRA 3SREA 2BOKL 2W8BA 4CPLA 4LMFA 1INYA 2Y5HL 1LPGA 1PFXL 1PXXA 1IVCA 2WYGB 3DASA 5F9TA 4JYVL 1IQFL 4NCSA 4FZHA 4CH9A 3K38A 4JYUL 3GVKA 4MWUA 1FE2A 3BPSE 3SOVA 4XMAA 4YW2A 4IMBA 2MGRA 1NSBA 4L7BA 1IJQA 2F11A 4KS5A 2YGPA 1IGXA 4GDJA 4MZAA 2WFTA 4NG9L 4ZGCA 2VAQA 1TOZA 1TLEA 1INXA 2QWDA 3O4PA 4GN9A 4DGRA 4LORA 1EUSA 2BATA 1B9SA 1CRZA 2FP9A 1RFNB 1IVOC 1PRHA 2P95L 3MQEA 2XBVL 2BZDA 2VPJA 2Y7ZB 3ZGDA 2G8SA 1HX2A 3MDLA 2FLGA 4Z6AL 1HCGB 3FW0A 3WDZA 1XDTR 1V2IA 2HTUA 2YA8A 1NQLB 2J94B 1M1XB 1F8EA 4GNAA 4B7MA 2Q1JB 2IASA 2ZWAA 5COXA 2GHSA 1IQKL 1DIYA 3HS5A 4BTTA 6COXA 2MHPA 1HT8A 2XBXL 1Z4WA 2FPCA 3V1SA 4D4UA 3LC5B 4BTUA 5CKQA 1BJIA 2HORA 4X8VL 2GVVA 4MWYA 3TC9A 1IVFA 2YA4A 2XZKA 2J2UB 4KS1A 1QIUA 2KNIA 3POYA 3S8ZA 2RA0L 3K37A 4HZXA 3HLHA 3C9AC 4YZ2A 4CPMA 2WZPP 2A75A 1HREA 2DDUA 2GD4A 1NCBN 1SNTA 2KB9A 5K0HB 1EUTA 2QWGA 2VVZA 3LI4A 3KQCL 3ZYIB 1ATEA 4N1BA 2QWJA 4O02B 5FNSA 2W86A 2W5NA 1EPIA 4B7RA 3LAQA 1C5KA 3SALA 1HT5A 1SUUA 1LPZA 1SO7A 1CVMA 2VVVL 3S6XA 3HRPA 3NN9A 3F1SB 4TGFA 3SOQA 2W2PE 4YW4A 1USXA 3SW2A 4FPJA 1KLIL 3EGFA 2BOXA 3TGFA 3BEQA 3LI5A 3KL6B 4M3MA 2Y7XB 1X2RA 4X6KA 1IQJL 2XC0L 4G1MB 4XJ9A 1CVUA 2DYHA 2BQ6A 2JJLA 2WG3C 2YDTA 3WWAA 1CEJA 4XBMA 3FVZA 2IATA 3GVLA 4B7NA 4WEGA 1N1IA 1MS4A 3KRKA 3TI3A 3QMOA 2FP8A 3P5BL 4RRYA 1WHFA 2P3UA 4JZDL 2D1JB 4RS0A 4A7IA 3D11A 2H9EL 2W2NE 3A9HA 5EO8A 5HUGA 2EI7B 4GNBA 4MMYB 1V1IA 3H71A 2VH6B 2ZW9A 3AMSA 1INHA 2XBYL 4FPFA 2ZB5A 3S94A 3U7UG 4GU4A 4XJZA 2K2TA 3S8VA 5CISA 2J38B 4GEZA 3NTGA 4D52C 4FJ6A 2X9MA 4PH9A 1NFXB 1UZKA 1W1XA 2SILA 5GX2A 4AGIA 3NJPC 1FFMA 1JL9A 3BT2A 7NN9A 3R05A 2CMLA 1USRA 4Q1UA 2B8HA 1L7FA 4MMXB 3OPZA 4JMLA 2F9BL 2PHBB 1N1YA 4FOWA 1L3YA 1S0JA 2P93L 3TZIA 5FZJA 1Z4VA 2Y5FL 4ZXYL 1QLGA 1SLIA 3TICA 3LI3A 4FPHA 5FNUA 4GJTA 5B2DA 2TGFA 3SILA 5FNTA 4E1GA 5JBBE 4NA9L 2KL7A 2W3KB 3ZYGA 2VVUL 5KN5C 2F28A 1UZPA 2HT7A 1KITA 1IQEL 2XZIA 1K32A 1KLJL 3II7A 3CL0A 3LN1A 1H6LA 3CFWA 1W7XL 2F13A 1ZGKA 3HS7A 4X4AA 1N6FA 3NTBA 2HQSA 3CKZA 3ELAL 1X7AL 1F0SB 1ATBA 2PR3B 3QH0A 4D0EA 1POOA 2SIMA 3TH3L 4MWQA 5D9DA 5NN9A 2POOA 4O5SA 1YGCL 1IP0A 2W26B 3U0SA 1KIGL 2WPJE 3KCGL 1EPHA 3L6VA 3LIWB 2IAWA 4YZUB 1MWEA 2W5OA 1YUKB 1XOGA 4MWWA 2WOZA 1A14N 2WFXB 3K9XA 1B9TA 6NN9A 2FLBL 1HAFA 1F7EA 3K3AA 1RWIA 4XMBA 1G1TA 1ADXA 1EAIC 2P26A 3N8XA 2F24A 2YDPA 4WA4A 1URKA 1XOEA 3KQEL 3FBYA 1FJSL 3LTFB 2AGSA 2SLIA 4IFJA 1N1SA 1SZBA 1G2MB 1NZIA 2QWHA 1Z50A 2W20A 2Y80B 3H73A 4OTJA 3NSSA 4Q6KA 1TPGA 1FAKL 4XJ8A 5F1AA 4YY8A 4ZLRA 4WA3A 2AEPA 3M36L 1ZAQA 2FHRA 4NN9A 5F72C 2YA7A 4NC5A 1DIMA 5FWWA 4C16A 3TI4A 4BDXA 4X8SL 3FFGL 1V3EA 1EMNA 1XKAL 3OLUA 4GZXA 4O1ZA 4WA5A 4XOGA 5FZNA 5HUNA 2VSMA 4XJUA 3LTGD 1S0IA 3Q6TA 5IKTA 4GN8A 5HX0A 3W09A 1IQLL 2GVUA 1NMBN 1OB1C 2BOHA 1HJ7A 1NSCA 1NFWB 3IJEB 4K1KA 1F8DA 1W20A 1JV2B 3V65B 3T1EA 2BMGA 1UZQA 3DEMA 2VWMK 1NCAN 2HTRA 2WPIE 1YO8A 3U73A 2BO2A 2J95B 2QWEA 2BZ6L 1V3DA 4M4UA 2Y5GL 4FOVA 4X8TL 1W0OA 1CX2A 1AUTL 3NO0A 4XJAA 1G1QA 4XJQA 2OYUP 4D8SA 3TIBA 2W2QE 2UWPB 4KS4A 4MWLA 2W3IB 4D90A 1E8TA 1S18A 1LMMA 2BOUA 1Q7FA 2VK7A 3Q6PA 2XBWL 3HO5A 1MQ6L 4A0PA 3HLIA 2VSKA 1V0FA 4ZHAB 1A3PA 4HHQA 1FF7A 3TBDA 1LK9A 1LQDA 4BXSA 1MS3A 4YZ5A 2FLRL 4QN3A 5JB8E 1QFKL 4Z0KB 2HU0A 4MWRA 1OFZA 4HIZA 3TK5B 1Z6EL 2VWLL 4X49A 2W2ME 2JKHL 4HZVA 4XJRA 5GX4A 4C1YB 4YW3A 1NMAN 5EGMB 3M37L 4C1YA 1B9WA 4MX0A 4CPNA 1IUCA 2UWOB 2QWIA 1COUA 2KV4A 2HU4A 1N6EA 5IKVA 4CPYA 1Z4YA 4I00A 4CHBA 1Z6CA 1F0RB 4BBWA 1C5MF 3ASIA 2IAPA 1ZI0A 3O9JA 3GCXE 1I0UA 1EBVA 2IAUA 4QNPA 1MS8A 3O9KA 2JKBA 2P3FN 5JVZA 4ISIL 2YGOA 1W0PA 2QWCA 3PJQA 2HT8A 3K39A 1IOEL 3KQDL 3H5CB 3Q3KB 1ATAA 1P9JA 4GU3A 4RRWA 1IVGA 3DR2A 3IAXA 1WP5A 4B7QA 3ALWA 1IQGL 2BT8A 5CKNA 4NGAL 1NNAA 4O5TA 4ZAEB 4D0FA 1N6DA 2WG4B 1EUUA 1NNCA 4R40A 2I9BA 3TIAA 5EX7A 2BQWA 1KLOA 1NCDN 2OYEP 5GX1A 4MWVA 4JF7A 4GN7A 3B69A 1W8OA 2B7DL 2QWAA 4MC7A 4CPOA 4RRZA 1CQ1A 2XC5L 4Y71B 4XE9A 5I46L 1HAEA 4GZWA 4XILA 4Y76B 4MWXA 4D52B 1NMCA 3G4EA 2Z32A 2F25A 1A4GA 4XIOA 4D52A 3RR3A 4XMIA 4AHAA 5JVYA 1V1HA 2FZZL 1F8BA 3PGHA 4X47A 1HRFA 3ALXA 5IKRA 4YW5A 2M74A 4UF7A 4GZTA 2ADXA 2GVWA 3OLTA 1N7DA 2BSFA 2F26A 4M10A 1FAXL 1P0SL 2VWOL 3A71A 1E8UA 5D9CA 3S2KA 2WPME 2P16L 1U67A 1E8VA 1Z4ZA 3ZGCA 5IKQA 2DSOA 1F8CA 4G3NA 2BERA 3SLIA 4JZFL 4Z0LA 4CPZA 1EZQB 2P94L 2IAVA 2C4LA 5L2ZL 4FPEA 5B2CA 1XKBA 1KKEA
chains in the Genus database with same CATH topology
2IAXA 4PWZA 3SOBB 2FD6A 4Y7AB 1DQBA 3Q6KA 1NT0A 1WHEA 1G2LB 1PGEA 3SRGA 1NFYB 1NPEB 3CS7L 1NPEA 3ZYJB 1JBUL 1QBIA 1F7MA 1DDXA 3NT1A 2FPBA 2AYLA 4RRXA 1PJXA 1EQHA 5E8DA 4DG6A 3BYCA 3CA7A 4CUEA 2H9EC 2I9AA 5L2YL 2DG1A 3LN0A 2XC4L 1CVWL 4Y79B 1YUGA 4BTIA 4Y7BB 1YUFA 1EGFA 2EI8B 5F19A 1L5GB 3GCWE 3WW9A 5GX3A 3TK6B 1IOXA 1BF9A 2P3TA 1EMOA 4YT6L 1IQIL 4YT7L 3FCSB 1MOXC 4MMZB 4FM5A 3CENL 1K37A 4M11A 2J34B 4COXA 1G1SA 1K36A 4CUDA 3KQBL 1IQML 1CQEA 2BQ7A 2W2OE 4X8UL 2YGQA 3QCWA 1U8CB 1DX5I 1GK5A 2Y38A 1APQA 2Y81B 2UWLB 2Y82B 5D9BA 2CJIB 1PTHA 1C9UA 5GX5A 2WYJB 1LPKA 1IQHL 5JB9E 4Y6DB 3N8ZA 4OTYA 1EPGA 1O5DL 2MGPA 1CRUA 2VH0B 3KGGA 2IAQA 4A94C 2NPRA 4RUTA 4ZH8B 4IYGA 2QE8A 3I1CA 1WU1B 2WPLE 3GISX 2DG0A 1V3XB 2GVXA 4JZEL 3N8YB 1CCVA 3KYAA 5JW1A 3N8YA 1IQNL 3KK6A 3ENSA 3BT1A 1EQGA 3Q7DA 1J9CL 1KSNB 2K2SB 4HHOA 1ATDA 4BDWA 3E5ZA 1XFEA 2VVCK 5JBCE 3HPTA 2RNLA 1HZ8A 3V64C 2RHPA 5L30L 4HW6A 2VJ3A 5FDQA 2J4IB 5JBAE 2VWNL 4ZXXL 4XL1A 1UZJA 2WPKE 4ISHL 2V91A 1CCFA 2G00L 1Q4GA 3HO3A 2P28B 4BXWA 2IAOA 3F6UL 1MQ5L 3N8WB 2ISMA 5CKMA 1G1RA 3LC3B 3N8VA 3N8WA 2PUQL 3HO4A 1LMJA 1DVAL 1W8BL 5KIRA 5GTQA 4XLWA 1V04A 1FSBA 1NFUB 2WPHE 4CUFA 2IVZA 1E1AA 4GNCA 2IARA 1RWLA 1IGZA 3IITB 4AQTA 4CSYA 3G4HA 2P3FL 3A9GA 2P4OA 1APOA 2OJHA 1EPJA 2EI6B 3HS6A 2W8BB 3AMRA 3SREA 2BOKL 2W8BA 4LMFA 2Y5HL 1LPGA 1PFXL 1PXXA 2WYGB 3DASA 4JYVL 1IQFL 4JYUL 1FE2A 3BPSE 3SOVA 4IMBA 2MGRA 1IJQA 2YGPA 1IGXA 2WFTA 4NG9L 2VAQA 1TOZA 1TLEA 4GN9A 3O4PA 4LORA 2FP9A 1CRZA 1RFNB 1IVOC 1PRHA 2P95L 3MQEA 2XBVL 2Y7ZB 2G8SA 1HX2A 3MDLA 2FLGA 4Z6AL 1HCGB 3FW0A 1XDTR 1NQLB 2J94B 1M1XB 4GNAA 2Q1JB 2IASA 5COXA 2GHSA 1IQKL 1DIYA 3HS5A 4BTTA 6COXA 2MHPA 1HT8A 2XBXL 2FPCA 3V1SA 3LC5B 4BTUA 5CKQA 4X8VL 2GVVA 3TC9A 2J2UB 2KNIA 3POYA 3S8ZA 2RA0L 3HLHA 3C9AC 2WZPP 1HREA 2DDUA 2GD4A 2KB9A 5K0HB 3LI4A 3KQCL 3ZYIB 1ATEA 4O02B 2W86A 1EPIA 3LAQA 1C5KA 1HT5A 1LPZA 1CVMA 2VVVL 3S6XA 3HRPA 3F1SB 4TGFA 3SOQA 2W2PE 3SW2A 1KLIL 3EGFA 2BOXA 3TGFA 3LI5A 3KL6B 2Y7XB 1IQJL 2XC0L 4G1MB 1CVUA 2BQ6A 2WG3C 3WWAA 1CEJA 4XBMA 3FVZA 2IATA 1N1IA 3KRKA 3QMOA 2FP8A 3P5BL 4RRYA 1WHFA 2P3UA 4JZDL 2D1JB 4RS0A 4A7IA 2H9EL 2W2NE 3A9HA 2EI7B 4GNBA 4MMYB 2VH6B 3AMSA 2XBYL 3S94A 3U7UG 2K2TA 3S8VA 5CISA 2J38B 3NTGA 4PH9A 1NFXB 1UZKA 5GX2A 3NJPC 1FFMA 1JL9A 3BT2A 3R05A 4Q1UA 4MMXB 4JMLA 2F9BL 2PHBB 1L3YA 2P93L 3TZIA 2Y5FL 4ZXYL 1QLGA 3LI3A 2TGFA 4E1GA 5JBBE 4NA9L 2KL7A 2W3KB 3ZYGA 2VVUL 5KN5C 1UZPA 1IQEL 1KLJL 3LN1A 1H6LA 3CFWA 1W7XL 3HS7A 3NTBA 2HQSA 3ELAL 1X7AL 1F0SB 1ATBA 2PR3B 3QH0A 4D0EA 1POOA 4ZLRA 3TH3L 5D9DA 2POOA 4O5SA 1YGCL 1IP0A 2W26B 3U0SA 1KIGL 2WPJE 3KCGL 1EPHA 3LIWB 2IAWA 4YZUB 1YUKB 2WFXB 3K9XA 2FLBL 1HAFA 1F7EA 1RWIA 1G1TA 1ADXA 1EAIC 2P26A 3N8XA 1URKA 3KQEL 3FBYA 1FJSL 3LTFB 1SZBA 1G2MB 1NZIA 2Y80B 4OTJA 1TPGA 1FAKL 5F1AA 3M36L 1ZAQA 5FWWA 4C16A 4BDXA 4X8SL 3FFGL 1EMNA 1XKAL 3OLUA 4O1ZA 3LTGD 3Q6TA 5IKTA 4GN8A 1IQLL 2GVUA 1OB1C 2BOHA 1HJ7A 1NFWB 3IJEB 1JV2B 3V65B 2BMGA 1UZQA 3DEMA 2VWMK 2WPIE 1YO8A 3U73A 2BO2A 2J95B 2BZ6L 2Y5GL 4X8TL 1CX2A 1AUTL 1G1QA 2OYUP 2W2QE 2UWPB 2W3IB 4D90A 1LMMA 2BOUA 1Q7FA 3Q6PA 2XBWL 3HO5A 1MQ6L 4A0PA 3HLIA 4ZHAB 1A3PA 4HHQA 1FF7A 3TBDA 1LQDA 4BXSA 2FLRL 5JB8E 1QFKL 4Z0KB 3TK5B 1Z6EL 2VWLL 2W2ME 2JKHL 5GX4A 5EGMB 3M37L 1B9WA 2UWOB 1COUA 2KV4A 5IKVA 1Z6CA 1F0RB 1C5MF 3ASIA 2IAPA 3GCXE 1I0UA 1EBVA 2IAUA 2P3FN 5JVZA 4ISIL 2YGOA 1IOEL 3KQDL 3H5CB 3Q3KB 1ATAA 1P9JA 4RRWA 3IAXA 3DR2A 1IQGL 5CKNA 4O5TA 4NGAL 4ZAEB 4D0FA 2WG4B 4R40A 2I9BA 5EX7A 2BQWA 1KLOA 2OYEP 5GX1A 4GN7A 2B7DL 4RRZA 1CQ1A 2XC5L 4Y71B 5I46L 1HAEA 4Y76B 3G4EA 3RR3A 5JVYA 2FZZL 3PGHA 1HRFA 5IKRA 2M74A 2ADXA 2GVWA 3OLTA 1N7DA 4M10A 1FAXL 1P0SL 2VWOL 5D9CA 3S2KA 2WPME 2P16L 1U67A 5IKQA 2DSOA 4JZFL 4Z0LA 1EZQB 2P94L 2IAVA 5L2ZL 1XKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAX A;  4PWZ A;  3SOB B;  2FD6 A;  4Y7A B;  1DQB A;  3Q6K A;  1NT0 A;  1WHE A;  1G2L B;  1PGE A;  3SRG A;  1NFY B;  1NPE B;  3CS7 L;  1NPE A;  3ZYJ B;  1JBU L;  1QBI A;  1F7M A;  1DDX A;  3NT1 A;  2FPB A;  2AYL A;  4RRX A;  1PJX A;  1EQH A;  5E8D A;  4DG6 A;  3BYC A;  3CA7 A;  4CUE A;  2I9A A;  5L2Y L;  2DG1 A;  3LN0 A;  2XC4 L;  1CVW L;  4Y79 B;  1YUG A;  4BTI A;  4Y7B B;  1YUF A;  1EGF A;  2EI8 B;  5F19 A;  1L5G B;  3GCW E;  3WW9 A;  5GX3 A;  3TK6 B;  1IOX A;  1BF9 A;  2P3T A;  1EMO A;  4YT6 L;  1IQI L;  4YT7 L;  3FCS B;  1MOX C;  4MMZ B;  4FM5 A;  3CEN L;  1K37 A;  4M11 A;  2J34 B;  4COX A;  1G1S A;  1K36 A;  4CUD A;  3KQB L;  1IQM L;  1CQE A;  2BQ7 A;  2W2O E;  4X8U L;  3QCW A;  1U8C B;  1DX5 I;  1GK5 A;  2Y38 A;  1APQ A;  2Y81 B;  2UWL B;  2Y82 B;  5D9B A;  2CJI B;  1PTH A;  1C9U A;  5GX5 A;  2WYJ B;  1LPK A;  1IQH L;  5JB9 E;  4Y6D B;  3N8Z A;  4OTY A;  1EPG A;  1O5D L;  2MGP A;  1CRU A;  2VH0 B;  3KGG A;  2IAQ A;  2NPR A;  4RUT A;  4ZH8 B;  4IYG A;  2QE8 A;  3I1C A;  1WU1 B;  2WPL E;  3GIS X;  2DG0 A;  1V3X B;  2GVX A;  4JZE L;  3N8Y B;  1CCV A;  3KYA A;  5JW1 A;  3N8Y A;  1IQN L;  3KK6 A;  3ENS A;  3BT1 A;  1EQG A;  3Q7D A;  1J9C L;  1KSN B;  2K2S B;  4HHO A;  1ATD A;  4BDW A;  3E5Z A;  1XFE A;  2VVC K;  5JBC E;  3HPT A;  2RNL A;  1HZ8 A;  3V64 C;  2RHP A;  5L30 L;  4HW6 A;  2VJ3 A;  5FDQ A;  2J4I B;  5JBA E;  2VWN L;  4ZXX L;  4XL1 A;  1UZJ A;  2WPK E;  4ISH L;  2V91 A;  1CCF A;  2G00 L;  1Q4G A;  3HO3 A;  2P28 B;  4BXW A;  2IAO A;  3F6U L;  1MQ5 L;  3N8W B;  2ISM A;  5CKM A;  1G1R A;  3LC3 B;  3N8V A;  3N8W A;  2PUQ L;  3HO4 A;  1LMJ A;  1DVA L;  1W8B L;  5KIR A;  5GTQ A;  4XLW A;  1V04 A;  1FSB A;  1NFU B;  2WPH E;  4CUF A;  2IVZ A;  1E1A A;  4GNC A;  2IAR A;  1RWL A;  1IGZ A;  3IIT B;  4AQT A;  4CSY A;  3G4H A;  2P3F L;  3A9G A;  2P4O A;  1APO A;  2OJH A;  1EPJ A;  2EI6 B;  3HS6 A;  2W8B B;  3AMR A;  3SRE A;  2BOK L;  2W8B A;  4LMF A;  2Y5H L;  1LPG A;  1PFX L;  1PXX A;  2WYG B;  3DAS A;  4JYV L;  1IQF L;  4JYU L;  1FE2 A;  3BPS E;  3SOV A;  4IMB A;  2MGR A;  1IJQ A;  2YGP A;  1IGX A;  2WFT A;  4NG9 L;  2VAQ A;  1TOZ A;  1TLE A;  4GN9 A;  3O4P A;  4LOR A;  2FP9 A;  1CRZ A;  1RFN B;  1IVO C;  1PRH A;  2P95 L;  3MQE A;  2XBV L;  2Y7Z B;  2G8S A;  1HX2 A;  3MDL A;  2FLG A;  4Z6A L;  1HCG B;  3FW0 A;  1XDT R;  1NQL B;  2J94 B;  1M1X B;  4GNA A;  2Q1J B;  2IAS A;  5COX A;  2GHS A;  1IQK L;  1DIY A;  3HS5 A;  4BTT A;  6COX A;  2MHP A;  1HT8 A;  2XBX L;  2FPC A;  3V1S A;  3LC5 B;  4BTU A;  5CKQ A;  4X8V L;  2GVV A;  3TC9 A;  2J2U B;  3POY A;  3S8Z A;  2RA0 L;  3HLH A;  3C9A C;  1HRE A;  2DDU A;  2GD4 A;  2KB9 A;  5K0H B;  3LI4 A;  3KQC L;  3ZYI B;  1ATE A;  4O02 B;  2W86 A;  1EPI A;  3LAQ A;  1C5K A;  1HT5 A;  1LPZ A;  1CVM A;  2VVV L;  3HRP A;  3F1S B;  4TGF A;  3SOQ A;  2W2P E;  3SW2 A;  1KLI L;  3EGF A;  2BOX A;  3TGF A;  3LI5 A;  3KL6 B;  2Y7X B;  1IQJ L;  2XC0 L;  4G1M B;  1CVU A;  2BQ6 A;  2WG3 C;  3WWA A;  1CEJ A;  4XBM A;  3FVZ A;  2IAT A;  1N1I A;  3KRK A;  3QMO A;  2FP8 A;  3P5B L;  4RRY A;  1WHF A;  2P3U A;  4JZD L;  2D1J B;  4RS0 A;  4A7I A;  2H9E L;  2W2N E;  3A9H A;  2EI7 B;  4GNB A;  4MMY B;  2VH6 B;  3AMS A;  2XBY L;  3S94 A;  3U7U G;  2K2T A;  3S8V A;  5CIS A;  2J38 B;  3NTG A;  4PH9 A;  1NFX B;  1UZK A;  5GX2 A;  3NJP C;  1FFM A;  1JL9 A;  3BT2 A;  3R05 A;  4Q1U A;  4MMX B;  4JML A;  2F9B L;  2PHB B;  1L3Y A;  2P93 L;  3TZI A;  2Y5F L;  4ZXY L;  1QLG A;  3LI3 A;  2TGF A;  4E1G A;  5JBB E;  4NA9 L;  2KL7 A;  2W3K B;  3ZYG A;  2VVU L;  5KN5 C;  1UZP A;  1IQE L;  1KLJ L;  3LN1 A;  1H6L A;  3CFW A;  1W7X L;  3HS7 A;  3NTB A;  2HQS A;  3ELA L;  1X7A L;  1F0S B;  1ATB A;  2PR3 B;  3QH0 A;  4D0E A;  1POO A;  4ZLR A;  3TH3 L;  5D9D A;  2POO A;  4O5S A;  1YGC L;  1IP0 A;  2W26 B;  3U0S A;  1KIG L;  2WPJ E;  3KCG L;  1EPH A;  3LIW B;  2IAW A;  4YZU B;  1YUK B;  2WFX B;  3K9X A;  2FLB L;  1HAF A;  1F7E A;  1RWI A;  1G1T A;  1ADX A;  1EAI C;  2P26 A;  3N8X A;  1URK A;  3KQE L;  3FBY A;  1FJS L;  3LTF B;  1SZB A;  1G2M B;  1NZI A;  2Y80 B;  4OTJ A;  1TPG A;  1FAK L;  5F1A A;  3M36 L;  1ZAQ A;  5FWW A;  4C16 A;  4BDX A;  4X8S L;  3FFG L;  1EMN A;  1XKA L;  3OLU A;  4O1Z A;  3LTG D;  3Q6T A;  5IKT A;  4GN8 A;  1IQL L;  2GVU A;  1OB1 C;  2BOH A;  1HJ7 A;  1NFW B;  3IJE B;  1JV2 B;  3V65 B;  2BMG A;  1UZQ A;  3DEM A;  2VWM K;  2WPI E;  1YO8 A;  3U73 A;  2BO2 A;  2J95 B;  2BZ6 L;  2Y5G L;  4X8T L;  1CX2 A;  1AUT L;  1G1Q A;  2OYU P;  2W2Q E;  2UWP B;  2W3I B;  4D90 A;  2BOU A;  1Q7F A;  3Q6P A;  2XBW L;  3HO5 A;  1MQ6 L;  4A0P A;  3HLI A;  4ZHA B;  1A3P A;  4HHQ A;  1FF7 A;  3TBD A;  1LQD A;  4BXS A;  2FLR L;  5JB8 E;  1QFK L;  4Z0K B;  3TK5 B;  1Z6E L;  2VWL L;  2W2M E;  2JKH L;  5GX4 A;  5EGM B;  3M37 L;  1B9W A;  2UWO B;  1COU A;  2KV4 A;  5IKV A;  1Z6C A;  1F0R B;  1C5M F;  3ASI A;  2IAP A;  3GCX E;  1I0U A;  1EBV A;  2IAU A;  2P3F N;  5JVZ A;  4ISI L;  2YGO A;  1IOE L;  3KQD L;  3H5C B;  3Q3K B;  1ATA A;  1P9J A;  4RRW A;  3IAX A;  3DR2 A;  1IQG L;  5CKN A;  4O5T A;  4NGA L;  4ZAE B;  4D0F A;  2WG4 B;  4R40 A;  2I9B A;  5EX7 A;  2BQW A;  1KLO A;  2OYE P;  5GX1 A;  4GN7 A;  2B7D L;  4RRZ A;  1CQ1 A;  2XC5 L;  4Y71 B;  5I46 L;  1HAE A;  4Y76 B;  3G4E A;  3RR3 A;  5JVY A;  2FZZ L;  3PGH A;  1HRF A;  5IKR A;  2M74 A;  2ADX A;  2GVW A;  3OLT A;  1N7D A;  4M10 A;  1FAX L;  1P0S L;  2VWO L;  5D9C A;  3S2K A;  2WPM E;  2P16 L;  1U67 A;  5IKQ A;  2DSO A;  4JZF L;  4Z0L A;  1EZQ B;  2P94 L;  2IAV A;  5L2Z L;  1XKB A; 
#chains in the Genus database with same CATH topology
 2IAX A;  4PWZ A;  3SOB B;  2BT7 A;  4GDI A;  2FD6 A;  2VW2 A;  4Y7A B;  1DQB A;  2XZJ A;  3Q6K A;  5JYY A;  5HUM A;  4GZQ A;  3UC1 A;  1NT0 A;  1WHE A;  2HTQ A;  2QWB A;  2VW0 A;  1G2L B;  2XN4 A;  1PGE A;  3SRG A;  1NFY B;  1WCS A;  4GB1 A;  5H47 A;  3ADE A;  1NPE B;  3CS7 L;  4KS3 A;  4WEF A;  4H53 A;  2F29 A;  1NPE A;  3ZYJ B;  4J9T A;  1NSD A;  2F10 A;  1JBU L;  3B7E A;  1W21 A;  1QBI A;  1F7M A;  4L7C A;  1DDX A;  3NT1 A;  1V0E A;  2F27 A;  2AYL A;  4RRX A;  2FPB A;  4SLI A;  1PJX A;  1EQH A;  5E8D A;  1N1T A;  4YW1 A;  4DG6 A;  2W38 A;  3JU4 A;  4M4V A;  2VK6 A;  3BYC A;  3CA7 A;  4CUE A;  2H9E C;  2I9A A;  4FPO B;  2QWK A;  5L2Y L;  3TI8 A;  3H6J A;  2DG1 A;  3LN0 A;  2XC4 L;  1CVW L;  4Y79 B;  1YUG A;  2HT5 A;  4BTI A;  2VRS A;  4Y7B B;  1NN2 A;  1YUF A;  1EGF A;  2H2U A;  4UOU A;  2H2N A;  2EI8 B;  5F19 A;  4XJW A;  1L5G B;  3GCW E;  3WW9 A;  1INW A;  5GX3 A;  3TK6 B;  4FP3 A;  4GZO A;  4MJU A;  2FLU X;  1U6D X;  4K1H A;  1IOX A;  1V3C A;  2AEQ A;  1BF9 A;  2P3T A;  1EMO A;  4FQ4 A;  4HZY A;  5FNQ A;  1WCQ A;  4YT6 L;  1IQI L;  4YT7 L;  4IQK A;  3FCS B;  1MOX C;  4MMZ B;  4FM5 A;  5CGJ A;  3D12 A;  3CEN L;  4K1J A;  4AH4 A;  1V3B A;  4IFL X;  1K37 A;  4M11 A;  2J34 B;  5HUK A;  4COX A;  1G1S A;  1K36 A;  2RKC A;  3CYE A;  4CUD A;  3KQB L;  1DIL A;  1IQM L;  1CQE A;  5M1Z A;  2XCY A;  2BQ7 A;  2W2O E;  4X8U L;  4FVK A;  2YGQ A;  4QN5 A;  3QCW A;  1U8C B;  1DX5 I;  1GK5 A;  3VNH A;  2Y38 A;  1APQ A;  1IVD A;  1VCU A;  2Y81 B;  2UWL B;  1L7G A;  3CL2 A;  2Y82 B;  2F0Z A;  2YA6 A;  5D9B A;  2CJI B;  3H72 A;  1PTH A;  1C9U A;  1L7H A;  5GX5 A;  2WYJ B;  4MWJ A;  1LPK A;  1IQH L;  5JB9 E;  4Y6D B;  3N8Z A;  1V0Z A;  1IVB A;  4OTY A;  5FNR A;  2VK5 A;  4AGT A;  1EPG A;  1B9V A;  1O5D L;  2MGP A;  1CRU A;  2VH0 B;  3KGG A;  2IAQ A;  1S1D A;  1INF A;  1MS9 A;  4A94 C;  2NPR A;  1NCC N;  1MS0 A;  4XHX A;  4CSD A;  4RUT A;  4XYX A;  4ZH8 B;  3WN7 A;  4IYG A;  2QE8 A;  2ZZK A;  1INV A;  1Z4X A;  3I1C A;  1WU1 B;  2C4A A;  2QWF A;  1IVE A;  2WPL E;  3GIS X;  2YA5 A;  2DG0 A;  4YZ4 A;  4FP2 A;  1V3X B;  2GVX A;  4JZE L;  3N8Y B;  1CCV A;  2HTV A;  3KYA A;  3VNG A;  5JW1 A;  3N8Y A;  1MS5 A;  1IQN L;  1A4Q A;  4M4N A;  3KK6 A;  3ENS A;  2HOX A;  3BT1 A;  4KS2 A;  1EQG A;  4HZW A;  3TI5 A;  3Q7D A;  4QN6 A;  4L7D A;  1N1V A;  1J9C L;  2VW1 A;  1KSN B;  1MZ6 A;  1NNB A;  2K2S B;  3K36 A;  4HHO A;  3GVJ A;  1ATD A;  4BDW A;  3E5Z A;  4FPG A;  1XFE A;  2VVC K;  2HTY A;  5JBC E;  4ASC A;  3HPT A;  2RNL A;  4YZ3 A;  1HZ8 A;  1SLL A;  1MZ5 A;  4QN4 A;  3V64 C;  4XHB A;  1X2J A;  2BF6 A;  3A72 A;  2VWD A;  2RHP A;  5L30 L;  4HW6 A;  4XIK A;  2VJ3 A;  4FPC A;  5EO7 A;  5FDQ A;  2J4I B;  4FOQ A;  5JBA E;  4QN7 A;  2VWN L;  4ZXX L;  4XL1 A;  1UZJ A;  2WPK E;  4ISH L;  2V91 A;  4GZS A;  1CCF A;  4IN4 A;  2G00 L;  1Q4G A;  3HO3 A;  4MZE A;  2P28 B;  3INB A;  4BXW A;  2F12 A;  4B7J A;  2IAO A;  4YZ1 A;  4FPY A;  3F6U L;  4MJV A;  1MQ5 L;  3SAN A;  3N8W B;  2ISM A;  5CKM A;  1G1R A;  3LC3 B;  3N8V A;  1MS1 A;  3N8W A;  4ZY3 A;  2PUQ L;  3HO4 A;  1LMJ A;  1DVA L;  1W8B L;  5KIR A;  1VCJ A;  3TI6 A;  5GTQ A;  4XLW A;  2HTW A;  1W8N A;  1V04 A;  1FSB A;  1NFU B;  2WPH E;  4CUF A;  1MR5 A;  2IVZ A;  2ZB6 A;  4IFN X;  1E1A A;  4HZZ A;  4GNC A;  2IAR A;  4K3Y A;  4FOY A;  1RWL A;  1EUR A;  1IUB A;  1IGZ A;  4FPK A;  4H52 A;  3IIT B;  4AQT A;  4CSY A;  3G4H A;  2P3F L;  4GZP A;  3A9G A;  2P4O A;  1APO A;  2OJH A;  2AH2 A;  1EPJ A;  4FPL A;  4K1I A;  2EI6 B;  3HS6 A;  1ING A;  2W8B B;  3AMR A;  3SRE A;  2BOK L;  2W8B A;  4CPL A;  4LMF A;  1INY A;  2Y5H L;  1LPG A;  1PFX L;  1PXX A;  1IVC A;  2WYG B;  3DAS A;  5F9T A;  4JYV L;  1IQF L;  4NCS A;  4FZH A;  4CH9 A;  3K38 A;  4JYU L;  3GVK A;  4MWU A;  1FE2 A;  3BPS E;  3SOV A;  4XMA A;  4YW2 A;  4IMB A;  2MGR A;  1NSB A;  4L7B A;  1IJQ A;  2F11 A;  4KS5 A;  2YGP A;  1IGX A;  4GDJ A;  4MZA A;  2WFT A;  4NG9 L;  4ZGC A;  2VAQ A;  1TOZ A;  1TLE A;  1INX A;  2QWD A;  3O4P A;  4GN9 A;  4DGR A;  4LOR A;  1EUS A;  2BAT A;  1B9S A;  1CRZ A;  2FP9 A;  1RFN B;  1IVO C;  1PRH A;  2P95 L;  3MQE A;  2XBV L;  2BZD A;  2VPJ A;  2Y7Z B;  3ZGD A;  2G8S A;  1HX2 A;  3MDL A;  2FLG A;  4Z6A L;  1HCG B;  3FW0 A;  3WDZ A;  1XDT R;  1V2I A;  2HTU A;  2YA8 A;  1NQL B;  2J94 B;  1M1X B;  1F8E A;  4GNA A;  4B7M A;  2Q1J B;  2IAS A;  2ZWA A;  5COX A;  2GHS A;  1IQK L;  1DIY A;  3HS5 A;  4BTT A;  6COX A;  2MHP A;  1HT8 A;  2XBX L;  1Z4W A;  2FPC A;  3V1S A;  4D4U A;  3LC5 B;  4BTU A;  5CKQ A;  1BJI A;  2HOR A;  4X8V L;  2GVV A;  4MWY A;  3TC9 A;  1IVF A;  2YA4 A;  2XZK A;  2J2U B;  4KS1 A;  1QIU A;  2KNI A;  3POY A;  3S8Z A;  2RA0 L;  3K37 A;  4HZX A;  3HLH A;  3C9A C;  4YZ2 A;  4CPM A;  2WZP P;  2A75 A;  1HRE A;  2DDU A;  2GD4 A;  1NCB N;  1SNT A;  2KB9 A;  5K0H B;  1EUT A;  2QWG A;  2VVZ A;  3LI4 A;  3KQC L;  3ZYI B;  1ATE A;  4N1B A;  2QWJ A;  4O02 B;  5FNS A;  2W86 A;  2W5N A;  1EPI A;  4B7R A;  3LAQ A;  1C5K A;  3SAL A;  1HT5 A;  1SUU A;  1LPZ A;  1SO7 A;  1CVM A;  2VVV L;  3S6X A;  3HRP A;  3NN9 A;  3F1S B;  4TGF A;  3SOQ A;  2W2P E;  4YW4 A;  1USX A;  3SW2 A;  4FPJ A;  1KLI L;  3EGF A;  2BOX A;  3TGF A;  3BEQ A;  3LI5 A;  3KL6 B;  4M3M A;  2Y7X B;  1X2R A;  4X6K A;  1IQJ L;  2XC0 L;  4G1M B;  4XJ9 A;  1CVU A;  2DYH A;  2BQ6 A;  2JJL A;  2WG3 C;  2YDT A;  3WWA A;  1CEJ A;  4XBM A;  3FVZ A;  2IAT A;  3GVL A;  4B7N A;  4WEG A;  1N1I A;  1MS4 A;  3KRK A;  3TI3 A;  3QMO A;  2FP8 A;  3P5B L;  4RRY A;  1WHF A;  2P3U A;  4JZD L;  2D1J B;  4RS0 A;  4A7I A;  3D11 A;  2H9E L;  2W2N E;  3A9H A;  5EO8 A;  5HUG A;  2EI7 B;  4GNB A;  4MMY B;  1V1I A;  3H71 A;  2VH6 B;  2ZW9 A;  3AMS A;  1INH A;  2XBY L;  4FPF A;  2ZB5 A;  3S94 A;  3U7U G;  4GU4 A;  4XJZ A;  2K2T A;  3S8V A;  5CIS A;  2J38 B;  4GEZ A;  3NTG A;  4D52 C;  4FJ6 A;  2X9M A;  4PH9 A;  1NFX B;  1UZK A;  1W1X A;  2SIL A;  5GX2 A;  4AGI A;  3NJP C;  1FFM A;  1JL9 A;  3BT2 A;  7NN9 A;  3R05 A;  2CML A;  1USR A;  4Q1U A;  2B8H A;  1L7F A;  4MMX B;  3OPZ A;  4JML A;  2F9B L;  2PHB B;  1N1Y A;  4FOW A;  1L3Y A;  1S0J A;  2P93 L;  3TZI A;  5FZJ A;  1Z4V A;  2Y5F L;  4ZXY L;  1QLG A;  1SLI A;  3TIC A;  3LI3 A;  4FPH A;  5FNU A;  4GJT A;  5B2D A;  2TGF A;  3SIL A;  5FNT A;  4E1G A;  5JBB E;  4NA9 L;  2KL7 A;  2W3K B;  3ZYG A;  2VVU L;  5KN5 C;  2F28 A;  1UZP A;  2HT7 A;  1KIT A;  1IQE L;  2XZI A;  1K32 A;  1KLJ L;  3II7 A;  3CL0 A;  3LN1 A;  1H6L A;  3CFW A;  1W7X L;  2F13 A;  1ZGK A;  3HS7 A;  4X4A A;  1N6F A;  3NTB A;  2HQS A;  3CKZ A;  3ELA L;  1X7A L;  1F0S B;  1ATB A;  2PR3 B;  3QH0 A;  4D0E A;  1POO A;  2SIM A;  3TH3 L;  4MWQ A;  5D9D A;  5NN9 A;  2POO A;  4O5S A;  1YGC L;  1IP0 A;  2W26 B;  3U0S A;  1KIG L;  2WPJ E;  3KCG L;  1EPH A;  3L6V A;  3LIW B;  2IAW A;  4YZU B;  1MWE A;  2W5O A;  1YUK B;  1XOG A;  4MWW A;  2WOZ A;  1A14 N;  2WFX B;  3K9X A;  1B9T A;  6NN9 A;  2FLB L;  1HAF A;  1F7E A;  3K3A A;  1RWI A;  4XMB A;  1G1T A;  1ADX A;  1EAI C;  2P26 A;  3N8X A;  2F24 A;  2YDP A;  4WA4 A;  1URK A;  1XOE A;  3KQE L;  3FBY A;  1FJS L;  3LTF B;  2AGS A;  2SLI A;  4IFJ A;  1N1S A;  1SZB A;  1G2M B;  1NZI A;  2QWH A;  1Z50 A;  2W20 A;  2Y80 B;  3H73 A;  4OTJ A;  3NSS A;  4Q6K A;  1TPG A;  1FAK L;  4XJ8 A;  5F1A A;  4YY8 A;  4ZLR A;  4WA3 A;  2AEP A;  3M36 L;  1ZAQ A;  2FHR A;  4NN9 A;  5F72 C;  2YA7 A;  4NC5 A;  1DIM A;  5FWW A;  4C16 A;  3TI4 A;  4BDX A;  4X8S L;  3FFG L;  1V3E A;  1EMN A;  1XKA L;  3OLU A;  4GZX A;  4O1Z A;  4WA5 A;  4XOG A;  5FZN A;  5HUN A;  2VSM A;  4XJU A;  3LTG D;  1S0I A;  3Q6T A;  5IKT A;  4GN8 A;  5HX0 A;  3W09 A;  1IQL L;  2GVU A;  1NMB N;  1OB1 C;  2BOH A;  1HJ7 A;  1NSC A;  1NFW B;  3IJE B;  4K1K A;  1F8D A;  1W20 A;  1JV2 B;  3V65 B;  3T1E A;  2BMG A;  1UZQ A;  3DEM A;  2VWM K;  1NCA N;  2HTR A;  2WPI E;  1YO8 A;  3U73 A;  2BO2 A;  2J95 B;  2QWE A;  2BZ6 L;  1V3D A;  4M4U A;  2Y5G L;  4FOV A;  4X8T L;  1W0O A;  1CX2 A;  1AUT L;  3NO0 A;  4XJA A;  1G1Q A;  4XJQ A;  2OYU P;  4D8S A;  3TIB A;  2W2Q E;  2UWP B;  4KS4 A;  4MWL A;  2W3I B;  4D90 A;  1E8T A;  1S18 A;  1LMM A;  2BOU A;  1Q7F A;  2VK7 A;  3Q6P A;  2XBW L;  3HO5 A;  1MQ6 L;  4A0P A;  3HLI A;  2VSK A;  1V0F A;  4ZHA B;  1A3P A;  4HHQ A;  1FF7 A;  3TBD A;  1LK9 A;  1LQD A;  4BXS A;  1MS3 A;  4YZ5 A;  2FLR L;  4QN3 A;  5JB8 E;  1QFK L;  4Z0K B;  2HU0 A;  4MWR A;  1OFZ A;  4HIZ A;  3TK5 B;  1Z6E L;  2VWL L;  4X49 A;  2W2M E;  2JKH L;  4HZV A;  4XJR A;  5GX4 A;  4C1Y B;  4YW3 A;  1NMA N;  5EGM B;  3M37 L;  4C1Y A;  1B9W A;  4MX0 A;  4CPN A;  1IUC A;  2UWO B;  2QWI A;  1COU A;  2KV4 A;  2HU4 A;  1N6E A;  5IKV A;  4CPY A;  1Z4Y A;  4I00 A;  4CHB A;  1Z6C A;  1F0R B;  4BBW A;  1C5M F;  3ASI A;  2IAP A;  1ZI0 A;  3O9J A;  3GCX E;  1I0U A;  1EBV A;  2IAU A;  4QNP A;  1MS8 A;  3O9K A;  2JKB A;  2P3F N;  5JVZ A;  4ISI L;  2YGO A;  1W0P A;  2QWC A;  3PJQ A;  2HT8 A;  3K39 A;  1IOE L;  3KQD L;  3H5C B;  3Q3K B;  1ATA A;  1P9J A;  4GU3 A;  4RRW A;  1IVG A;  3DR2 A;  3IAX A;  1WP5 A;  4B7Q A;  3ALW A;  1IQG L;  2BT8 A;  5CKN A;  4NGA L;  1NNA A;  4O5T A;  4ZAE B;  4D0F A;  1N6D A;  2WG4 B;  1EUU A;  1NNC A;  4R40 A;  2I9B A;  3TIA A;  5EX7 A;  2BQW A;  1KLO A;  1NCD N;  2OYE P;  5GX1 A;  4MWV A;  4JF7 A;  4GN7 A;  3B69 A;  1W8O A;  2B7D L;  2QWA A;  4MC7 A;  4CPO A;  4RRZ A;  1CQ1 A;  2XC5 L;  4Y71 B;  4XE9 A;  5I46 L;  1HAE A;  4GZW A;  4XIL A;  4Y76 B;  4MWX A;  4D52 B;  1NMC A;  3G4E A;  2Z32 A;  2F25 A;  1A4G A;  4XIO A;  4D52 A;  3RR3 A;  4XMI A;  4AHA A;  5JVY A;  1V1H A;  2FZZ L;  1F8B A;  3PGH A;  4X47 A;  1HRF A;  3ALX A;  5IKR A;  4YW5 A;  2M74 A;  4UF7 A;  4GZT A;  2ADX A;  2GVW A;  3OLT A;  1N7D A;  2BSF A;  2F26 A;  4M10 A;  1FAX L;  1P0S L;  2VWO L;  3A71 A;  1E8U A;  5D9C A;  3S2K A;  2WPM E;  2P16 L;  1U67 A;  1E8V A;  1Z4Z A;  3ZGC A;  5IKQ A;  2DSO A;  1F8C A;  4G3N A;  2BER A;  3SLI A;  4JZF L;  4Z0L A;  4CPZ A;  1EZQ B;  2P94 L;  2IAV A;  2C4L A;  5L2Z L;  4FPE A;  5B2C A;  1XKB A;  1KKE A; 
#chains in the Genus database with same CATH homology
 2IAX A;  4PWZ A;  3SOB B;  2FD6 A;  4Y7A B;  1DQB A;  3Q6K A;  1NT0 A;  1WHE A;  1G2L B;  1PGE A;  3SRG A;  1NFY B;  1NPE B;  3CS7 L;  1NPE A;  3ZYJ B;  1JBU L;  1QBI A;  1F7M A;  1DDX A;  3NT1 A;  2FPB A;  2AYL A;  4RRX A;  1PJX A;  1EQH A;  5E8D A;  4DG6 A;  3BYC A;  3CA7 A;  4CUE A;  2H9E C;  2I9A A;  5L2Y L;  2DG1 A;  3LN0 A;  2XC4 L;  1CVW L;  4Y79 B;  1YUG A;  4BTI A;  4Y7B B;  1YUF A;  1EGF A;  2EI8 B;  5F19 A;  1L5G B;  3GCW E;  3WW9 A;  5GX3 A;  3TK6 B;  1IOX A;  1BF9 A;  2P3T A;  1EMO A;  4YT6 L;  1IQI L;  4YT7 L;  3FCS B;  1MOX C;  4MMZ B;  4FM5 A;  3CEN L;  1K37 A;  4M11 A;  2J34 B;  4COX A;  1G1S A;  1K36 A;  4CUD A;  3KQB L;  1IQM L;  1CQE A;  2BQ7 A;  2W2O E;  4X8U L;  2YGQ A;  3QCW A;  1U8C B;  1DX5 I;  1GK5 A;  2Y38 A;  1APQ A;  2Y81 B;  2UWL B;  2Y82 B;  5D9B A;  2CJI B;  1PTH A;  1C9U A;  5GX5 A;  2WYJ B;  1LPK A;  1IQH L;  5JB9 E;  4Y6D B;  3N8Z A;  4OTY A;  1EPG A;  1O5D L;  2MGP A;  1CRU A;  2VH0 B;  3KGG A;  2IAQ A;  4A94 C;  2NPR A;  4RUT A;  4ZH8 B;  4IYG A;  2QE8 A;  3I1C A;  1WU1 B;  2WPL E;  3GIS X;  2DG0 A;  1V3X B;  2GVX A;  4JZE L;  3N8Y B;  1CCV A;  3KYA A;  5JW1 A;  3N8Y A;  1IQN L;  3KK6 A;  3ENS A;  3BT1 A;  1EQG A;  3Q7D A;  1J9C L;  1KSN B;  2K2S B;  4HHO A;  1ATD A;  4BDW A;  3E5Z A;  1XFE A;  2VVC K;  5JBC E;  3HPT A;  2RNL A;  1HZ8 A;  3V64 C;  2RHP A;  5L30 L;  4HW6 A;  2VJ3 A;  5FDQ A;  2J4I B;  5JBA E;  2VWN L;  4ZXX L;  4XL1 A;  1UZJ A;  2WPK E;  4ISH L;  2V91 A;  1CCF A;  2G00 L;  1Q4G A;  3HO3 A;  2P28 B;  4BXW A;  2IAO A;  3F6U L;  1MQ5 L;  3N8W B;  2ISM A;  5CKM A;  1G1R A;  3LC3 B;  3N8V A;  3N8W A;  2PUQ L;  3HO4 A;  1LMJ A;  1DVA L;  1W8B L;  5KIR A;  5GTQ A;  4XLW A;  1V04 A;  1FSB A;  1NFU B;  2WPH E;  4CUF A;  2IVZ A;  1E1A A;  4GNC A;  2IAR A;  1RWL A;  1IGZ A;  3IIT B;  4AQT A;  4CSY A;  3G4H A;  2P3F L;  3A9G A;  2P4O A;  1APO A;  2OJH A;  1EPJ A;  2EI6 B;  3HS6 A;  2W8B B;  3AMR A;  3SRE A;  2BOK L;  2W8B A;  4LMF A;  2Y5H L;  1LPG A;  1PFX L;  1PXX A;  2WYG B;  3DAS A;  4JYV L;  1IQF L;  4JYU L;  1FE2 A;  3BPS E;  3SOV A;  4IMB A;  2MGR A;  1IJQ A;  2YGP A;  1IGX A;  2WFT A;  4NG9 L;  2VAQ A;  1TOZ A;  1TLE A;  4GN9 A;  3O4P A;  4LOR A;  2FP9 A;  1CRZ A;  1RFN B;  1IVO C;  1PRH A;  2P95 L;  3MQE A;  2XBV L;  2Y7Z B;  2G8S A;  1HX2 A;  3MDL A;  2FLG A;  4Z6A L;  1HCG B;  3FW0 A;  1XDT R;  1NQL B;  2J94 B;  1M1X B;  4GNA A;  2Q1J B;  2IAS A;  5COX A;  2GHS A;  1IQK L;  1DIY A;  3HS5 A;  4BTT A;  6COX A;  2MHP A;  1HT8 A;  2XBX L;  2FPC A;  3V1S A;  3LC5 B;  4BTU A;  5CKQ A;  4X8V L;  2GVV A;  3TC9 A;  2J2U B;  2KNI A;  3POY A;  3S8Z A;  2RA0 L;  3HLH A;  3C9A C;  2WZP P;  1HRE A;  2DDU A;  2GD4 A;  2KB9 A;  5K0H B;  3LI4 A;  3KQC L;  3ZYI B;  1ATE A;  4O02 B;  2W86 A;  1EPI A;  3LAQ A;  1C5K A;  1HT5 A;  1LPZ A;  1CVM A;  2VVV L;  3S6X A;  3HRP A;  3F1S B;  4TGF A;  3SOQ A;  2W2P E;  3SW2 A;  1KLI L;  3EGF A;  2BOX A;  3TGF A;  3LI5 A;  3KL6 B;  2Y7X B;  1IQJ L;  2XC0 L;  4G1M B;  1CVU A;  2BQ6 A;  2WG3 C;  3WWA A;  1CEJ A;  4XBM A;  3FVZ A;  2IAT A;  1N1I A;  3KRK A;  3QMO A;  2FP8 A;  3P5B L;  4RRY A;  1WHF A;  2P3U A;  4JZD L;  2D1J B;  4RS0 A;  4A7I A;  2H9E L;  2W2N E;  3A9H A;  2EI7 B;  4GNB A;  4MMY B;  2VH6 B;  3AMS A;  2XBY L;  3S94 A;  3U7U G;  2K2T A;  3S8V A;  5CIS A;  2J38 B;  3NTG A;  4PH9 A;  1NFX B;  1UZK A;  5GX2 A;  3NJP C;  1FFM A;  1JL9 A;  3BT2 A;  3R05 A;  4Q1U A;  4MMX B;  4JML A;  2F9B L;  2PHB B;  1L3Y A;  2P93 L;  3TZI A;  2Y5F L;  4ZXY L;  1QLG A;  3LI3 A;  2TGF A;  4E1G A;  5JBB E;  4NA9 L;  2KL7 A;  2W3K B;  3ZYG A;  2VVU L;  5KN5 C;  1UZP A;  1IQE L;  1KLJ L;  3LN1 A;  1H6L A;  3CFW A;  1W7X L;  3HS7 A;  3NTB A;  2HQS A;  3ELA L;  1X7A L;  1F0S B;  1ATB A;  2PR3 B;  3QH0 A;  4D0E A;  1POO A;  4ZLR A;  3TH3 L;  5D9D A;  2POO A;  4O5S A;  1YGC L;  1IP0 A;  2W26 B;  3U0S A;  1KIG L;  2WPJ E;  3KCG L;  1EPH A;  3LIW B;  2IAW A;  4YZU B;  1YUK B;  2WFX B;  3K9X A;  2FLB L;  1HAF A;  1F7E A;  1RWI A;  1G1T A;  1ADX A;  1EAI C;  2P26 A;  3N8X A;  1URK A;  3KQE L;  3FBY A;  1FJS L;  3LTF B;  1SZB A;  1G2M B;  1NZI A;  2Y80 B;  4OTJ A;  1TPG A;  1FAK L;  5F1A A;  3M36 L;  1ZAQ A;  5FWW A;  4C16 A;  4BDX A;  4X8S L;  3FFG L;  1EMN A;  1XKA L;  3OLU A;  4O1Z A;  3LTG D;  3Q6T A;  5IKT A;  4GN8 A;  1IQL L;  2GVU A;  1OB1 C;  2BOH A;  1HJ7 A;  1NFW B;  3IJE B;  1JV2 B;  3V65 B;  2BMG A;  1UZQ A;  3DEM A;  2VWM K;  2WPI E;  1YO8 A;  3U73 A;  2BO2 A;  2J95 B;  2BZ6 L;  2Y5G L;  4X8T L;  1CX2 A;  1AUT L;  1G1Q A;  2OYU P;  2W2Q E;  2UWP B;  2W3I B;  4D90 A;  1LMM A;  2BOU A;  1Q7F A;  3Q6P A;  2XBW L;  3HO5 A;  1MQ6 L;  4A0P A;  3HLI A;  4ZHA B;  1A3P A;  4HHQ A;  1FF7 A;  3TBD A;  1LQD A;  4BXS A;  2FLR L;  5JB8 E;  1QFK L;  4Z0K B;  3TK5 B;  1Z6E L;  2VWL L;  2W2M E;  2JKH L;  5GX4 A;  5EGM B;  3M37 L;  1B9W A;  2UWO B;  1COU A;  2KV4 A;  5IKV A;  1Z6C A;  1F0R B;  1C5M F;  3ASI A;  2IAP A;  3GCX E;  1I0U A;  1EBV A;  2IAU A;  2P3F N;  5JVZ A;  4ISI L;  2YGO A;  1IOE L;  3KQD L;  3H5C B;  3Q3K B;  1ATA A;  1P9J A;  4RRW A;  3IAX A;  3DR2 A;  1IQG L;  5CKN A;  4O5T A;  4NGA L;  4ZAE B;  4D0F A;  2WG4 B;  4R40 A;  2I9B A;  5EX7 A;  2BQW A;  1KLO A;  2OYE P;  5GX1 A;  4GN7 A;  2B7D L;  4RRZ A;  1CQ1 A;  2XC5 L;  4Y71 B;  5I46 L;  1HAE A;  4Y76 B;  3G4E A;  3RR3 A;  5JVY A;  2FZZ L;  3PGH A;  1HRF A;  5IKR A;  2M74 A;  2ADX A;  2GVW A;  3OLT A;  1N7D A;  4M10 A;  1FAX L;  1P0S L;  2VWO L;  5D9C A;  3S2K A;  2WPM E;  2P16 L;  1U67 A;  5IKQ A;  2DSO A;  4JZF L;  4Z0L A;  1EZQ B;  2P94 L;  2IAV A;  5L2Z L;  1XKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...