1APOA

Three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
42
structure length
42
Chain Sequence
KDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of the apo form of the N-terminal EGF-like module of blood coagulation factor X as determined by NMR spectroscopy and simulated folding.
pubmed doi rcsb
molecule keywords EGF-LIKE MODULE OF BLOOD COAGULATION FACTOR X
molecule tags Coagulation factor
source organism Bos taurus
total genus 4
structure length 42
sequence length 42
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 1992-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1apoA00
2BO2A 1IGXA 1OB1C 1FJSL 1PGEA 5COXA 4BTUA 4MMXB 3GCXE 3ENSA 2PUQL 1F0RB 4BXWA 3CFWA 1IQML 1FE2A 2Y5HL 4Y71B 3HS6A 3TBDA 1URKA 5E8DA 5KN5C 5IKVA 1ATAA 2VJ3A 4XL1A 2XC0L 3LTFB 2W2ME 3ASIA 3ZYGA 1XDTR 1Z6CA 1YUFA 4MMZB 2BOUA 1DVAL 4D90A 2MHPA 1JBUL 2P3UA 2P3TA 3KQBL 2MGPA 2BOHA 3HS5A 2KV4A 4Y7AB 3OLTA 1PTHA 3K9XA 4MMYB 1X7AL 3BPSE 2WPHE 1HT5A 1IP0A 1F7MA 2D1JB 3NTBA 1DIYA 1HRFA 2YGPA 2VH0B 3TZIA 1IQGL 2W26B 2W3KB 4BTTA 1FAKL 1K36A 3HPTA 2BQ7A 3KQCL 2VVVL 1UZQA 1TLEA 1G1QA 3Q7DA 2XBWL 5L30L 2VH6B 2Y82B 1N7DA 4RRYA 1JL9A 2W3IB 4X8VL 5EGMB 2P28B 2P3FN 2VVUL 4BDWA 5L2ZL 4Z0KB 1C5MF 2WYGB 2ADXA 2Q1JB 3HO5A 3N8YB 1F0SB 2G00L 5KIRA 1P9JA 3N8WA 2FZZL 3PGHA 1IGZA 2XC5L 1EPGA 2AYLA 1FAXL 1MOXC 2M74A 3QMOA 4Y79B 3C9AC 5F1AA 1AUTL 1DDXA 2MGRA 3FFGL 2FLBL 1L5GB 1FFMA 1PFXL 3NJPC 1CX2A 1NT0A 4O02B 3KCGL 2J38B 4ISIL 4LMFA 2DDUA 4YT6L 1EGFA 4Z6AL 1XKBA 2PR3B 3SOBB 2I9AA 1G2MB 2Y38A 4ZHAB 3MQEA 5CISA 3N8YA 1WU1B 3SOVA 2FLRL 1B9WA 1CQEA 2BZ6L 3QCWA 1NQLB 1HJ7A 2OYUP 4TGFA 2XBXL 2RHPA 3N8ZA 2I9BA 3HS7A 5JW1A 2WPME 4JYUL 3ZYJB 5JBCE 3ZYIB 4ZXXL 2P95L 2TGFA 5JBAE 5JVYA 2W2PE 3NTGA 1NFYB 4RRZA 3KK6A 2PHBB 5IKRA 4A7IA 1LQDA 2WPKE 2P16L 5CKMA 1ATEA 3TH3L 2VWOL 1UZJA 1KLJL 4YZUB 2XBYL 1TPGA 2B7DL 2Y5FL 1CVUA 5JBBE 1IJQA 1IQEL 4RS0A 4ISHL 2BOXA 2OYEP 1HX2A 3GISX 2K2TA 1KIGL 4JZDL 2RA0L 1G1SA 2VWLL 1HCGB 2WYJB 3N8WB 1WHEA 3U73A 1XFEA 3ELAL 1Q4GA 2VWMK 2Y80B 1N1IA 1W8BL 2WPLE 2EI6B 4ZXYL 1V3XB 3CA7A 5JB9E 1RFNB 1IQJL 3U7UG 3M36L 1FSBA 1ATBA 1IQKL 3LC5B 2EI7B 1LPGA 4JZEL 4PH9A 1IQHL 4M10A 4E1GA 2Y7XB 3GCWE 2YGOA 1CVWL 1IQLL 5CKNA 2VWNL 3POYA 1EMOA 3KRKA 1HZ8A 2WPJE 1LMJA 4Y7BB 2J34B 3F1SB 3Q3KB 4X8TL 1LPZA 1HAEA 4Z0LA 1XKAL 3BT1A 4CSYA 2EI8B 3CENL 1A3PA 2K2SB 2VVCK 1EQHA 3OLUA 2KB9A 1ATDA 3P5BL 4AQTA 2Y5GL 3FBYA 4JZFL 2BQ6A 2UWLB 1U8CB 3V64C 2WG4B 2FLGA 3LAQA 1ADXA 4YT7L 4NA9L 2WG3C 1SZBA 3H5CB 2GD4A 3MDLA 1YGCL 4RRWA 3F6UL 4LORA 2Y81B 4ZH8B 3TGFA 5L2YL 1EZQB 4D0FA 2BOKL 5IKQA 1G1TA 2W86A 4OTJA 1NPEB 1O5DL 3LC3B 1EPJA 1L3YA 2UWPB 3EGFA 4CUEA 1M1XB 5JB8E 4D0EA 2W2NE 1DX5I 1GK5A 2P26A 3KQEL 4ZAEB 1NFUB 4C16A 2J4IB 1COUA 1EPIA 1F7EA 1G1RA 3CS7L 3N8XA 4JYVL 1EQGA 1U67A 1EPHA 1LPKA 1QFKL 4BXSA 3DEMA 1KLOA 1IOXA 2WPIE 4OTYA 3M37L 1PRHA 5I46L 1KLIL 2XBVL 1MQ5L 4NG9L 1NFXB 4O1ZA 1EBVA 1IQNL 4G1MB 2CJIB 5FDQA 1DQBA 1P0SL 3RR3A 4Y6DB 4COXA 3TK6B 2Y7ZB 1IQFL 2H9EL 3SOQA 1IQIL 3KL6B 1K37A 1I0UA 4CUFA 1APQA 3SW2A 2J95B 4BDXA 1MQ6L 1Z6EL 3V65B 2P3FL 2BQWA 5K0HB 2F9BL 1J9CL 3LTGD 2KL7A 2XC4L 1G2LB 1ZAQA 1NZIA 1JV2B 1IVOC 5JVZA 1EMNA 3TK5B 2P93L 1FF7A 2BMGA 1W7XL 4BTIA 3LIWB 6COXA 1APOA 4X8UL 2P94L 5IKTA 5F19A 3N8VA 2W2QE 1PXXA 3LN1A 1HREA 3R05A 3IJEB 4FM5A 3HO4A 3HO3A 3IITB 2W2OE 1YO8A 3FCSB 2J2UB 1TOZA 4RRXA 4XLWA 1CEJA 2RNLA 1HT8A 1YUKB 4CUDA 3NT1A 1KSNB 1UZKA 3QH0A 2UWOB 2JKHL 2J94B 4XBMA 1HAFA 2NPRA 1YUGA 1BF9A 1WHFA 1IOEL 2WFXB 5CKQA 1CCVA 2FD6A 3BT2A 4M11A 2WFTA 3LN0A 1NFWB 1CCFA 4NGAL 4X8SL 1EAIC 3KQDL 4Y76B 1UZPA 4RUTA
chains in the Genus database with same CATH superfamily
2BO2A 1IGXA 1OB1C 1FJSL 1PGEA 5COXA 4BTUA 4MMXB 3GCXE 3ENSA 2PUQL 1F0RB 4BXWA 3CFWA 1IQML 1FE2A 2Y5HL 4Y71B 3HS6A 2YGQA 3TBDA 4GU3A 1URKA 5E8DA 5KN5C 5IKVA 1ATAA 2VJ3A 4XL1A 2XC0L 3LTFB 2W2ME 3ASIA 3ZYGA 1XDTR 1Z6CA 1YUFA 4MMZB 2BOUA 1DVAL 4D90A 2MHPA 1JBUL 2P3UA 2P3TA 3KQBL 2MGPA 2BOHA 3HS5A 2KV4A 4Y7AB 3OLTA 1PTHA 3K9XA 4MMYB 1X7AL 3BPSE 2WPHE 1HT5A 1IP0A 1F7MA 2D1JB 3NTBA 2WZPP 1DIYA 1HRFA 2YGPA 2VH0B 3TZIA 1IQGL 2W26B 2W3KB 4BTTA 1FAKL 1K36A 3HPTA 2BQ7A 3KQCL 2VVVL 1UZQA 1TLEA 1G1QA 3Q7DA 2XBWL 5L30L 2VH6B 2Y82B 1N7DA 4RRYA 1JL9A 2W3IB 4X8VL 5EGMB 2P28B 2P3FN 2VVUL 4BDWA 5L2ZL 4Z0KB 1C5MF 2WYGB 2ADXA 2Q1JB 3HO5A 2BSFA 3N8YB 1F0SB 2G00L 5KIRA 1P9JA 3N8WA 2FZZL 3PGHA 1IGZA 2XC5L 1EPGA 2AYLA 1FAXL 1MOXC 2M74A 3QMOA 4Y79B 3C9AC 5F1AA 1AUTL 1DDXA 2MGRA 3FFGL 2FLBL 1L5GB 1FFMA 1PFXL 3NJPC 1CX2A 1NT0A 4O02B 3KCGL 2J38B 4ISIL 4LMFA 2DDUA 4YT6L 1EGFA 4Z6AL 1XKBA 2PR3B 3SOBB 2I9AA 1G2MB 2Y38A 4ZHAB 3MQEA 5CISA 3N8YA 1WU1B 3SOVA 2FLRL 1B9WA 1CQEA 2BZ6L 3QCWA 1NQLB 1HJ7A 2OYUP 4TGFA 2XBXL 2RHPA 3N8ZA 2I9BA 2BT8A 3HS7A 5JW1A 2WPME 4JYUL 3ZYJB 5JBCE 3ZYIB 4ZXXL 2P95L 2TGFA 5JBAE 5JVYA 2W2PE 3NTGA 1NFYB 4RRZA 3KK6A 2PHBB 5IKRA 4A7IA 1LQDA 2WPKE 2P16L 5CKMA 1ATEA 1LMMA 3TH3L 2VWOL 1KKEA 1UZJA 1KLJL 4YZUB 2XBYL 1TPGA 2B7DL 2Y5FL 1CVUA 5JBBE 1IJQA 1IQEL 4RS0A 4ISHL 2BOXA 2OYEP 1HX2A 3GISX 2K2TA 1KIGL 4JZDL 2RA0L 1G1SA 2VWLL 1HCGB 2WYJB 3N8WB 1WHEA 3U73A 1XFEA 3ELAL 1Q4GA 2VWMK 2Y80B 1N1IA 1W8BL 2WPLE 2EI6B 4ZXYL 1V3XB 3CA7A 5JB9E 1RFNB 1IQJL 3U7UG 3M36L 1FSBA 1ATBA 1IQKL 3LC5B 2EI7B 1LPGA 4JZEL 4PH9A 1IQHL 4M10A 4E1GA 2Y7XB 3GCWE 2YGOA 1CVWL 1IQLL 5CKNA 2VWNL 3POYA 1EMOA 3KRKA 1HZ8A 2WPJE 1LMJA 2BT7A 4Y7BB 2J34B 3F1SB 3Q3KB 4X8TL 2VRSA 1LPZA 1HAEA 4Z0LA 1XKAL 3BT1A 4CSYA 2EI8B 3CENL 1A3PA 2K2SB 2VVCK 1EQHA 3OLUA 2KB9A 1ATDA 3P5BL 4AQTA 2Y5GL 3FBYA 4JZFL 2BQ6A 2UWLB 1U8CB 3V64C 2WG4B 2FLGA 3LAQA 1ADXA 4YT7L 4NA9L 2WG3C 1SZBA 3H5CB 2GD4A 3MDLA 1YGCL 4RRWA 3F6UL 4LORA 2Y81B 4ZH8B 3TGFA 5L2YL 1EZQB 4D0FA 2BOKL 5IKQA 1G1TA 2W86A 4OTJA 1NPEB 1O5DL 3LC3B 1EPJA 1L3YA 2UWPB 3EGFA 2JJLA 4CUEA 1M1XB 5JB8E 4D0EA 2KNIA 2W2NE 1DX5I 1GK5A 2P26A 3KQEL 4ZAEB 1NFUB 4C16A 2J4IB 1COUA 1EPIA 1QIUA 1F7EA 1G1RA 3CS7L 3N8XA 4JYVL 1EQGA 1U67A 1EPHA 1LPKA 1QFKL 4BXSA 3DEMA 1KLOA 1IOXA 2WPIE 4OTYA 1PRHA 3M37L 5I46L 1KLIL 2XBVL 2HOXA 1MQ5L 4NG9L 1NFXB 4O1ZA 1V1IA 1EBVA 1IQNL 4G1MB 2CJIB 5FDQA 1DQBA 1P0SL 3RR3A 4Y6DB 4COXA 3TK6B 2Y7ZB 1IQFL 2H9EL 3SOQA 2H9EC 1IQIL 3KL6B 1K37A 1I0UA 4CUFA 1APQA 3SW2A 1V1HA 2J95B 4BDXA 1MQ6L 1Z6EL 3V65B 2P3FL 2BQWA 5K0HB 2F9BL 1J9CL 3LTGD 2KL7A 2XC4L 1G2LB 1ZAQA 1NZIA 1JV2B 1IVOC 5JVZA 1EMNA 3TK5B 2P93L 1FF7A 2BMGA 1W7XL 4BTIA 3LIWB 6COXA 1APOA 2HORA 4X8UL 3S6XA 2P94L 5IKTA 5F19A 3N8VA 2W2QE 1PXXA 3LN1A 1HREA 4GU4A 3R05A 3IJEB 4FM5A 3HO4A 3HO3A 3IITB 2W2OE 1YO8A 3FCSB 2J2UB 1TOZA 4RRXA 4XLWA 1CEJA 2RNLA 1HT8A 1YUKB 4CUDA 3NT1A 1KSNB 1UZKA 4A94C 3QH0A 2UWOB 2JKHL 2J94B 4XBMA 1LK9A 1HAFA 2NPRA 1YUGA 1BF9A 1WHFA 1IOEL 2WFXB 5CKQA 1CCVA 2FD6A 3BT2A 4M11A 2WFTA 3LN0A 1NFWB 1CCFA 4NGAL 4X8SL 1EAIC 3KQDL 4Y76B 1UZPA 4RUTA
chains in the Genus database with same CATH topology
2BO2A 1IGXA 1OB1C 1FJSL 1PGEA 5COXA 4BTUA 4MMXB 3GCXE 3ENSA 2PUQL 1F0RB 4BXWA 3CFWA 1IQML 1FE2A 2Y5HL 4Y71B 3HS6A 2YGQA 3TBDA 1URKA 5E8DA 5KN5C 5IKVA 1ATAA 2VJ3A 4XL1A 2XC0L 3LTFB 2W2ME 3ASIA 3ZYGA 1XDTR 1Z6CA 1YUFA 4MMZB 2BOUA 1DVAL 4D90A 2MHPA 1JBUL 2P3UA 2P3TA 3KQBL 2MGPA 2BOHA 3HS5A 2KV4A 4Y7AB 3OLTA 1PTHA 3K9XA 4MMYB 1X7AL 3BPSE 2WPHE 1HT5A 1IP0A 1F7MA 2D1JB 3NTBA 2WZPP 1DIYA 1HRFA 2YGPA 2VH0B 3TZIA 1IQGL 2W26B 2W3KB 4BTTA 1FAKL 1K36A 3HPTA 2BQ7A 3KQCL 2VVVL 1UZQA 1TLEA 1G1QA 3Q7DA 2XBWL 5L30L 2VH6B 2Y82B 1N7DA 4RRYA 1JL9A 2W3IB 4X8VL 5EGMB 2P28B 2P3FN 2VVUL 4BDWA 5L2ZL 4Z0KB 1C5MF 2WYGB 2ADXA 2Q1JB 3HO5A 3N8YB 1F0SB 2G00L 5KIRA 1P9JA 3N8WA 2FZZL 3PGHA 1IGZA 2XC5L 1EPGA 2AYLA 1FAXL 1MOXC 2M74A 3QMOA 4Y79B 3C9AC 5F1AA 1AUTL 1DDXA 2MGRA 3FFGL 2FLBL 1L5GB 1FFMA 1PFXL 3NJPC 1CX2A 1NT0A 4O02B 3KCGL 2J38B 4ISIL 4LMFA 2DDUA 4YT6L 1EGFA 4Z6AL 1XKBA 2PR3B 3SOBB 2I9AA 1G2MB 2Y38A 4ZHAB 3MQEA 5CISA 3N8YA 1WU1B 3SOVA 2FLRL 1B9WA 1CQEA 2BZ6L 3QCWA 1NQLB 1HJ7A 2OYUP 4TGFA 2XBXL 2RHPA 3N8ZA 2I9BA 3HS7A 5JW1A 2WPME 4JYUL 3ZYJB 5JBCE 3ZYIB 4ZXXL 2P95L 2TGFA 5JBAE 5JVYA 2W2PE 3NTGA 1NFYB 4RRZA 3KK6A 2PHBB 5IKRA 4A7IA 1LQDA 2WPKE 2P16L 5CKMA 1ATEA 1LMMA 3TH3L 2VWOL 1UZJA 1KLJL 4YZUB 2XBYL 1TPGA 2B7DL 2Y5FL 1CVUA 5JBBE 1IJQA 1IQEL 4RS0A 4ISHL 2BOXA 2OYEP 1HX2A 3GISX 2K2TA 1KIGL 4JZDL 2RA0L 1G1SA 2VWLL 1HCGB 2WYJB 3N8WB 1WHEA 3U73A 1XFEA 3ELAL 1Q4GA 2VWMK 2Y80B 1N1IA 1W8BL 2WPLE 2EI6B 4ZXYL 1V3XB 3CA7A 5JB9E 1RFNB 1IQJL 3U7UG 3M36L 1FSBA 1ATBA 1IQKL 3LC5B 2EI7B 1LPGA 4JZEL 4PH9A 1IQHL 4M10A 4E1GA 2Y7XB 3GCWE 2YGOA 1CVWL 1IQLL 5CKNA 2VWNL 3POYA 1EMOA 3KRKA 1HZ8A 2WPJE 1LMJA 4Y7BB 2J34B 3F1SB 3Q3KB 4X8TL 1LPZA 1HAEA 4Z0LA 1XKAL 3BT1A 4CSYA 2EI8B 3CENL 1A3PA 2K2SB 2VVCK 1EQHA 3OLUA 2KB9A 1ATDA 3P5BL 4AQTA 2Y5GL 3FBYA 4JZFL 2BQ6A 2UWLB 1U8CB 3V64C 2WG4B 2FLGA 3LAQA 1ADXA 4YT7L 4NA9L 2WG3C 1SZBA 3H5CB 2GD4A 3MDLA 1YGCL 4RRWA 3F6UL 4LORA 2Y81B 4ZH8B 3TGFA 5L2YL 1EZQB 4D0FA 2BOKL 5IKQA 1G1TA 2W86A 4OTJA 1NPEB 1O5DL 3LC3B 1EPJA 1L3YA 2UWPB 3EGFA 4CUEA 1M1XB 5JB8E 4D0EA 2KNIA 2W2NE 1DX5I 1GK5A 2P26A 3KQEL 4ZAEB 1NFUB 4C16A 2J4IB 1COUA 1EPIA 1F7EA 1G1RA 3CS7L 3N8XA 4JYVL 1EQGA 1U67A 1EPHA 1LPKA 1QFKL 4BXSA 3DEMA 1KLOA 1IOXA 2WPIE 4OTYA 3M37L 1PRHA 5I46L 1KLIL 2XBVL 1MQ5L 4NG9L 1NFXB 4O1ZA 1EBVA 1IQNL 4G1MB 2CJIB 5FDQA 1DQBA 1P0SL 3RR3A 4Y6DB 4COXA 3TK6B 2Y7ZB 1IQFL 2H9EL 3SOQA 2H9EC 1IQIL 3KL6B 1K37A 1I0UA 4CUFA 1APQA 3SW2A 2J95B 4BDXA 1MQ6L 1Z6EL 3V65B 2P3FL 2BQWA 5K0HB 2F9BL 1J9CL 3LTGD 2KL7A 2XC4L 1G2LB 1ZAQA 1NZIA 1JV2B 1IVOC 5JVZA 1EMNA 3TK5B 2P93L 1FF7A 2BMGA 1W7XL 4BTIA 3LIWB 6COXA 1APOA 4X8UL 3S6XA 2P94L 5IKTA 5F19A 3N8VA 2W2QE 1PXXA 3LN1A 1HREA 3R05A 3IJEB 4FM5A 3HO4A 3HO3A 3IITB 2W2OE 1YO8A 3FCSB 2J2UB 1TOZA 4RRXA 4XLWA 1CEJA 2RNLA 1HT8A 1YUKB 4CUDA 3NT1A 1KSNB 1UZKA 4A94C 3QH0A 2UWOB 2JKHL 2J94B 4XBMA 1HAFA 2NPRA 1YUGA 1BF9A 1WHFA 1IOEL 2WFXB 5CKQA 1CCVA 2FD6A 3BT2A 4M11A 2WFTA 3LN0A 1NFWB 1CCFA 4NGAL 4X8SL 1EAIC 3KQDL 4Y76B 1UZPA 4RUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO2 A;  1IGX A;  1OB1 C;  1FJS L;  1PGE A;  5COX A;  4BTU A;  4MMX B;  3GCX E;  3ENS A;  2PUQ L;  1F0R B;  4BXW A;  3CFW A;  1IQM L;  1FE2 A;  2Y5H L;  4Y71 B;  3HS6 A;  3TBD A;  1URK A;  5E8D A;  5KN5 C;  5IKV A;  1ATA A;  2VJ3 A;  4XL1 A;  2XC0 L;  3LTF B;  2W2M E;  3ASI A;  3ZYG A;  1XDT R;  1Z6C A;  1YUF A;  4MMZ B;  2BOU A;  1DVA L;  4D90 A;  2MHP A;  1JBU L;  2P3U A;  2P3T A;  3KQB L;  2MGP A;  2BOH A;  3HS5 A;  2KV4 A;  4Y7A B;  3OLT A;  1PTH A;  3K9X A;  4MMY B;  1X7A L;  3BPS E;  2WPH E;  1HT5 A;  1IP0 A;  1F7M A;  2D1J B;  3NTB A;  1DIY A;  1HRF A;  2YGP A;  2VH0 B;  3TZI A;  1IQG L;  2W26 B;  2W3K B;  4BTT A;  1FAK L;  1K36 A;  3HPT A;  2BQ7 A;  3KQC L;  2VVV L;  1UZQ A;  1TLE A;  1G1Q A;  3Q7D A;  2XBW L;  5L30 L;  2VH6 B;  2Y82 B;  1N7D A;  4RRY A;  1JL9 A;  2W3I B;  4X8V L;  5EGM B;  2P28 B;  2P3F N;  2VVU L;  4BDW A;  5L2Z L;  4Z0K B;  1C5M F;  2WYG B;  2ADX A;  2Q1J B;  3HO5 A;  3N8Y B;  1F0S B;  2G00 L;  5KIR A;  1P9J A;  3N8W A;  2FZZ L;  3PGH A;  1IGZ A;  2XC5 L;  1EPG A;  2AYL A;  1FAX L;  1MOX C;  2M74 A;  3QMO A;  4Y79 B;  3C9A C;  5F1A A;  1AUT L;  1DDX A;  2MGR A;  3FFG L;  2FLB L;  1L5G B;  1FFM A;  1PFX L;  3NJP C;  1CX2 A;  1NT0 A;  4O02 B;  3KCG L;  2J38 B;  4ISI L;  4LMF A;  2DDU A;  4YT6 L;  1EGF A;  4Z6A L;  1XKB A;  2PR3 B;  3SOB B;  2I9A A;  1G2M B;  2Y38 A;  4ZHA B;  3MQE A;  5CIS A;  3N8Y A;  1WU1 B;  3SOV A;  2FLR L;  1B9W A;  1CQE A;  2BZ6 L;  3QCW A;  1NQL B;  1HJ7 A;  2OYU P;  4TGF A;  2XBX L;  2RHP A;  3N8Z A;  2I9B A;  3HS7 A;  5JW1 A;  2WPM E;  4JYU L;  3ZYJ B;  5JBC E;  3ZYI B;  4ZXX L;  2P95 L;  2TGF A;  5JBA E;  5JVY A;  2W2P E;  3NTG A;  1NFY B;  4RRZ A;  3KK6 A;  2PHB B;  5IKR A;  4A7I A;  1LQD A;  2WPK E;  2P16 L;  5CKM A;  1ATE A;  3TH3 L;  2VWO L;  1UZJ A;  1KLJ L;  4YZU B;  2XBY L;  1TPG A;  2B7D L;  2Y5F L;  1CVU A;  5JBB E;  1IJQ A;  1IQE L;  4RS0 A;  4ISH L;  2BOX A;  2OYE P;  1HX2 A;  3GIS X;  2K2T A;  1KIG L;  4JZD L;  2RA0 L;  1G1S A;  2VWL L;  1HCG B;  2WYJ B;  3N8W B;  1WHE A;  3U73 A;  1XFE A;  3ELA L;  1Q4G A;  2VWM K;  2Y80 B;  1N1I A;  1W8B L;  2WPL E;  2EI6 B;  4ZXY L;  1V3X B;  3CA7 A;  5JB9 E;  1RFN B;  1IQJ L;  3U7U G;  3M36 L;  1FSB A;  1ATB A;  1IQK L;  3LC5 B;  2EI7 B;  1LPG A;  4JZE L;  4PH9 A;  1IQH L;  4M10 A;  4E1G A;  2Y7X B;  3GCW E;  2YGO A;  1CVW L;  1IQL L;  5CKN A;  2VWN L;  3POY A;  1EMO A;  3KRK A;  1HZ8 A;  2WPJ E;  1LMJ A;  4Y7B B;  2J34 B;  3F1S B;  3Q3K B;  4X8T L;  1LPZ A;  1HAE A;  4Z0L A;  1XKA L;  3BT1 A;  4CSY A;  2EI8 B;  3CEN L;  1A3P A;  2K2S B;  2VVC K;  1EQH A;  3OLU A;  2KB9 A;  1ATD A;  3P5B L;  4AQT A;  2Y5G L;  3FBY A;  4JZF L;  2BQ6 A;  2UWL B;  1U8C B;  3V64 C;  2WG4 B;  2FLG A;  3LAQ A;  1ADX A;  4YT7 L;  4NA9 L;  2WG3 C;  1SZB A;  3H5C B;  2GD4 A;  3MDL A;  1YGC L;  4RRW A;  3F6U L;  4LOR A;  2Y81 B;  4ZH8 B;  3TGF A;  5L2Y L;  1EZQ B;  4D0F A;  2BOK L;  5IKQ A;  1G1T A;  2W86 A;  4OTJ A;  1NPE B;  1O5D L;  3LC3 B;  1EPJ A;  1L3Y A;  2UWP B;  3EGF A;  4CUE A;  1M1X B;  5JB8 E;  4D0E A;  2W2N E;  1DX5 I;  1GK5 A;  2P26 A;  3KQE L;  4ZAE B;  1NFU B;  4C16 A;  2J4I B;  1COU A;  1EPI A;  1F7E A;  1G1R A;  3CS7 L;  3N8X A;  4JYV L;  1EQG A;  1U67 A;  1EPH A;  1LPK A;  1QFK L;  4BXS A;  3DEM A;  1KLO A;  1IOX A;  2WPI E;  4OTY A;  3M37 L;  1PRH A;  5I46 L;  1KLI L;  2XBV L;  1MQ5 L;  4NG9 L;  1NFX B;  4O1Z A;  1EBV A;  1IQN L;  4G1M B;  2CJI B;  5FDQ A;  1DQB A;  1P0S L;  3RR3 A;  4Y6D B;  4COX A;  3TK6 B;  2Y7Z B;  1IQF L;  2H9E L;  3SOQ A;  1IQI L;  3KL6 B;  1K37 A;  1I0U A;  4CUF A;  1APQ A;  3SW2 A;  2J95 B;  4BDX A;  1MQ6 L;  1Z6E L;  3V65 B;  2P3F L;  2BQW A;  5K0H B;  2F9B L;  1J9C L;  3LTG D;  2KL7 A;  2XC4 L;  1G2L B;  1ZAQ A;  1NZI A;  1JV2 B;  1IVO C;  5JVZ A;  1EMN A;  3TK5 B;  2P93 L;  1FF7 A;  2BMG A;  1W7X L;  4BTI A;  3LIW B;  6COX A;  1APO A;  4X8U L;  2P94 L;  5IKT A;  5F19 A;  3N8V A;  2W2Q E;  1PXX A;  3LN1 A;  1HRE A;  3R05 A;  3IJE B;  4FM5 A;  3HO4 A;  3HO3 A;  3IIT B;  2W2O E;  1YO8 A;  3FCS B;  2J2U B;  1TOZ A;  4RRX A;  4XLW A;  1CEJ A;  2RNL A;  1HT8 A;  1YUK B;  4CUD A;  3NT1 A;  1KSN B;  1UZK A;  3QH0 A;  2UWO B;  2JKH L;  2J94 B;  4XBM A;  1HAF A;  2NPR A;  1YUG A;  1BF9 A;  1WHF A;  1IOE L;  2WFX B;  5CKQ A;  1CCV A;  2FD6 A;  3BT2 A;  4M11 A;  2WFT A;  3LN0 A;  1NFW B;  1CCF A;  4NGA L;  4X8S L;  1EAI C;  3KQD L;  4Y76 B;  1UZP A;  4RUT A; 
#chains in the Genus database with same CATH topology
 2BO2 A;  1IGX A;  1OB1 C;  1FJS L;  1PGE A;  5COX A;  4BTU A;  4MMX B;  3GCX E;  3ENS A;  2PUQ L;  1F0R B;  4BXW A;  3CFW A;  1IQM L;  1FE2 A;  2Y5H L;  4Y71 B;  3HS6 A;  2YGQ A;  3TBD A;  4GU3 A;  1URK A;  5E8D A;  5KN5 C;  5IKV A;  1ATA A;  2VJ3 A;  4XL1 A;  2XC0 L;  3LTF B;  2W2M E;  3ASI A;  3ZYG A;  1XDT R;  1Z6C A;  1YUF A;  4MMZ B;  2BOU A;  1DVA L;  4D90 A;  2MHP A;  1JBU L;  2P3U A;  2P3T A;  3KQB L;  2MGP A;  2BOH A;  3HS5 A;  2KV4 A;  4Y7A B;  3OLT A;  1PTH A;  3K9X A;  4MMY B;  1X7A L;  3BPS E;  2WPH E;  1HT5 A;  1IP0 A;  1F7M A;  2D1J B;  3NTB A;  2WZP P;  1DIY A;  1HRF A;  2YGP A;  2VH0 B;  3TZI A;  1IQG L;  2W26 B;  2W3K B;  4BTT A;  1FAK L;  1K36 A;  3HPT A;  2BQ7 A;  3KQC L;  2VVV L;  1UZQ A;  1TLE A;  1G1Q A;  3Q7D A;  2XBW L;  5L30 L;  2VH6 B;  2Y82 B;  1N7D A;  4RRY A;  1JL9 A;  2W3I B;  4X8V L;  5EGM B;  2P28 B;  2P3F N;  2VVU L;  4BDW A;  5L2Z L;  4Z0K B;  1C5M F;  2WYG B;  2ADX A;  2Q1J B;  3HO5 A;  2BSF A;  3N8Y B;  1F0S B;  2G00 L;  5KIR A;  1P9J A;  3N8W A;  2FZZ L;  3PGH A;  1IGZ A;  2XC5 L;  1EPG A;  2AYL A;  1FAX L;  1MOX C;  2M74 A;  3QMO A;  4Y79 B;  3C9A C;  5F1A A;  1AUT L;  1DDX A;  2MGR A;  3FFG L;  2FLB L;  1L5G B;  1FFM A;  1PFX L;  3NJP C;  1CX2 A;  1NT0 A;  4O02 B;  3KCG L;  2J38 B;  4ISI L;  4LMF A;  2DDU A;  4YT6 L;  1EGF A;  4Z6A L;  1XKB A;  2PR3 B;  3SOB B;  2I9A A;  1G2M B;  2Y38 A;  4ZHA B;  3MQE A;  5CIS A;  3N8Y A;  1WU1 B;  3SOV A;  2FLR L;  1B9W A;  1CQE A;  2BZ6 L;  3QCW A;  1NQL B;  1HJ7 A;  2OYU P;  4TGF A;  2XBX L;  2RHP A;  3N8Z A;  2I9B A;  2BT8 A;  3HS7 A;  5JW1 A;  2WPM E;  4JYU L;  3ZYJ B;  5JBC E;  3ZYI B;  4ZXX L;  2P95 L;  2TGF A;  5JBA E;  5JVY A;  2W2P E;  3NTG A;  1NFY B;  4RRZ A;  3KK6 A;  2PHB B;  5IKR A;  4A7I A;  1LQD A;  2WPK E;  2P16 L;  5CKM A;  1ATE A;  1LMM A;  3TH3 L;  2VWO L;  1KKE A;  1UZJ A;  1KLJ L;  4YZU B;  2XBY L;  1TPG A;  2B7D L;  2Y5F L;  1CVU A;  5JBB E;  1IJQ A;  1IQE L;  4RS0 A;  4ISH L;  2BOX A;  2OYE P;  1HX2 A;  3GIS X;  2K2T A;  1KIG L;  4JZD L;  2RA0 L;  1G1S A;  2VWL L;  1HCG B;  2WYJ B;  3N8W B;  1WHE A;  3U73 A;  1XFE A;  3ELA L;  1Q4G A;  2VWM K;  2Y80 B;  1N1I A;  1W8B L;  2WPL E;  2EI6 B;  4ZXY L;  1V3X B;  3CA7 A;  5JB9 E;  1RFN B;  1IQJ L;  3U7U G;  3M36 L;  1FSB A;  1ATB A;  1IQK L;  3LC5 B;  2EI7 B;  1LPG A;  4JZE L;  4PH9 A;  1IQH L;  4M10 A;  4E1G A;  2Y7X B;  3GCW E;  2YGO A;  1CVW L;  1IQL L;  5CKN A;  2VWN L;  3POY A;  1EMO A;  3KRK A;  1HZ8 A;  2WPJ E;  1LMJ A;  2BT7 A;  4Y7B B;  2J34 B;  3F1S B;  3Q3K B;  4X8T L;  2VRS A;  1LPZ A;  1HAE A;  4Z0L A;  1XKA L;  3BT1 A;  4CSY A;  2EI8 B;  3CEN L;  1A3P A;  2K2S B;  2VVC K;  1EQH A;  3OLU A;  2KB9 A;  1ATD A;  3P5B L;  4AQT A;  2Y5G L;  3FBY A;  4JZF L;  2BQ6 A;  2UWL B;  1U8C B;  3V64 C;  2WG4 B;  2FLG A;  3LAQ A;  1ADX A;  4YT7 L;  4NA9 L;  2WG3 C;  1SZB A;  3H5C B;  2GD4 A;  3MDL A;  1YGC L;  4RRW A;  3F6U L;  4LOR A;  2Y81 B;  4ZH8 B;  3TGF A;  5L2Y L;  1EZQ B;  4D0F A;  2BOK L;  5IKQ A;  1G1T A;  2W86 A;  4OTJ A;  1NPE B;  1O5D L;  3LC3 B;  1EPJ A;  1L3Y A;  2UWP B;  3EGF A;  2JJL A;  4CUE A;  1M1X B;  5JB8 E;  4D0E A;  2KNI A;  2W2N E;  1DX5 I;  1GK5 A;  2P26 A;  3KQE L;  4ZAE B;  1NFU B;  4C16 A;  2J4I B;  1COU A;  1EPI A;  1QIU A;  1F7E A;  1G1R A;  3CS7 L;  3N8X A;  4JYV L;  1EQG A;  1U67 A;  1EPH A;  1LPK A;  1QFK L;  4BXS A;  3DEM A;  1KLO A;  1IOX A;  2WPI E;  4OTY A;  1PRH A;  3M37 L;  5I46 L;  1KLI L;  2XBV L;  2HOX A;  1MQ5 L;  4NG9 L;  1NFX B;  4O1Z A;  1V1I A;  1EBV A;  1IQN L;  4G1M B;  2CJI B;  5FDQ A;  1DQB A;  1P0S L;  3RR3 A;  4Y6D B;  4COX A;  3TK6 B;  2Y7Z B;  1IQF L;  2H9E L;  3SOQ A;  2H9E C;  1IQI L;  3KL6 B;  1K37 A;  1I0U A;  4CUF A;  1APQ A;  3SW2 A;  1V1H A;  2J95 B;  4BDX A;  1MQ6 L;  1Z6E L;  3V65 B;  2P3F L;  2BQW A;  5K0H B;  2F9B L;  1J9C L;  3LTG D;  2KL7 A;  2XC4 L;  1G2L B;  1ZAQ A;  1NZI A;  1JV2 B;  1IVO C;  5JVZ A;  1EMN A;  3TK5 B;  2P93 L;  1FF7 A;  2BMG A;  1W7X L;  4BTI A;  3LIW B;  6COX A;  1APO A;  2HOR A;  4X8U L;  3S6X A;  2P94 L;  5IKT A;  5F19 A;  3N8V A;  2W2Q E;  1PXX A;  3LN1 A;  1HRE A;  4GU4 A;  3R05 A;  3IJE B;  4FM5 A;  3HO4 A;  3HO3 A;  3IIT B;  2W2O E;  1YO8 A;  3FCS B;  2J2U B;  1TOZ A;  4RRX A;  4XLW A;  1CEJ A;  2RNL A;  1HT8 A;  1YUK B;  4CUD A;  3NT1 A;  1KSN B;  1UZK A;  4A94 C;  3QH0 A;  2UWO B;  2JKH L;  2J94 B;  4XBM A;  1LK9 A;  1HAF A;  2NPR A;  1YUG A;  1BF9 A;  1WHF A;  1IOE L;  2WFX B;  5CKQ A;  1CCV A;  2FD6 A;  3BT2 A;  4M11 A;  2WFT A;  3LN0 A;  1NFW B;  1CCF A;  4NGA L;  4X8S L;  1EAI C;  3KQD L;  4Y76 B;  1UZP A;  4RUT A; 
#chains in the Genus database with same CATH homology
 2BO2 A;  1IGX A;  1OB1 C;  1FJS L;  1PGE A;  5COX A;  4BTU A;  4MMX B;  3GCX E;  3ENS A;  2PUQ L;  1F0R B;  4BXW A;  3CFW A;  1IQM L;  1FE2 A;  2Y5H L;  4Y71 B;  3HS6 A;  2YGQ A;  3TBD A;  1URK A;  5E8D A;  5KN5 C;  5IKV A;  1ATA A;  2VJ3 A;  4XL1 A;  2XC0 L;  3LTF B;  2W2M E;  3ASI A;  3ZYG A;  1XDT R;  1Z6C A;  1YUF A;  4MMZ B;  2BOU A;  1DVA L;  4D90 A;  2MHP A;  1JBU L;  2P3U A;  2P3T A;  3KQB L;  2MGP A;  2BOH A;  3HS5 A;  2KV4 A;  4Y7A B;  3OLT A;  1PTH A;  3K9X A;  4MMY B;  1X7A L;  3BPS E;  2WPH E;  1HT5 A;  1IP0 A;  1F7M A;  2D1J B;  3NTB A;  2WZP P;  1DIY A;  1HRF A;  2YGP A;  2VH0 B;  3TZI A;  1IQG L;  2W26 B;  2W3K B;  4BTT A;  1FAK L;  1K36 A;  3HPT A;  2BQ7 A;  3KQC L;  2VVV L;  1UZQ A;  1TLE A;  1G1Q A;  3Q7D A;  2XBW L;  5L30 L;  2VH6 B;  2Y82 B;  1N7D A;  4RRY A;  1JL9 A;  2W3I B;  4X8V L;  5EGM B;  2P28 B;  2P3F N;  2VVU L;  4BDW A;  5L2Z L;  4Z0K B;  1C5M F;  2WYG B;  2ADX A;  2Q1J B;  3HO5 A;  3N8Y B;  1F0S B;  2G00 L;  5KIR A;  1P9J A;  3N8W A;  2FZZ L;  3PGH A;  1IGZ A;  2XC5 L;  1EPG A;  2AYL A;  1FAX L;  1MOX C;  2M74 A;  3QMO A;  4Y79 B;  3C9A C;  5F1A A;  1AUT L;  1DDX A;  2MGR A;  3FFG L;  2FLB L;  1L5G B;  1FFM A;  1PFX L;  3NJP C;  1CX2 A;  1NT0 A;  4O02 B;  3KCG L;  2J38 B;  4ISI L;  4LMF A;  2DDU A;  4YT6 L;  1EGF A;  4Z6A L;  1XKB A;  2PR3 B;  3SOB B;  2I9A A;  1G2M B;  2Y38 A;  4ZHA B;  3MQE A;  5CIS A;  3N8Y A;  1WU1 B;  3SOV A;  2FLR L;  1B9W A;  1CQE A;  2BZ6 L;  3QCW A;  1NQL B;  1HJ7 A;  2OYU P;  4TGF A;  2XBX L;  2RHP A;  3N8Z A;  2I9B A;  3HS7 A;  5JW1 A;  2WPM E;  4JYU L;  3ZYJ B;  5JBC E;  3ZYI B;  4ZXX L;  2P95 L;  2TGF A;  5JBA E;  5JVY A;  2W2P E;  3NTG A;  1NFY B;  4RRZ A;  3KK6 A;  2PHB B;  5IKR A;  4A7I A;  1LQD A;  2WPK E;  2P16 L;  5CKM A;  1ATE A;  1LMM A;  3TH3 L;  2VWO L;  1UZJ A;  1KLJ L;  4YZU B;  2XBY L;  1TPG A;  2B7D L;  2Y5F L;  1CVU A;  5JBB E;  1IJQ A;  1IQE L;  4RS0 A;  4ISH L;  2BOX A;  2OYE P;  1HX2 A;  3GIS X;  2K2T A;  1KIG L;  4JZD L;  2RA0 L;  1G1S A;  2VWL L;  1HCG B;  2WYJ B;  3N8W B;  1WHE A;  3U73 A;  1XFE A;  3ELA L;  1Q4G A;  2VWM K;  2Y80 B;  1N1I A;  1W8B L;  2WPL E;  2EI6 B;  4ZXY L;  1V3X B;  3CA7 A;  5JB9 E;  1RFN B;  1IQJ L;  3U7U G;  3M36 L;  1FSB A;  1ATB A;  1IQK L;  3LC5 B;  2EI7 B;  1LPG A;  4JZE L;  4PH9 A;  1IQH L;  4M10 A;  4E1G A;  2Y7X B;  3GCW E;  2YGO A;  1CVW L;  1IQL L;  5CKN A;  2VWN L;  3POY A;  1EMO A;  3KRK A;  1HZ8 A;  2WPJ E;  1LMJ A;  4Y7B B;  2J34 B;  3F1S B;  3Q3K B;  4X8T L;  1LPZ A;  1HAE A;  4Z0L A;  1XKA L;  3BT1 A;  4CSY A;  2EI8 B;  3CEN L;  1A3P A;  2K2S B;  2VVC K;  1EQH A;  3OLU A;  2KB9 A;  1ATD A;  3P5B L;  4AQT A;  2Y5G L;  3FBY A;  4JZF L;  2BQ6 A;  2UWL B;  1U8C B;  3V64 C;  2WG4 B;  2FLG A;  3LAQ A;  1ADX A;  4YT7 L;  4NA9 L;  2WG3 C;  1SZB A;  3H5C B;  2GD4 A;  3MDL A;  1YGC L;  4RRW A;  3F6U L;  4LOR A;  2Y81 B;  4ZH8 B;  3TGF A;  5L2Y L;  1EZQ B;  4D0F A;  2BOK L;  5IKQ A;  1G1T A;  2W86 A;  4OTJ A;  1NPE B;  1O5D L;  3LC3 B;  1EPJ A;  1L3Y A;  2UWP B;  3EGF A;  4CUE A;  1M1X B;  5JB8 E;  4D0E A;  2KNI A;  2W2N E;  1DX5 I;  1GK5 A;  2P26 A;  3KQE L;  4ZAE B;  1NFU B;  4C16 A;  2J4I B;  1COU A;  1EPI A;  1F7E A;  1G1R A;  3CS7 L;  3N8X A;  4JYV L;  1EQG A;  1U67 A;  1EPH A;  1LPK A;  1QFK L;  4BXS A;  3DEM A;  1KLO A;  1IOX A;  2WPI E;  4OTY A;  3M37 L;  1PRH A;  5I46 L;  1KLI L;  2XBV L;  1MQ5 L;  4NG9 L;  1NFX B;  4O1Z A;  1EBV A;  1IQN L;  4G1M B;  2CJI B;  5FDQ A;  1DQB A;  1P0S L;  3RR3 A;  4Y6D B;  4COX A;  3TK6 B;  2Y7Z B;  1IQF L;  2H9E L;  3SOQ A;  2H9E C;  1IQI L;  3KL6 B;  1K37 A;  1I0U A;  4CUF A;  1APQ A;  3SW2 A;  2J95 B;  4BDX A;  1MQ6 L;  1Z6E L;  3V65 B;  2P3F L;  2BQW A;  5K0H B;  2F9B L;  1J9C L;  3LTG D;  2KL7 A;  2XC4 L;  1G2L B;  1ZAQ A;  1NZI A;  1JV2 B;  1IVO C;  5JVZ A;  1EMN A;  3TK5 B;  2P93 L;  1FF7 A;  2BMG A;  1W7X L;  4BTI A;  3LIW B;  6COX A;  1APO A;  4X8U L;  3S6X A;  2P94 L;  5IKT A;  5F19 A;  3N8V A;  2W2Q E;  1PXX A;  3LN1 A;  1HRE A;  3R05 A;  3IJE B;  4FM5 A;  3HO4 A;  3HO3 A;  3IIT B;  2W2O E;  1YO8 A;  3FCS B;  2J2U B;  1TOZ A;  4RRX A;  4XLW A;  1CEJ A;  2RNL A;  1HT8 A;  1YUK B;  4CUD A;  3NT1 A;  1KSN B;  1UZK A;  4A94 C;  3QH0 A;  2UWO B;  2JKH L;  2J94 B;  4XBM A;  1HAF A;  2NPR A;  1YUG A;  1BF9 A;  1WHF A;  1IOE L;  2WFX B;  5CKQ A;  1CCV A;  2FD6 A;  3BT2 A;  4M11 A;  2WFT A;  3LN0 A;  1NFW B;  1CCF A;  4NGA L;  4X8S L;  1EAI C;  3KQD L;  4Y76 B;  1UZP A;  4RUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...