1IJQA

Crystal structure of the ldl receptor ywtd-egf domain pair
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
316
structure length
308
Chain Sequence
IAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Implications for familial hypercholesterolemia from the structure of the LDL receptor YWTD-EGF domain pair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
total genus 74
structure length 308
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1ijqA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 1ijqA01
2K2SB 2Y7XB 1C5MF 3BPSE 3LTFB 3BYCA 1HREA 4RS0A 1NFXB 1Z6EL 5GX4A 3K9XA 1CVUA 1P0SL 5CKNA 1L5GB 2OYUP 2GVVA 2XC4L 1IVOC 3LAQA 1FFMA 4LMFA 3Q6KA 3N8YA 1EZQB 1DX5I 2XBVL 3IJEB 4CUEA 2VH0B 4GNCA 3LN0A 1XKAL 1NPEA 3GCWE 2Y82B 5IKTA 4X8VL 2VVCK 2BOXA 4ZXXL 4C16A 2WPIE 1Q7FA 3LIWB 3KQCL 1G2MB 4PH9A 1PRHA 4GNBA 3M36L 2WPJE 3SOBB 1EQGA 1APOA 2IAPA 1IQEL 1O5DL 1HRFA 2I9AA 2KV4A 1P9JA 1CCVA 5IKRA 1J9CL 2WYGB 1F7MA 2BOHA 3TGFA 1WHEA 3QH0A 3KQDL 3OLTA 2Y5GL 2J34B 3RR3A 4BTTA 1I0UA 1HT8A 3LC5B 2IAQA 1EQHA 1IP0A 2GVWA 2BQWA 4PWZA 1EMOA 4AQTA 4XLWA 1FAKL 3S2KA 3LN1A 1WU1B 2CJIB 4GNAA 5JVYA 1COUA 3KQBL 3N8ZA 4G1MB 1ZAQA 2W2QE 2WPLE 4IMBA 3KL6B 3F6UL 4NGAL 3CENL 2BOUA 1JBUL 5L2ZL 3POYA 3A9GA 3PGHA 3SRGA 1IGZA 3A9HA 5FWWA 1YUKB 3WWAA 2W2OE 3FBYA 1IQFL 3Q3KB 4O5TA 3TK5B 2ADXA 1NFUB 3V1SA 3BT2A 1M1XB 3EGFA 2P95L 5JB9E 3Q6PA 2Y5FL 5GX5A 4IYGA 2WG3C 1LPKA 1NZIA 1KLOA 2M74A 4XL1A 2IARA 2Y5HL 4JZFL 3SREA 2UWLB 4CSYA 2Y81B 2GHSA 2FLRL 4JZEL 1Q4GA 1YGCL 4X8TL 1X7AL 1IQJL 3LI4A 4GN9A 4ZLRA 1FE2A 3OLUA 5D9DA 2G00L 1HAEA 5IKQA 1YUGA 2FP8A 3O4PA 1ATEA 1JL9A 1ATAA 2XBXL 2WPME 3FW0A 3ZYIB 2Q1JB 4O5SA 3N8VA 1MQ6L 3S8VA 2FLGA 4Z0KB 3SOVA 2DG0A 5D9BA 4BXWA 1QFKL 2W8BA 3S94A 3FFGL 4HHQA 2MHPA 2UWOB 1IQHL 3ASIA 1LPZA 2VVVL 1V3XB 5CKQA 2F9BL 3G4EA 1HZ8A 4A0PA 4ZXYL 1RFNB 2BQ6A 2J4IB 1FSBA 2FP9A 3N8YB 2GVXA 1KLIL 1W8BL 1WHFA 4BTIA 3LC3B 4Y79B 4O02B 1NQLB 3HO4A 4BXSA 1EBVA 4MMYB 3C9AC 1TLEA 2POOA 1PTHA 5JW1A 2AYLA 1CQEA 1UZPA 3DASA 2EI8B 1EPIA 4LORA 3S8ZA 2I9BA 2P3FN 2XBWL 4A7IA 5GX1A 1XFEA 4X8UL 4Q1UA 3V64C 3ZYGA 3HLIA 4RRXA 3HS5A 1GK5A 4NG9L 4HHOA 1CRUA 2IAUA 3ENSA 5K0HB 1HT5A 3DEMA 4Z0LA 4OTYA 2NPRA 1CVMA 3GISX 3P5BL 1LQDA 2BZ6L 2BMGA 3LI3A 2P93L 1CCFA 1NFWB 1UZQA 3H5CB 1FF7A 3NJPC 4RUTA 4FM5A 2VAQA 2GD4A 4ZHAB 3HS6A 1IOXA 3QCWA 2JKHL 2QE8A 5GX3A 2W3IB 4GN7A 2BQ7A 1F0SB 1MOXC 2FD6A 1IQKL 2J95B 3CS7L 3NTGA 3IAXA 1IJQA 2VH6B 4DG6A 5L30L 1TOZA 2MGPA 1G1RA 1YO8A 3G4HA 1RWLA 1L3YA 2W26B 1EPJA 1A3PA 2IVZA 5D9CA 2P28B 1XDTR 2PR3B 1PJXA 2W86A 3HO3A 1POOA 2W2PE 2DSOA 2ISMA 2W8BB 2G8SA 2V91A 1CQ1A 3HO5A 1PGEA 2WYJB 4JMLA 5EX7A 3KCGL 4CUDA 3TC9A 1NT0A 2KL7A 3LTGD 3SW2A 2P16L 4GN8A 2VWMK 1PXXA 1URKA 1U8CB 2RNLA 2XC5L 2P3UA 2P3TA 3ZYJB 3HPTA 1DDXA 1HJ7A 1KIGL 1UZJA 1NPEB 2HQSA 1BF9A 2IATA 5L2YL 4RRWA 2FPBA 4HW6A 3GCXE 4MMZB 3V65B 2EI6B 1MQ5L 1K37A 2WPKE 3M37L 2J2UB 4ZAEB 1IQIL 1FJSL 4Z6AL 1EPHA 3TZIA 3KYAA 4Y7AB 3AMSA 1IQNL 2W2NE 3SOQA 5CISA 2J94B 2P94L 3E5ZA 4ISHL 4M11A 3CA7A 3I1CA 4BDXA 2IAWA 1OB1C 1DQBA 1C9UA 2EI7B 5COXA 2P26A 4NA9L 2VWNL 2IAVA 1IQML 3DR2A 1N1IA 3HRPA 2Y38A 5E8DA 1EMNA 1Z6CA 2Y7ZB 1C5KA 4MMXB 2YGOA 1G2LB 1V04A 4COXA 1XKBA 4Y7BB 5JBAE 4RRZA 2H9EL 4X8SL 5JBCE 1JV2B 1HCGB 1H6LA 2WPHE 1K36A 1F7EA 3KQEL 4YT6L 1G1SA 5KN5C 2FZZL 1DIYA 2XBYL 4OTJA 2OYEP 3ELAL 1QLGA 3U0SA 2W2ME 3U7UG 2YGPA 1ATBA 3LI5A 2VWOL 3MQEA 4D0FA 1EGFA 1EAIC 1CRZA 2WFTA 3IITB 2TGFA 2FPCA 4CUFA 5GX2A 5FDQA 3N8WB 1ATDA 2BOKL 4Y71B 4O1ZA 1B9WA 5JB8E 3AMRA 2PHBB 4JYUL 2IAOA 1RWIA 1FAXL 1LPGA 4TGFA 1G1TA 2DDUA 4Y76B 5I46L 4RRYA 2IAXA 3Q7DA 1TPGA 2WFXB 2Y80B 1CX2A 3U73A 4YZUB 1LMJA 1KLJL 5JVZA 3KK6A 1SZBA 1ADXA 3WW9A 1G1QA 2MGRA 2BO2A 1IOEL 1APQA 2P4OA 3BT1A 2P3FL 2XC0L 3MDLA 1IGXA 1IQLL 2W3KB 3FCSB 4XBMA 4E1GA 1U67A 4YT7L 5F19A 3N8WA 3TBDA 2K2TA 2J38B 5JBBE 1YUFA 4ZH8B 2GVUA 1CEJA 3CFWA 2D1JB 2VJ3A 2RA0L 5CKMA 6COXA 1W7XL 2PUQL 3R05A 3HLHA 3KGGA 2VVUL 1E1AA 2FLBL 1KSNB 1EPGA 4JYVL 4R40A 4D0EA 1QBIA 4M10A 4JZDL 3NT1A 4BDWA 3TH3L 3FVZA 1PFXL 2KB9A 5GTQA 1IQGL 4BTUA 1CVWL 1HAFA 1AUTL 2OJHA 3N8XA 5KIRA 3KRKA 2UWPB 3HS7A 4ISIL 2IASA 1HX2A 3Q6TA 1UZKA 3TK6B 3QMOA 2DG1A 2RHPA 2VWLL 3NTBA 1F0RB 2B7DL 5F1AA 4D90A 1N7DA 4Y6DB 2WG4B 1DVAL 1NFYB 5IKVA 3F1SB 5EGMB
chains in the Genus database with same CATH superfamily
2K2SB 2Y7XB 1C5MF 3BPSE 4X47A 3LTFB 1KITA 3BYCA 1HREA 2VVZA 2QWAA 1N1SA 4RS0A 4GZOA 1NFXB 1A14N 1Z6EL 5GX4A 1S1DA 3SALA 1XOEA 3K9XA 1NSCA 3ALXA 5FNQA 1CVUA 1P0SL 4GZXA 4MWXA 5CKNA 2SLIA 2X9MA 4XJWA 1SLLA 1Z4YA 1NMCA 1L5GB 2HTVA 2OYUP 2GVVA 2XC4L 1EUSA 1MWEA 4DGRA 1IVOC 3LAQA 1FFMA 4LMFA 1NMBN 1MS0A 3Q6KA 3N8YA 3NN9A 4YZ2A 1EZQB 4GU3A 1V2IA 2F11A 4QN3A 1INVA 1DX5I 2XBVL 3IJEB 4CUEA 1F8DA 4QNPA 2VH0B 1N6EA 4GNCA 2BF6A 4CPNA 3LN0A 1XKAL 4YZ3A 1NPEA 3GCWE 2Y82B 3TIBA 5IKTA 2ZB5A 4X8VL 2VVCK 2BOXA 4ZXXL 5M1ZA 4C16A 2WPIE 1Q7FA 3LIWB 3KQCL 1G2MB 4PH9A 3GVJA 1K32A 1PRHA 4GNBA 3M36L 2WPJE 3SOBB 1EQGA 1APOA 1L7GA 2IAPA 5F9TA 1IQEL 4GZQA 5NN9A 1O5DL 1HRFA 2I9AA 4B7JA 2KV4A 1P9JA 1CCVA 5IKRA 1J9CL 2QWDA 3ZGDA 4FPCA 5HUNA 2WYGB 1E8UA 1F7MA 2BZDA 4GEZA 3NSSA 1EURA 2BOHA 3TGFA 1WHEA 3QH0A 4I00A 2BT7A 3KQDL 4SLIA 1KKEA 2F24A 4D52C 1F8CA 3OLTA 3TIAA 1Z4WA 1MZ5A 2Y5GL 5HUKA 2J34B 3RR3A 4BTTA 1I0UA 1HT8A 3LC5B 2XZIA 2IAQA 1EQHA 1IP0A 2GVWA 2BQWA 2CMLA 4PWZA 4XIKA 1EMOA 4AQTA 4XLWA 1V0ZA 4FOWA 1FAKL 1ZI0A 1IUBA 3S2KA 3LN1A 4GDJA 2ZW9A 1WU1B 2CJIB 1MS1A 5JVYA 1INWA 4GNAA 3A72A 4XYXA 2W38A 1COUA 3KQBL 3N8ZA 4G1MB 3GVLA 5EO8A 1ZAQA 3TI4A 2W2QE 2WPLE 4ZGCA 4MWWA 4IMBA 2QWHA 2WZPP 4FZHA 3KL6B 3F6UL 4NGAL 3JU4A 4YW1A 3CENL 2BOUA 1JBUL 5L2ZL 3TI5A 3POYA 3A9GA 3CKZA 3PGHA 3SRGA 1IGZA 2HT7A 3A9HA 1EUUA 4G3NA 5FWWA 1YUKB 3WWAA 2W2OE 5FNUA 3FBYA 1IQFL 3Q3KB 4O5TA 3TK5B 2ADXA 1NFUB 3V1SA 4AGTA 4YY8A 4FJ6A 2VK5A 3BT2A 4MWVA 1M1XB 1U6DX 1SUUA 4MWJA 3EGFA 1NNBA 5FZNA 2P95L 2YA4A 5JB9E 1NSDA 3Q6PA 2Y5FL 5GX5A 2F13A 2WG3C 1LPKA 2DYHA 1NZIA 1KLOA 2M74A 4GU4A 4XL1A 2IARA 4H53A 4XJRA 3VNHA 1BJIA 2Y5HL 4JZFL 3SREA 2F29A 4FOVA 4IFLX 2UWLB 3D11A 4CSYA 2Y81B 2GHSA 4B7QA 2FLRL 4C1YA 4JZEL 2HTYA 1Q4GA 1YGCL 4X8TL 1X7AL 1IQJL 2HTUA 2W20A 2SILA 2VSKA 4KS5A 4GZSA 3LI4A 4YW4A 4FPGA 4GN9A 4ZLRA 1FE2A 2HT5A 3OLUA 5D9DA 2G00L 4WA4A 1HAEA 5IKQA 1V1HA 1YUGA 2FP8A 4K3YA 3O4PA 4HIZA 1IVFA 1ATEA 1JL9A 1ATAA 2QWJA 1ZGKA 2VSMA 2XBXL 2WPME 3FW0A 1WCSA 1Z50A 4NCSA 3ZYIB 4L7DA 2Q1JB 4O5SA 1W21A 1SLIA 4XE9A 3N8VA 1MQ6L 3S8VA 2FLGA 1V1IA 4Z0KB 2QWCA 1S0IA 4L7CA 3SOVA 4MJUA 2DG0A 5D9BA 1F8EA 4BXWA 1QFKL 2W8BA 1INXA 3S94A 3FFGL 1DILA 2MHPA 4HHQA 2UWOB 4IYGA 1IQHL 3ASIA 1LPZA 1B9VA 2HTWA 2VWDA 2VVVL 1V3XB 4FVKA 5CKQA 2F9BL 3CL2A 3G4EA 1HZ8A 5HUMA 2H9EC 4A0PA 1IVBA 1EUTA 4ZXYL 3TICA 1SO7A 2ZB6A 4FPOB 1RFNB 1MS8A 2BT8A 4A94C 4XJQA 2BQ6A 2J4IB 2AEPA 4JF7A 1FSBA 2FP9A 3N8YB 2GVXA 1KLIL 1LMMA 1W8BL 1WHFA 4AGIA 1X2JA 4BTIA 3LC3B 4Y79B 2XZKA 4O02B 1NQLB 3HO4A 4BXSA 1EBVA 2YA6A 4MMYB 4FPHA 3C9AC 1TLEA 2POOA 1QIUA 1PTHA 5JW1A 2AYLA 1CQEA 1UZPA 3DASA 4FPFA 1W1XA 2EI8B 1EPIA 4LORA 3S8ZA 2I9BA 2P3FN 2XBWL 4A7IA 3A71A 3CL0A 2F10A 1XFEA 5GX1A 4X8UL 2F28A 4Q1UA 3V64C 2VPJA 4MJVA 3ZYGA 4GZTA 3HLIA 1MZ6A 4RRXA 4N1BA 3HS5A 1GK5A 4M4VA 1Z4XA 5FNRA 4D52A 5EO7A 4NG9L 4HHOA 1CRUA 1DIMA 2IAUA 3ENSA 5K0HB 1W0OA 1HT5A 3DEMA 4Z0LA 2Z32A 3SLIA 4OTYA 2NPRA 5FNSA 1CVMA 2QWEA 3GISX 2QWKA 4K1HA 3P5BL 1LQDA 3SILA 2BZ6L 2BMGA 4GB1A 3LI3A 2P93L 1CCFA 1NFWB 1UZQA 3H5CB 1FF7A 1VCJA 3NJPC 3VNGA 5JYYA 4RUTA 4FM5A 2VAQA 2GD4A 4ZHAB 3HS6A 5HUGA 4XJZA 1IOXA 4HZZA 3QCWA 4XMBA 4XMIA 2JKHL 1IVCA 1NCCN 4YW5A 1V3CA 2QE8A 4CH9A 1A4GA 2W3IB 4GN7A 2BQ7A 1F0SB 1MOXC 5GX3A 2FD6A 1IQKL 2J95B 3CS7L 3NTGA 3IAXA 1IJQA 2VH6B 1MS3A 5FNTA 1NCAN 4DG6A 5L30L 1TOZA 4B7RA 4UOUA 2MGPA 4MWUA 1G1RA 1YO8A 3G4HA 1RWLA 1L3YA 2W26B 1MS4A 3NO0A 1EPJA 1A3PA 2IVZA 5D9CA 4MWYA 3CYEA 2P28B 1XDTR 2PR3B 1Z4VA 2H2NA 1PJXA 4ZY3A 2W86A 3HO3A 4XILA 1WCQA 2F12A 1POOA 2VW2A 2W2PE 2DSOA 2ISMA 2W8BB 3TI3A 1V3DA 2G8SA 2V91A 4QN4A 1CQ1A 3HO5A 1B9SA 1PGEA 2WYJB 4JMLA 5EX7A 3KCGL 4CUDA 2HU0A 2WOZA 3TC9A 1NSBA 1NT0A 2VK7A 2KL7A 3LTGD 3SW2A 2P16L 1VCUA 4GN8A 2AH2A 3ADEA 2VWMK 4D8SA 1PXXA 1URKA 2QWFA 4H52A 1U8CB 2YGQA 2RNLA 2XC5L 2P3UA 2P3TA 3ZYJB 3HPTA 1DDXA 1HJ7A 1KIGL 1USRA 2F0ZA 2XN4A 1UZJA 4XJ8A 3WN7A 5F72C 1NPEB 2HQSA 1L7FA 1OFZA 1BF9A 3TI6A 3K36A 2IATA 4YW3A 1INHA 5L2YL 4RRWA 2FPBA 4HW6A 3GCXE 1NNAA 4FQ4A 4MMZB 4CPLA 3V65B 2QWIA 2EI6B 1MQ5L 1K37A 2WPKE 3M37L 2J2UB 4ZAEB 4ASCA 1IQIL 6NN9A 2F26A 1V3EA 1FJSL 4Z6AL 1EPHA 3TZIA 4NN9A 2QWBA 2YDTA 4Y7AB 3KYAA 2XZJA 3AMSA 4IN4A 1IQNL 2W2NE 3SOQA 3O9KA 4MZEA 3PJQA 2A75A 1V3BA 2ZZKA 4QN5A 5CISA 7NN9A 4FPKA 2J94B 4J9TA 2P94L 3E5ZA 4ISHL 4M11A 3B7EA 3UC1A 3CA7A 1N1YA 3I1CA 4BDXA 2HU4A 2IAWA 1OB1C 3K37A 1DQBA 1C9UA 2EI7B 1INGA 5COXA 4GZPA 1NMAN 1XOGA 2P26A 4Q6KA 4NA9L 3T1EA 4B7MA 2VWNL 2IAVA 3L6VA 1IQML 3DR2A 4NC5A 1N1IA 4HZYA 3HRPA 2Y38A 5E8DA 2BERA 1EMNA 1Z6CA 2Y7ZB 2YA8A 3K3AA 1C5KA 4FPEA 4MMXB 2YGOA 4K1IA 4XHBA 1G2LB 1V04A 3WDZA 4COXA 1XKBA 2JJLA 4Y7BB 5JBAE 5H47A 4IFJA 3OPZA 4RRZA 1V0EA 3SANA 3TI8A 2RKCA 2XCYA 1IVDA 2H9EL 4B7NA 4X8SL 5JBCE 4GZWA 4FP2A 1W8OA 1JV2B 1HCGB 1H6LA 2BATA 2F25A 1NNCA 1W0PA 2WPHE 2VRSA 1K36A 1F7EA 3KQEL 4YT6L 1G1SA 1E8TA 1L7HA 5KN5C 2FZZL 1DIYA 2XBYL 4OTJA 2OYEP 3ELAL 1QLGA 4MWRA 4KS2A 4FPLA 3U0SA 2W2ME 3U7UG 2YGPA 1N6DA 2VW0A 1ATBA 4MWLA 3LI5A 2VWOL 3MQEA 4D0FA 4KS1A 1IUCA 4XOGA 3ZGCA 1EGFA 4D4UA 1EAIC 4X6KA 1CRZA 2W5NA 5HX0A 5B2DA 3D12A 4QN7A 4X49A 2WFTA 3IITB 1WP5A 2TGFA 2AEQA 4XJ9A 2FPCA 4M3MA 2BSFA 4XHXA 4CUFA 4AHAA 5GX2A 5FDQA 3N8WB 1ATDA 2BOKL 1MS5A 2HTRA 4Y71B 3ALWA 1MS9A 2B8HA 4IFNX 4YZ4A 4O1ZA 1B9WA 2FLUX 5JB8E 4GJTA 1S0JA 3AMRA 2HT8A 4CPOA 4K1JA 1NN2A 2PHBB 2C4AA 4JYUL 4MZAA 4YZ5A 2IAOA 1RWIA 2JKBA 1V0FA 1FAXL 4L7BA 4QN6A 1LPGA 1A4QA 2HOXA 4TGFA 1B9TA 4YW2A 1G1TA 2DDUA 2VW1A 4Y76B 5I46L 4RRYA 2IAXA 3Q7DA 1TPGA 1N1VA 2WFXB 2Y80B 1NCDN 4FP3A 4M4UA 1CX2A 3U73A 3S6XA 4YZUB 2YA5A 2YA7A 1LMJA 1KLJL 3H71A 1INYA 5JVZA 1W8NA 2C4LA 1INFA 3KK6A 2QWGA 1SZBA 4IQKA 2SIMA 1ADXA 3WW9A 1G1QA 3H73A 4CHBA 4FPJA 4CPZA 2MGRA 1N6FA 4WEFA 2BO2A 1USXA 5FZJA 1IOEL 1APQA 1X2RA 4FOYA 1IVGA 1LK9A 2P4OA 4CPMA 3BT1A 2P3FL 1F8BA 2AGSA 2XC0L 3MDLA 4AH4A 1IGXA 1IQLL 2YDPA 2W3KB 1Z4ZA 4XJUA 3B69A 4XMAA 3FCSB 4XBMA 4E1GA 1U67A 1W20A 3H72A 4YZ1A 4YT7L 3GVKA 4CSDA 4HZWA 2F27A 4CPYA 3INBA 5F19A 3N8WA 3TBDA 2ZWAA 1S18A 2K2TA 4MC7A 4UF7A 2J38B 5JBBE 1YUFA 2KNIA 4ZH8B 2GVUA 1CEJA 3CFWA 2D1JB 2VJ3A 4M4NA 4MX0A 2RA0L 5CKMA 6COXA 5CGJA 1W7XL 2PUQL 3R05A 3HLHA 3KGGA 2VVUL 1SNTA 1E1AA 2FLBL 1KSNB 1EPGA 4C1YB 1MR5A 4HZVA 2HTQA 3K38A 4X4AA 4MWQA 3H6JA 4JYVL 3K39A 2H2UA 4K1KA 1NCBN 2W5OA 4R40A 3W09A 2HORA 4D0EA 1QBIA 4M10A 4JZDL 3NT1A 4BDWA 3TH3L 3FVZA 1PFXL 2KB9A 5GTQA 2FHRA 1IQGL 3II7A 4BTUA 5B2CA 1CVWL 1HAFA 4XIOA 4KS4A 1N1TA 1AUTL 4XJAA 4FPYA 1IVEA 2OJHA 4GDIA 4WA5A 4WEGA 4FOQA 3N8XA 5KIRA 3KRKA 4ISIL 2UWPB 3HS7A 1E8VA 1HX2A 2IASA 1UZKA 3TK6B 3Q6TA 3QMOA 2DG1A 2RHPA 2VWLL 3NTBA 1F0RB 2B7DL 5F1AA 4D90A 4KS3A 1N7DA 4BBWA 2VK6A 3BEQA 4Y6DB 2WG4B 3O9JA 1DVAL 1NFYB 5IKVA 4WA3A 4HZXA 4D52B 3F1SB 5EGMB
chains in the Genus database with same CATH topology
2K2SB 2Y7XB 1C5MF 3BPSE 3LTFB 3BYCA 1HREA 4RS0A 1NFXB 1Z6EL 5GX4A 3K9XA 1CVUA 1P0SL 5CKNA 1L5GB 2OYUP 2GVVA 2XC4L 1IVOC 3LAQA 1FFMA 4LMFA 3Q6KA 3N8YA 1EZQB 1DX5I 2XBVL 3IJEB 4CUEA 2VH0B 4GNCA 3LN0A 1XKAL 1NPEA 3GCWE 2Y82B 5IKTA 4X8VL 2VVCK 2BOXA 4ZXXL 4C16A 2WPIE 1Q7FA 3LIWB 3KQCL 1G2MB 4PH9A 1PRHA 4GNBA 3M36L 2WPJE 3SOBB 1EQGA 1APOA 2IAPA 1IQEL 1O5DL 1HRFA 2I9AA 2KV4A 1P9JA 1CCVA 5IKRA 1J9CL 2WYGB 1F7MA 2BOHA 3TGFA 1WHEA 3QH0A 3KQDL 3OLTA 2Y5GL 2J34B 3RR3A 4BTTA 1I0UA 1HT8A 3LC5B 2IAQA 1EQHA 1IP0A 2GVWA 2BQWA 4PWZA 1EMOA 4AQTA 4XLWA 1FAKL 3S2KA 3LN1A 1WU1B 2CJIB 4GNAA 5JVYA 1COUA 3KQBL 3N8ZA 4G1MB 1ZAQA 2W2QE 2WPLE 4IMBA 2WZPP 3KL6B 3F6UL 4NGAL 3CENL 2BOUA 1JBUL 5L2ZL 3POYA 3A9GA 3PGHA 3SRGA 1IGZA 3A9HA 5FWWA 1YUKB 3WWAA 2W2OE 3FBYA 1IQFL 3Q3KB 4O5TA 3TK5B 2ADXA 1NFUB 3V1SA 3BT2A 1M1XB 3EGFA 2P95L 5JB9E 3Q6PA 2Y5FL 5GX5A 4IYGA 2WG3C 1LPKA 1NZIA 1KLOA 2M74A 4XL1A 2IARA 2Y5HL 4JZFL 3SREA 2UWLB 4CSYA 2Y81B 2GHSA 2FLRL 4JZEL 1Q4GA 1YGCL 4X8TL 1X7AL 1IQJL 3LI4A 4GN9A 4ZLRA 1FE2A 3OLUA 5D9DA 2G00L 1HAEA 5IKQA 1YUGA 2FP8A 3O4PA 1ATEA 1JL9A 1ATAA 2XBXL 2WPME 3FW0A 3ZYIB 2Q1JB 4O5SA 3N8VA 1MQ6L 3S8VA 2FLGA 4Z0KB 3SOVA 2DG0A 5D9BA 4BXWA 1QFKL 2W8BA 3S94A 3FFGL 4HHQA 2MHPA 2UWOB 1IQHL 3ASIA 1LPZA 2VVVL 1V3XB 5CKQA 2F9BL 3G4EA 1HZ8A 4A0PA 2H9EC 4ZXYL 1RFNB 4A94C 2BQ6A 2J4IB 1FSBA 2FP9A 3N8YB 2GVXA 1KLIL 1LMMA 1W8BL 1WHFA 4BTIA 3LC3B 4Y79B 4O02B 1NQLB 3HO4A 4BXSA 1EBVA 4MMYB 3C9AC 1TLEA 2POOA 1PTHA 5JW1A 2AYLA 1CQEA 1UZPA 3DASA 2EI8B 1EPIA 4LORA 3S8ZA 2I9BA 2P3FN 2XBWL 4A7IA 5GX1A 1XFEA 4X8UL 4Q1UA 3V64C 3ZYGA 3HLIA 4RRXA 3HS5A 1GK5A 4NG9L 4HHOA 1CRUA 2IAUA 3ENSA 5K0HB 1HT5A 3DEMA 4Z0LA 4OTYA 2NPRA 1CVMA 3GISX 3P5BL 1LQDA 2BZ6L 2BMGA 3LI3A 2P93L 1CCFA 1NFWB 1UZQA 3H5CB 1FF7A 3NJPC 4RUTA 4FM5A 2VAQA 2GD4A 4ZHAB 3HS6A 1IOXA 3QCWA 2JKHL 2QE8A 5GX3A 2W3IB 4GN7A 2BQ7A 1F0SB 1MOXC 2FD6A 1IQKL 2J95B 3CS7L 3NTGA 3IAXA 1IJQA 2VH6B 4DG6A 5L30L 1TOZA 2MGPA 1G1RA 1YO8A 3G4HA 1RWLA 1L3YA 2W26B 1EPJA 1A3PA 2IVZA 5D9CA 2P28B 1XDTR 2PR3B 1PJXA 2W86A 3HO3A 1POOA 2W2PE 2DSOA 2ISMA 2W8BB 2G8SA 2V91A 1CQ1A 3HO5A 1PGEA 2WYJB 4JMLA 5EX7A 3KCGL 4CUDA 3TC9A 1NT0A 2KL7A 3LTGD 3SW2A 2P16L 4GN8A 2VWMK 1PXXA 1URKA 1U8CB 2YGQA 2RNLA 2XC5L 2P3UA 2P3TA 3ZYJB 3HPTA 1DDXA 1HJ7A 1KIGL 1UZJA 1NPEB 2HQSA 1BF9A 2IATA 5L2YL 4RRWA 2FPBA 4HW6A 3GCXE 4MMZB 3V65B 2EI6B 1MQ5L 1K37A 2WPKE 3M37L 2J2UB 4ZAEB 1IQIL 1FJSL 4Z6AL 1EPHA 3TZIA 3KYAA 4Y7AB 3AMSA 1IQNL 2W2NE 3SOQA 5CISA 2J94B 2P94L 3E5ZA 4ISHL 4M11A 3CA7A 3I1CA 4BDXA 2IAWA 1OB1C 1DQBA 1C9UA 2EI7B 5COXA 2P26A 4NA9L 2VWNL 2IAVA 1IQML 3DR2A 1N1IA 3HRPA 2Y38A 5E8DA 1EMNA 1Z6CA 2Y7ZB 1C5KA 4MMXB 2YGOA 1G2LB 1V04A 4COXA 1XKBA 4Y7BB 5JBAE 4RRZA 2H9EL 4X8SL 5JBCE 1JV2B 1HCGB 1H6LA 2WPHE 1K36A 1F7EA 3KQEL 4YT6L 1G1SA 5KN5C 2FZZL 1DIYA 2XBYL 4OTJA 2OYEP 3ELAL 1QLGA 3U0SA 2W2ME 3U7UG 2YGPA 1ATBA 3LI5A 2VWOL 3MQEA 4D0FA 1EGFA 1EAIC 1CRZA 2WFTA 3IITB 2TGFA 2FPCA 4CUFA 5GX2A 5FDQA 3N8WB 1ATDA 2BOKL 4Y71B 4O1ZA 1B9WA 5JB8E 3AMRA 2PHBB 4JYUL 2IAOA 1RWIA 1FAXL 1LPGA 4TGFA 1G1TA 2DDUA 4Y76B 5I46L 4RRYA 2IAXA 3Q7DA 1TPGA 2WFXB 2Y80B 1CX2A 3U73A 3S6XA 4YZUB 1LMJA 1KLJL 5JVZA 3KK6A 1SZBA 1ADXA 3WW9A 1G1QA 2MGRA 2BO2A 1IOEL 1APQA 2P4OA 3BT1A 2P3FL 2XC0L 3MDLA 1IGXA 1IQLL 2W3KB 3FCSB 4XBMA 4E1GA 1U67A 4YT7L 5F19A 3N8WA 3TBDA 2K2TA 2J38B 5JBBE 1YUFA 2KNIA 4ZH8B 2GVUA 1CEJA 3CFWA 2D1JB 2VJ3A 2RA0L 5CKMA 6COXA 1W7XL 2PUQL 3R05A 3HLHA 3KGGA 2VVUL 1E1AA 2FLBL 1KSNB 1EPGA 4JYVL 4R40A 4D0EA 1QBIA 4M10A 4JZDL 3NT1A 4BDWA 3TH3L 3FVZA 1PFXL 2KB9A 5GTQA 1IQGL 4BTUA 1CVWL 1HAFA 1AUTL 2OJHA 3N8XA 5KIRA 3KRKA 2UWPB 3HS7A 4ISIL 2IASA 1HX2A 3Q6TA 1UZKA 3TK6B 3QMOA 2DG1A 2RHPA 2VWLL 3NTBA 1F0RB 2B7DL 5F1AA 4D90A 1N7DA 4Y6DB 2WG4B 1DVAL 1NFYB 5IKVA 3F1SB 5EGMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2S B;  2Y7X B;  1C5M F;  3BPS E;  3LTF B;  3BYC A;  1HRE A;  4RS0 A;  1NFX B;  1Z6E L;  5GX4 A;  3K9X A;  1CVU A;  1P0S L;  5CKN A;  1L5G B;  2OYU P;  2GVV A;  2XC4 L;  1IVO C;  3LAQ A;  1FFM A;  4LMF A;  3Q6K A;  3N8Y A;  1EZQ B;  1DX5 I;  2XBV L;  3IJE B;  4CUE A;  2VH0 B;  4GNC A;  3LN0 A;  1XKA L;  1NPE A;  3GCW E;  2Y82 B;  5IKT A;  4X8V L;  2VVC K;  2BOX A;  4ZXX L;  4C16 A;  2WPI E;  1Q7F A;  3LIW B;  3KQC L;  1G2M B;  4PH9 A;  1PRH A;  4GNB A;  3M36 L;  2WPJ E;  3SOB B;  1EQG A;  1APO A;  2IAP A;  1IQE L;  1O5D L;  1HRF A;  2I9A A;  2KV4 A;  1P9J A;  1CCV A;  5IKR A;  1J9C L;  2WYG B;  1F7M A;  2BOH A;  3TGF A;  1WHE A;  3QH0 A;  3KQD L;  3OLT A;  2Y5G L;  2J34 B;  3RR3 A;  4BTT A;  1I0U A;  1HT8 A;  3LC5 B;  2IAQ A;  1EQH A;  1IP0 A;  2GVW A;  2BQW A;  4PWZ A;  1EMO A;  4AQT A;  4XLW A;  1FAK L;  3S2K A;  3LN1 A;  1WU1 B;  2CJI B;  4GNA A;  5JVY A;  1COU A;  3KQB L;  3N8Z A;  4G1M B;  1ZAQ A;  2W2Q E;  2WPL E;  4IMB A;  3KL6 B;  3F6U L;  4NGA L;  3CEN L;  2BOU A;  1JBU L;  5L2Z L;  3POY A;  3A9G A;  3PGH A;  3SRG A;  1IGZ A;  3A9H A;  5FWW A;  1YUK B;  3WWA A;  2W2O E;  3FBY A;  1IQF L;  3Q3K B;  4O5T A;  3TK5 B;  2ADX A;  1NFU B;  3V1S A;  3BT2 A;  1M1X B;  3EGF A;  2P95 L;  5JB9 E;  3Q6P A;  2Y5F L;  5GX5 A;  4IYG A;  2WG3 C;  1LPK A;  1NZI A;  1KLO A;  2M74 A;  4XL1 A;  2IAR A;  2Y5H L;  4JZF L;  3SRE A;  2UWL B;  4CSY A;  2Y81 B;  2GHS A;  2FLR L;  4JZE L;  1Q4G A;  1YGC L;  4X8T L;  1X7A L;  1IQJ L;  3LI4 A;  4GN9 A;  4ZLR A;  1FE2 A;  3OLU A;  5D9D A;  2G00 L;  1HAE A;  5IKQ A;  1YUG A;  2FP8 A;  3O4P A;  1ATE A;  1JL9 A;  1ATA A;  2XBX L;  2WPM E;  3FW0 A;  3ZYI B;  2Q1J B;  4O5S A;  3N8V A;  1MQ6 L;  3S8V A;  2FLG A;  4Z0K B;  3SOV A;  2DG0 A;  5D9B A;  4BXW A;  1QFK L;  2W8B A;  3S94 A;  3FFG L;  4HHQ A;  2MHP A;  2UWO B;  1IQH L;  3ASI A;  1LPZ A;  2VVV L;  1V3X B;  5CKQ A;  2F9B L;  3G4E A;  1HZ8 A;  4A0P A;  4ZXY L;  1RFN B;  2BQ6 A;  2J4I B;  1FSB A;  2FP9 A;  3N8Y B;  2GVX A;  1KLI L;  1W8B L;  1WHF A;  4BTI A;  3LC3 B;  4Y79 B;  4O02 B;  1NQL B;  3HO4 A;  4BXS A;  1EBV A;  4MMY B;  3C9A C;  1TLE A;  2POO A;  1PTH A;  5JW1 A;  2AYL A;  1CQE A;  1UZP A;  3DAS A;  2EI8 B;  1EPI A;  4LOR A;  3S8Z A;  2I9B A;  2P3F N;  2XBW L;  4A7I A;  5GX1 A;  1XFE A;  4X8U L;  4Q1U A;  3V64 C;  3ZYG A;  3HLI A;  4RRX A;  3HS5 A;  1GK5 A;  4NG9 L;  4HHO A;  1CRU A;  2IAU A;  3ENS A;  5K0H B;  1HT5 A;  3DEM A;  4Z0L A;  4OTY A;  2NPR A;  1CVM A;  3GIS X;  3P5B L;  1LQD A;  2BZ6 L;  2BMG A;  3LI3 A;  2P93 L;  1CCF A;  1NFW B;  1UZQ A;  3H5C B;  1FF7 A;  3NJP C;  4RUT A;  4FM5 A;  2VAQ A;  2GD4 A;  4ZHA B;  3HS6 A;  1IOX A;  3QCW A;  2JKH L;  2QE8 A;  5GX3 A;  2W3I B;  4GN7 A;  2BQ7 A;  1F0S B;  1MOX C;  2FD6 A;  1IQK L;  2J95 B;  3CS7 L;  3NTG A;  3IAX A;  1IJQ A;  2VH6 B;  4DG6 A;  5L30 L;  1TOZ A;  2MGP A;  1G1R A;  1YO8 A;  3G4H A;  1RWL A;  1L3Y A;  2W26 B;  1EPJ A;  1A3P A;  2IVZ A;  5D9C A;  2P28 B;  1XDT R;  2PR3 B;  1PJX A;  2W86 A;  3HO3 A;  1POO A;  2W2P E;  2DSO A;  2ISM A;  2W8B B;  2G8S A;  2V91 A;  1CQ1 A;  3HO5 A;  1PGE A;  2WYJ B;  4JML A;  5EX7 A;  3KCG L;  4CUD A;  3TC9 A;  1NT0 A;  2KL7 A;  3LTG D;  3SW2 A;  2P16 L;  4GN8 A;  2VWM K;  1PXX A;  1URK A;  1U8C B;  2RNL A;  2XC5 L;  2P3U A;  2P3T A;  3ZYJ B;  3HPT A;  1DDX A;  1HJ7 A;  1KIG L;  1UZJ A;  1NPE B;  2HQS A;  1BF9 A;  2IAT A;  5L2Y L;  4RRW A;  2FPB A;  4HW6 A;  3GCX E;  4MMZ B;  3V65 B;  2EI6 B;  1MQ5 L;  1K37 A;  2WPK E;  3M37 L;  2J2U B;  4ZAE B;  1IQI L;  1FJS L;  4Z6A L;  1EPH A;  3TZI A;  3KYA A;  4Y7A B;  3AMS A;  1IQN L;  2W2N E;  3SOQ A;  5CIS A;  2J94 B;  2P94 L;  3E5Z A;  4ISH L;  4M11 A;  3CA7 A;  3I1C A;  4BDX A;  2IAW A;  1OB1 C;  1DQB A;  1C9U A;  2EI7 B;  5COX A;  2P26 A;  4NA9 L;  2VWN L;  2IAV A;  1IQM L;  3DR2 A;  1N1I A;  3HRP A;  2Y38 A;  5E8D A;  1EMN A;  1Z6C A;  2Y7Z B;  1C5K A;  4MMX B;  2YGO A;  1G2L B;  1V04 A;  4COX A;  1XKB A;  4Y7B B;  5JBA E;  4RRZ A;  2H9E L;  4X8S L;  5JBC E;  1JV2 B;  1HCG B;  1H6L A;  2WPH E;  1K36 A;  1F7E A;  3KQE L;  4YT6 L;  1G1S A;  5KN5 C;  2FZZ L;  1DIY A;  2XBY L;  4OTJ A;  2OYE P;  3ELA L;  1QLG A;  3U0S A;  2W2M E;  3U7U G;  2YGP A;  1ATB A;  3LI5 A;  2VWO L;  3MQE A;  4D0F A;  1EGF A;  1EAI C;  1CRZ A;  2WFT A;  3IIT B;  2TGF A;  2FPC A;  4CUF A;  5GX2 A;  5FDQ A;  3N8W B;  1ATD A;  2BOK L;  4Y71 B;  4O1Z A;  1B9W A;  5JB8 E;  3AMR A;  2PHB B;  4JYU L;  2IAO A;  1RWI A;  1FAX L;  1LPG A;  4TGF A;  1G1T A;  2DDU A;  4Y76 B;  5I46 L;  4RRY A;  2IAX A;  3Q7D A;  1TPG A;  2WFX B;  2Y80 B;  1CX2 A;  3U73 A;  4YZU B;  1LMJ A;  1KLJ L;  5JVZ A;  3KK6 A;  1SZB A;  1ADX A;  3WW9 A;  1G1Q A;  2MGR A;  2BO2 A;  1IOE L;  1APQ A;  2P4O A;  3BT1 A;  2P3F L;  2XC0 L;  3MDL A;  1IGX A;  1IQL L;  2W3K B;  3FCS B;  4XBM A;  4E1G A;  1U67 A;  4YT7 L;  5F19 A;  3N8W A;  3TBD A;  2K2T A;  2J38 B;  5JBB E;  1YUF A;  4ZH8 B;  2GVU A;  1CEJ A;  3CFW A;  2D1J B;  2VJ3 A;  2RA0 L;  5CKM A;  6COX A;  1W7X L;  2PUQ L;  3R05 A;  3HLH A;  3KGG A;  2VVU L;  1E1A A;  2FLB L;  1KSN B;  1EPG A;  4JYV L;  4R40 A;  4D0E A;  1QBI A;  4M10 A;  4JZD L;  3NT1 A;  4BDW A;  3TH3 L;  3FVZ A;  1PFX L;  2KB9 A;  5GTQ A;  1IQG L;  4BTU A;  1CVW L;  1HAF A;  1AUT L;  2OJH A;  3N8X A;  5KIR A;  3KRK A;  2UWP B;  3HS7 A;  4ISI L;  2IAS A;  1HX2 A;  3Q6T A;  1UZK A;  3TK6 B;  3QMO A;  2DG1 A;  2RHP A;  2VWL L;  3NTB A;  1F0R B;  2B7D L;  5F1A A;  4D90 A;  1N7D A;  4Y6D B;  2WG4 B;  1DVA L;  1NFY B;  5IKV A;  3F1S B;  5EGM B; 
#chains in the Genus database with same CATH topology
 2K2S B;  2Y7X B;  1C5M F;  3BPS E;  4X47 A;  3LTF B;  1KIT A;  3BYC A;  1HRE A;  2VVZ A;  2QWA A;  1N1S A;  4RS0 A;  4GZO A;  1NFX B;  1A14 N;  1Z6E L;  5GX4 A;  1S1D A;  3SAL A;  1XOE A;  3K9X A;  1NSC A;  3ALX A;  5FNQ A;  1CVU A;  1P0S L;  4GZX A;  4MWX A;  5CKN A;  2SLI A;  2X9M A;  4XJW A;  1SLL A;  1Z4Y A;  1NMC A;  1L5G B;  2HTV A;  2OYU P;  2GVV A;  2XC4 L;  1EUS A;  1MWE A;  4DGR A;  1IVO C;  3LAQ A;  1FFM A;  4LMF A;  1NMB N;  1MS0 A;  3Q6K A;  3N8Y A;  3NN9 A;  4YZ2 A;  1EZQ B;  4GU3 A;  1V2I A;  2F11 A;  4QN3 A;  1INV A;  1DX5 I;  2XBV L;  3IJE B;  4CUE A;  1F8D A;  4QNP A;  2VH0 B;  1N6E A;  4GNC A;  2BF6 A;  4CPN A;  3LN0 A;  1XKA L;  4YZ3 A;  1NPE A;  3GCW E;  2Y82 B;  3TIB A;  5IKT A;  2ZB5 A;  4X8V L;  2VVC K;  2BOX A;  4ZXX L;  5M1Z A;  4C16 A;  2WPI E;  1Q7F A;  3LIW B;  3KQC L;  1G2M B;  4PH9 A;  3GVJ A;  1K32 A;  1PRH A;  4GNB A;  3M36 L;  2WPJ E;  3SOB B;  1EQG A;  1APO A;  1L7G A;  2IAP A;  5F9T A;  1IQE L;  4GZQ A;  5NN9 A;  1O5D L;  1HRF A;  2I9A A;  4B7J A;  2KV4 A;  1P9J A;  1CCV A;  5IKR A;  1J9C L;  2QWD A;  3ZGD A;  4FPC A;  5HUN A;  2WYG B;  1E8U A;  1F7M A;  2BZD A;  4GEZ A;  3NSS A;  1EUR A;  2BOH A;  3TGF A;  1WHE A;  3QH0 A;  4I00 A;  2BT7 A;  3KQD L;  4SLI A;  1KKE A;  2F24 A;  4D52 C;  1F8C A;  3OLT A;  3TIA A;  1Z4W A;  1MZ5 A;  2Y5G L;  5HUK A;  2J34 B;  3RR3 A;  4BTT A;  1I0U A;  1HT8 A;  3LC5 B;  2XZI A;  2IAQ A;  1EQH A;  1IP0 A;  2GVW A;  2BQW A;  2CML A;  4PWZ A;  4XIK A;  1EMO A;  4AQT A;  4XLW A;  1V0Z A;  4FOW A;  1FAK L;  1ZI0 A;  1IUB A;  3S2K A;  3LN1 A;  4GDJ A;  2ZW9 A;  1WU1 B;  2CJI B;  1MS1 A;  5JVY A;  1INW A;  4GNA A;  3A72 A;  4XYX A;  2W38 A;  1COU A;  3KQB L;  3N8Z A;  4G1M B;  3GVL A;  5EO8 A;  1ZAQ A;  3TI4 A;  2W2Q E;  2WPL E;  4ZGC A;  4MWW A;  4IMB A;  2QWH A;  2WZP P;  4FZH A;  3KL6 B;  3F6U L;  4NGA L;  3JU4 A;  4YW1 A;  3CEN L;  2BOU A;  1JBU L;  5L2Z L;  3TI5 A;  3POY A;  3A9G A;  3CKZ A;  3PGH A;  3SRG A;  1IGZ A;  2HT7 A;  3A9H A;  1EUU A;  4G3N A;  5FWW A;  1YUK B;  3WWA A;  2W2O E;  5FNU A;  3FBY A;  1IQF L;  3Q3K B;  4O5T A;  3TK5 B;  2ADX A;  1NFU B;  3V1S A;  4AGT A;  4YY8 A;  4FJ6 A;  2VK5 A;  3BT2 A;  4MWV A;  1M1X B;  1U6D X;  1SUU A;  4MWJ A;  3EGF A;  1NNB A;  5FZN A;  2P95 L;  2YA4 A;  5JB9 E;  1NSD A;  3Q6P A;  2Y5F L;  5GX5 A;  2F13 A;  2WG3 C;  1LPK A;  2DYH A;  1NZI A;  1KLO A;  2M74 A;  4GU4 A;  4XL1 A;  2IAR A;  4H53 A;  4XJR A;  3VNH A;  1BJI A;  2Y5H L;  4JZF L;  3SRE A;  2F29 A;  4FOV A;  4IFL X;  2UWL B;  3D11 A;  4CSY A;  2Y81 B;  2GHS A;  4B7Q A;  2FLR L;  4C1Y A;  4JZE L;  2HTY A;  1Q4G A;  1YGC L;  4X8T L;  1X7A L;  1IQJ L;  2HTU A;  2W20 A;  2SIL A;  2VSK A;  4KS5 A;  4GZS A;  3LI4 A;  4YW4 A;  4FPG A;  4GN9 A;  4ZLR A;  1FE2 A;  2HT5 A;  3OLU A;  5D9D A;  2G00 L;  4WA4 A;  1HAE A;  5IKQ A;  1V1H A;  1YUG A;  2FP8 A;  4K3Y A;  3O4P A;  4HIZ A;  1IVF A;  1ATE A;  1JL9 A;  1ATA A;  2QWJ A;  1ZGK A;  2VSM A;  2XBX L;  2WPM E;  3FW0 A;  1WCS A;  1Z50 A;  4NCS A;  3ZYI B;  4L7D A;  2Q1J B;  4O5S A;  1W21 A;  1SLI A;  4XE9 A;  3N8V A;  1MQ6 L;  3S8V A;  2FLG A;  1V1I A;  4Z0K B;  2QWC A;  1S0I A;  4L7C A;  3SOV A;  4MJU A;  2DG0 A;  5D9B A;  1F8E A;  4BXW A;  1QFK L;  2W8B A;  1INX A;  3S94 A;  3FFG L;  1DIL A;  2MHP A;  4HHQ A;  2UWO B;  4IYG A;  1IQH L;  3ASI A;  1LPZ A;  1B9V A;  2HTW A;  2VWD A;  2VVV L;  1V3X B;  4FVK A;  5CKQ A;  2F9B L;  3CL2 A;  3G4E A;  1HZ8 A;  5HUM A;  2H9E C;  4A0P A;  1IVB A;  1EUT A;  4ZXY L;  3TIC A;  1SO7 A;  2ZB6 A;  4FPO B;  1RFN B;  1MS8 A;  2BT8 A;  4A94 C;  4XJQ A;  2BQ6 A;  2J4I B;  2AEP A;  4JF7 A;  1FSB A;  2FP9 A;  3N8Y B;  2GVX A;  1KLI L;  1LMM A;  1W8B L;  1WHF A;  4AGI A;  1X2J A;  4BTI A;  3LC3 B;  4Y79 B;  2XZK A;  4O02 B;  1NQL B;  3HO4 A;  4BXS A;  1EBV A;  2YA6 A;  4MMY B;  4FPH A;  3C9A C;  1TLE A;  2POO A;  1QIU A;  1PTH A;  5JW1 A;  2AYL A;  1CQE A;  1UZP A;  3DAS A;  4FPF A;  1W1X A;  2EI8 B;  1EPI A;  4LOR A;  3S8Z A;  2I9B A;  2P3F N;  2XBW L;  4A7I A;  3A71 A;  3CL0 A;  2F10 A;  1XFE A;  5GX1 A;  4X8U L;  2F28 A;  4Q1U A;  3V64 C;  2VPJ A;  4MJV A;  3ZYG A;  4GZT A;  3HLI A;  1MZ6 A;  4RRX A;  4N1B A;  3HS5 A;  1GK5 A;  4M4V A;  1Z4X A;  5FNR A;  4D52 A;  5EO7 A;  4NG9 L;  4HHO A;  1CRU A;  1DIM A;  2IAU A;  3ENS A;  5K0H B;  1W0O A;  1HT5 A;  3DEM A;  4Z0L A;  2Z32 A;  3SLI A;  4OTY A;  2NPR A;  5FNS A;  1CVM A;  2QWE A;  3GIS X;  2QWK A;  4K1H A;  3P5B L;  1LQD A;  3SIL A;  2BZ6 L;  2BMG A;  4GB1 A;  3LI3 A;  2P93 L;  1CCF A;  1NFW B;  1UZQ A;  3H5C B;  1FF7 A;  1VCJ A;  3NJP C;  3VNG A;  5JYY A;  4RUT A;  4FM5 A;  2VAQ A;  2GD4 A;  4ZHA B;  3HS6 A;  5HUG A;  4XJZ A;  1IOX A;  4HZZ A;  3QCW A;  4XMB A;  4XMI A;  2JKH L;  1IVC A;  1NCC N;  4YW5 A;  1V3C A;  2QE8 A;  4CH9 A;  1A4G A;  2W3I B;  4GN7 A;  2BQ7 A;  1F0S B;  1MOX C;  5GX3 A;  2FD6 A;  1IQK L;  2J95 B;  3CS7 L;  3NTG A;  3IAX A;  1IJQ A;  2VH6 B;  1MS3 A;  5FNT A;  1NCA N;  4DG6 A;  5L30 L;  1TOZ A;  4B7R A;  4UOU A;  2MGP A;  4MWU A;  1G1R A;  1YO8 A;  3G4H A;  1RWL A;  1L3Y A;  2W26 B;  1MS4 A;  3NO0 A;  1EPJ A;  1A3P A;  2IVZ A;  5D9C A;  4MWY A;  3CYE A;  2P28 B;  1XDT R;  2PR3 B;  1Z4V A;  2H2N A;  1PJX A;  4ZY3 A;  2W86 A;  3HO3 A;  4XIL A;  1WCQ A;  2F12 A;  1POO A;  2VW2 A;  2W2P E;  2DSO A;  2ISM A;  2W8B B;  3TI3 A;  1V3D A;  2G8S A;  2V91 A;  4QN4 A;  1CQ1 A;  3HO5 A;  1B9S A;  1PGE A;  2WYJ B;  4JML A;  5EX7 A;  3KCG L;  4CUD A;  2HU0 A;  2WOZ A;  3TC9 A;  1NSB A;  1NT0 A;  2VK7 A;  2KL7 A;  3LTG D;  3SW2 A;  2P16 L;  1VCU A;  4GN8 A;  2AH2 A;  3ADE A;  2VWM K;  4D8S A;  1PXX A;  1URK A;  2QWF A;  4H52 A;  1U8C B;  2YGQ A;  2RNL A;  2XC5 L;  2P3U A;  2P3T A;  3ZYJ B;  3HPT A;  1DDX A;  1HJ7 A;  1KIG L;  1USR A;  2F0Z A;  2XN4 A;  1UZJ A;  4XJ8 A;  3WN7 A;  5F72 C;  1NPE B;  2HQS A;  1L7F A;  1OFZ A;  1BF9 A;  3TI6 A;  3K36 A;  2IAT A;  4YW3 A;  1INH A;  5L2Y L;  4RRW A;  2FPB A;  4HW6 A;  3GCX E;  1NNA A;  4FQ4 A;  4MMZ B;  4CPL A;  3V65 B;  2QWI A;  2EI6 B;  1MQ5 L;  1K37 A;  2WPK E;  3M37 L;  2J2U B;  4ZAE B;  4ASC A;  1IQI L;  6NN9 A;  2F26 A;  1V3E A;  1FJS L;  4Z6A L;  1EPH A;  3TZI A;  4NN9 A;  2QWB A;  2YDT A;  4Y7A B;  3KYA A;  2XZJ A;  3AMS A;  4IN4 A;  1IQN L;  2W2N E;  3SOQ A;  3O9K A;  4MZE A;  3PJQ A;  2A75 A;  1V3B A;  2ZZK A;  4QN5 A;  5CIS A;  7NN9 A;  4FPK A;  2J94 B;  4J9T A;  2P94 L;  3E5Z A;  4ISH L;  4M11 A;  3B7E A;  3UC1 A;  3CA7 A;  1N1Y A;  3I1C A;  4BDX A;  2HU4 A;  2IAW A;  1OB1 C;  3K37 A;  1DQB A;  1C9U A;  2EI7 B;  1ING A;  5COX A;  4GZP A;  1NMA N;  1XOG A;  2P26 A;  4Q6K A;  4NA9 L;  3T1E A;  4B7M A;  2VWN L;  2IAV A;  3L6V A;  1IQM L;  3DR2 A;  4NC5 A;  1N1I A;  4HZY A;  3HRP A;  2Y38 A;  5E8D A;  2BER A;  1EMN A;  1Z6C A;  2Y7Z B;  2YA8 A;  3K3A A;  1C5K A;  4FPE A;  4MMX B;  2YGO A;  4K1I A;  4XHB A;  1G2L B;  1V04 A;  3WDZ A;  4COX A;  1XKB A;  2JJL A;  4Y7B B;  5JBA E;  5H47 A;  4IFJ A;  3OPZ A;  4RRZ A;  1V0E A;  3SAN A;  3TI8 A;  2RKC A;  2XCY A;  1IVD A;  2H9E L;  4B7N A;  4X8S L;  5JBC E;  4GZW A;  4FP2 A;  1W8O A;  1JV2 B;  1HCG B;  1H6L A;  2BAT A;  2F25 A;  1NNC A;  1W0P A;  2WPH E;  2VRS A;  1K36 A;  1F7E A;  3KQE L;  4YT6 L;  1G1S A;  1E8T A;  1L7H A;  5KN5 C;  2FZZ L;  1DIY A;  2XBY L;  4OTJ A;  2OYE P;  3ELA L;  1QLG A;  4MWR A;  4KS2 A;  4FPL A;  3U0S A;  2W2M E;  3U7U G;  2YGP A;  1N6D A;  2VW0 A;  1ATB A;  4MWL A;  3LI5 A;  2VWO L;  3MQE A;  4D0F A;  4KS1 A;  1IUC A;  4XOG A;  3ZGC A;  1EGF A;  4D4U A;  1EAI C;  4X6K A;  1CRZ A;  2W5N A;  5HX0 A;  5B2D A;  3D12 A;  4QN7 A;  4X49 A;  2WFT A;  3IIT B;  1WP5 A;  2TGF A;  2AEQ A;  4XJ9 A;  2FPC A;  4M3M A;  2BSF A;  4XHX A;  4CUF A;  4AHA A;  5GX2 A;  5FDQ A;  3N8W B;  1ATD A;  2BOK L;  1MS5 A;  2HTR A;  4Y71 B;  3ALW A;  1MS9 A;  2B8H A;  4IFN X;  4YZ4 A;  4O1Z A;  1B9W A;  2FLU X;  5JB8 E;  4GJT A;  1S0J A;  3AMR A;  2HT8 A;  4CPO A;  4K1J A;  1NN2 A;  2PHB B;  2C4A A;  4JYU L;  4MZA A;  4YZ5 A;  2IAO A;  1RWI A;  2JKB A;  1V0F A;  1FAX L;  4L7B A;  4QN6 A;  1LPG A;  1A4Q A;  2HOX A;  4TGF A;  1B9T A;  4YW2 A;  1G1T A;  2DDU A;  2VW1 A;  4Y76 B;  5I46 L;  4RRY A;  2IAX A;  3Q7D A;  1TPG A;  1N1V A;  2WFX B;  2Y80 B;  1NCD N;  4FP3 A;  4M4U A;  1CX2 A;  3U73 A;  3S6X A;  4YZU B;  2YA5 A;  2YA7 A;  1LMJ A;  1KLJ L;  3H71 A;  1INY A;  5JVZ A;  1W8N A;  2C4L A;  1INF A;  3KK6 A;  2QWG A;  1SZB A;  4IQK A;  2SIM A;  1ADX A;  3WW9 A;  1G1Q A;  3H73 A;  4CHB A;  4FPJ A;  4CPZ A;  2MGR A;  1N6F A;  4WEF A;  2BO2 A;  1USX A;  5FZJ A;  1IOE L;  1APQ A;  1X2R A;  4FOY A;  1IVG A;  1LK9 A;  2P4O A;  4CPM A;  3BT1 A;  2P3F L;  1F8B A;  2AGS A;  2XC0 L;  3MDL A;  4AH4 A;  1IGX A;  1IQL L;  2YDP A;  2W3K B;  1Z4Z A;  4XJU A;  3B69 A;  4XMA A;  3FCS B;  4XBM A;  4E1G A;  1U67 A;  1W20 A;  3H72 A;  4YZ1 A;  4YT7 L;  3GVK A;  4CSD A;  4HZW A;  2F27 A;  4CPY A;  3INB A;  5F19 A;  3N8W A;  3TBD A;  2ZWA A;  1S18 A;  2K2T A;  4MC7 A;  4UF7 A;  2J38 B;  5JBB E;  1YUF A;  2KNI A;  4ZH8 B;  2GVU A;  1CEJ A;  3CFW A;  2D1J B;  2VJ3 A;  4M4N A;  4MX0 A;  2RA0 L;  5CKM A;  6COX A;  5CGJ A;  1W7X L;  2PUQ L;  3R05 A;  3HLH A;  3KGG A;  2VVU L;  1SNT A;  1E1A A;  2FLB L;  1KSN B;  1EPG A;  4C1Y B;  1MR5 A;  4HZV A;  2HTQ A;  3K38 A;  4X4A A;  4MWQ A;  3H6J A;  4JYV L;  3K39 A;  2H2U A;  4K1K A;  1NCB N;  2W5O A;  4R40 A;  3W09 A;  2HOR A;  4D0E A;  1QBI A;  4M10 A;  4JZD L;  3NT1 A;  4BDW A;  3TH3 L;  3FVZ A;  1PFX L;  2KB9 A;  5GTQ A;  2FHR A;  1IQG L;  3II7 A;  4BTU A;  5B2C A;  1CVW L;  1HAF A;  4XIO A;  4KS4 A;  1N1T A;  1AUT L;  4XJA A;  4FPY A;  1IVE A;  2OJH A;  4GDI A;  4WA5 A;  4WEG A;  4FOQ A;  3N8X A;  5KIR A;  3KRK A;  4ISI L;  2UWP B;  3HS7 A;  1E8V A;  1HX2 A;  2IAS A;  1UZK A;  3TK6 B;  3Q6T A;  3QMO A;  2DG1 A;  2RHP A;  2VWL L;  3NTB A;  1F0R B;  2B7D L;  5F1A A;  4D90 A;  4KS3 A;  1N7D A;  4BBW A;  2VK6 A;  3BEQ A;  4Y6D B;  2WG4 B;  3O9J A;  1DVA L;  1NFY B;  5IKV A;  4WA3 A;  4HZX A;  4D52 B;  3F1S B;  5EGM B; 
#chains in the Genus database with same CATH homology
 2K2S B;  2Y7X B;  1C5M F;  3BPS E;  3LTF B;  3BYC A;  1HRE A;  4RS0 A;  1NFX B;  1Z6E L;  5GX4 A;  3K9X A;  1CVU A;  1P0S L;  5CKN A;  1L5G B;  2OYU P;  2GVV A;  2XC4 L;  1IVO C;  3LAQ A;  1FFM A;  4LMF A;  3Q6K A;  3N8Y A;  1EZQ B;  1DX5 I;  2XBV L;  3IJE B;  4CUE A;  2VH0 B;  4GNC A;  3LN0 A;  1XKA L;  1NPE A;  3GCW E;  2Y82 B;  5IKT A;  4X8V L;  2VVC K;  2BOX A;  4ZXX L;  4C16 A;  2WPI E;  1Q7F A;  3LIW B;  3KQC L;  1G2M B;  4PH9 A;  1PRH A;  4GNB A;  3M36 L;  2WPJ E;  3SOB B;  1EQG A;  1APO A;  2IAP A;  1IQE L;  1O5D L;  1HRF A;  2I9A A;  2KV4 A;  1P9J A;  1CCV A;  5IKR A;  1J9C L;  2WYG B;  1F7M A;  2BOH A;  3TGF A;  1WHE A;  3QH0 A;  3KQD L;  3OLT A;  2Y5G L;  2J34 B;  3RR3 A;  4BTT A;  1I0U A;  1HT8 A;  3LC5 B;  2IAQ A;  1EQH A;  1IP0 A;  2GVW A;  2BQW A;  4PWZ A;  1EMO A;  4AQT A;  4XLW A;  1FAK L;  3S2K A;  3LN1 A;  1WU1 B;  2CJI B;  4GNA A;  5JVY A;  1COU A;  3KQB L;  3N8Z A;  4G1M B;  1ZAQ A;  2W2Q E;  2WPL E;  4IMB A;  2WZP P;  3KL6 B;  3F6U L;  4NGA L;  3CEN L;  2BOU A;  1JBU L;  5L2Z L;  3POY A;  3A9G A;  3PGH A;  3SRG A;  1IGZ A;  3A9H A;  5FWW A;  1YUK B;  3WWA A;  2W2O E;  3FBY A;  1IQF L;  3Q3K B;  4O5T A;  3TK5 B;  2ADX A;  1NFU B;  3V1S A;  3BT2 A;  1M1X B;  3EGF A;  2P95 L;  5JB9 E;  3Q6P A;  2Y5F L;  5GX5 A;  4IYG A;  2WG3 C;  1LPK A;  1NZI A;  1KLO A;  2M74 A;  4XL1 A;  2IAR A;  2Y5H L;  4JZF L;  3SRE A;  2UWL B;  4CSY A;  2Y81 B;  2GHS A;  2FLR L;  4JZE L;  1Q4G A;  1YGC L;  4X8T L;  1X7A L;  1IQJ L;  3LI4 A;  4GN9 A;  4ZLR A;  1FE2 A;  3OLU A;  5D9D A;  2G00 L;  1HAE A;  5IKQ A;  1YUG A;  2FP8 A;  3O4P A;  1ATE A;  1JL9 A;  1ATA A;  2XBX L;  2WPM E;  3FW0 A;  3ZYI B;  2Q1J B;  4O5S A;  3N8V A;  1MQ6 L;  3S8V A;  2FLG A;  4Z0K B;  3SOV A;  2DG0 A;  5D9B A;  4BXW A;  1QFK L;  2W8B A;  3S94 A;  3FFG L;  4HHQ A;  2MHP A;  2UWO B;  1IQH L;  3ASI A;  1LPZ A;  2VVV L;  1V3X B;  5CKQ A;  2F9B L;  3G4E A;  1HZ8 A;  4A0P A;  2H9E C;  4ZXY L;  1RFN B;  4A94 C;  2BQ6 A;  2J4I B;  1FSB A;  2FP9 A;  3N8Y B;  2GVX A;  1KLI L;  1LMM A;  1W8B L;  1WHF A;  4BTI A;  3LC3 B;  4Y79 B;  4O02 B;  1NQL B;  3HO4 A;  4BXS A;  1EBV A;  4MMY B;  3C9A C;  1TLE A;  2POO A;  1PTH A;  5JW1 A;  2AYL A;  1CQE A;  1UZP A;  3DAS A;  2EI8 B;  1EPI A;  4LOR A;  3S8Z A;  2I9B A;  2P3F N;  2XBW L;  4A7I A;  5GX1 A;  1XFE A;  4X8U L;  4Q1U A;  3V64 C;  3ZYG A;  3HLI A;  4RRX A;  3HS5 A;  1GK5 A;  4NG9 L;  4HHO A;  1CRU A;  2IAU A;  3ENS A;  5K0H B;  1HT5 A;  3DEM A;  4Z0L A;  4OTY A;  2NPR A;  1CVM A;  3GIS X;  3P5B L;  1LQD A;  2BZ6 L;  2BMG A;  3LI3 A;  2P93 L;  1CCF A;  1NFW B;  1UZQ A;  3H5C B;  1FF7 A;  3NJP C;  4RUT A;  4FM5 A;  2VAQ A;  2GD4 A;  4ZHA B;  3HS6 A;  1IOX A;  3QCW A;  2JKH L;  2QE8 A;  5GX3 A;  2W3I B;  4GN7 A;  2BQ7 A;  1F0S B;  1MOX C;  2FD6 A;  1IQK L;  2J95 B;  3CS7 L;  3NTG A;  3IAX A;  1IJQ A;  2VH6 B;  4DG6 A;  5L30 L;  1TOZ A;  2MGP A;  1G1R A;  1YO8 A;  3G4H A;  1RWL A;  1L3Y A;  2W26 B;  1EPJ A;  1A3P A;  2IVZ A;  5D9C A;  2P28 B;  1XDT R;  2PR3 B;  1PJX A;  2W86 A;  3HO3 A;  1POO A;  2W2P E;  2DSO A;  2ISM A;  2W8B B;  2G8S A;  2V91 A;  1CQ1 A;  3HO5 A;  1PGE A;  2WYJ B;  4JML A;  5EX7 A;  3KCG L;  4CUD A;  3TC9 A;  1NT0 A;  2KL7 A;  3LTG D;  3SW2 A;  2P16 L;  4GN8 A;  2VWM K;  1PXX A;  1URK A;  1U8C B;  2YGQ A;  2RNL A;  2XC5 L;  2P3U A;  2P3T A;  3ZYJ B;  3HPT A;  1DDX A;  1HJ7 A;  1KIG L;  1UZJ A;  1NPE B;  2HQS A;  1BF9 A;  2IAT A;  5L2Y L;  4RRW A;  2FPB A;  4HW6 A;  3GCX E;  4MMZ B;  3V65 B;  2EI6 B;  1MQ5 L;  1K37 A;  2WPK E;  3M37 L;  2J2U B;  4ZAE B;  1IQI L;  1FJS L;  4Z6A L;  1EPH A;  3TZI A;  3KYA A;  4Y7A B;  3AMS A;  1IQN L;  2W2N E;  3SOQ A;  5CIS A;  2J94 B;  2P94 L;  3E5Z A;  4ISH L;  4M11 A;  3CA7 A;  3I1C A;  4BDX A;  2IAW A;  1OB1 C;  1DQB A;  1C9U A;  2EI7 B;  5COX A;  2P26 A;  4NA9 L;  2VWN L;  2IAV A;  1IQM L;  3DR2 A;  1N1I A;  3HRP A;  2Y38 A;  5E8D A;  1EMN A;  1Z6C A;  2Y7Z B;  1C5K A;  4MMX B;  2YGO A;  1G2L B;  1V04 A;  4COX A;  1XKB A;  4Y7B B;  5JBA E;  4RRZ A;  2H9E L;  4X8S L;  5JBC E;  1JV2 B;  1HCG B;  1H6L A;  2WPH E;  1K36 A;  1F7E A;  3KQE L;  4YT6 L;  1G1S A;  5KN5 C;  2FZZ L;  1DIY A;  2XBY L;  4OTJ A;  2OYE P;  3ELA L;  1QLG A;  3U0S A;  2W2M E;  3U7U G;  2YGP A;  1ATB A;  3LI5 A;  2VWO L;  3MQE A;  4D0F A;  1EGF A;  1EAI C;  1CRZ A;  2WFT A;  3IIT B;  2TGF A;  2FPC A;  4CUF A;  5GX2 A;  5FDQ A;  3N8W B;  1ATD A;  2BOK L;  4Y71 B;  4O1Z A;  1B9W A;  5JB8 E;  3AMR A;  2PHB B;  4JYU L;  2IAO A;  1RWI A;  1FAX L;  1LPG A;  4TGF A;  1G1T A;  2DDU A;  4Y76 B;  5I46 L;  4RRY A;  2IAX A;  3Q7D A;  1TPG A;  2WFX B;  2Y80 B;  1CX2 A;  3U73 A;  3S6X A;  4YZU B;  1LMJ A;  1KLJ L;  5JVZ A;  3KK6 A;  1SZB A;  1ADX A;  3WW9 A;  1G1Q A;  2MGR A;  2BO2 A;  1IOE L;  1APQ A;  2P4O A;  3BT1 A;  2P3F L;  2XC0 L;  3MDL A;  1IGX A;  1IQL L;  2W3K B;  3FCS B;  4XBM A;  4E1G A;  1U67 A;  4YT7 L;  5F19 A;  3N8W A;  3TBD A;  2K2T A;  2J38 B;  5JBB E;  1YUF A;  2KNI A;  4ZH8 B;  2GVU A;  1CEJ A;  3CFW A;  2D1J B;  2VJ3 A;  2RA0 L;  5CKM A;  6COX A;  1W7X L;  2PUQ L;  3R05 A;  3HLH A;  3KGG A;  2VVU L;  1E1A A;  2FLB L;  1KSN B;  1EPG A;  4JYV L;  4R40 A;  4D0E A;  1QBI A;  4M10 A;  4JZD L;  3NT1 A;  4BDW A;  3TH3 L;  3FVZ A;  1PFX L;  2KB9 A;  5GTQ A;  1IQG L;  4BTU A;  1CVW L;  1HAF A;  1AUT L;  2OJH A;  3N8X A;  5KIR A;  3KRK A;  2UWP B;  3HS7 A;  4ISI L;  2IAS A;  1HX2 A;  3Q6T A;  1UZK A;  3TK6 B;  3QMO A;  2DG1 A;  2RHP A;  2VWL L;  3NTB A;  1F0R B;  2B7D L;  5F1A A;  4D90 A;  1N7D A;  4Y6D B;  2WG4 B;  1DVA L;  1NFY B;  5IKV A;  3F1S B;  5EGM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...