1EGFA

Solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
53
structure length
53
Chain Sequence
b'NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR
publication title Solution structure of murine epidermal growth factor determined by NMR spectroscopy and refined by energy minimization with restraints.
pubmed doi rcsb
source organism Mus musculus
molecule tags Growth factor
total genus 6
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1991-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1egfA00
3HO3A 1NFUB 5KIRA 2J34B 1DVAL 3SW2A 1N7DA 3LIWB 1CEJA 2CJIB 3HO5A 2UWPB 3ZYGA 1EGFA 3U7UG 1IQGL 2J4IB 3GCXE 1HRFA 2W2QE 5F19A 3ENSA 1Z6CA 4Z0LA 5JB9E 1AUTL 1FSBA 1WHFA 2VWLL 5JBAE 3H5CB 1DQBA 2P3UA 1G1QA 3N8ZA 1URKA 1XKAL 2WPHE 3KQDL 5JVZA 2VWOL 1UZKA 5EGMB 1Z6EL 4OTJA 1OB1C 3LTGD 3SOVA 4ISIL 2VH6B 3KK6A 4C16A 2KL7A 2UWOB 1O5DL 1PXXA 4RRWA 1UZJA 2PR3B 1IJQA 4BDWA 2FLRL 3CS7L 1SZBA 2MHPA 4NG9L 2W86A 3IITB 3Q7DA 2FLBL 4Y7BB 3LTFB 1JV2B 2P28B 3QCWA 2YGOA 5JW1A 4XLWA 1IQNL 4A7IA 3NTGA 3N8YB 1KIGL 1FAXL 4Z6AL 4JYVL 3HS5A 4JZEL 1PGEA 2OYUP 1C5MF 2VVUL 1BF9A 3TK6B 1L3YA 2Q1JB 3KRKA 5CKQA 2P3TA 2W2PE 1UZPA 1PFXL 5FDQA 3C9AC 4ZAEB 2J94B 1EMOA 4Z0KB 2WYGB 1HCGB 1RFNB 1A3PA 2Y81B 3PGHA 2XC4L 1W7XL 2ADXA 4X8VL 2BOUA 2J38B 1J9CL 4JZDL 3V65B 2PHBB 2XBXL 3N8WA 2TGFA 4ZXXL 1F7EA 3DEMA 1CQEA 1FF7A 1K37A 3KQEL 4RRZA 3OLTA 1IQFL 1LPGA 1FAKL 2P93L 1IQHL 1HT5A 1NZIA 2BZ6L 3LAQA 5F1AA 2G00L 1KLOA 4XBMA 4M10A 2P26A 3QH0A 5CKMA 5KN5C 5COXA 2NPRA 3FFGL 3BT1A 3LC3B 1MQ6L 3BT2A 1IVOC 1COUA 3LN1A 1XDTR 4TGFA 4ISHL 1TPGA 2P94L 4NGAL 2P95L 2PUQL 3TK5B 1JBUL 3CA7A 1TLEA 2W2ME 4YT6L 2P3FL 1EBVA 4M11A 2VWMK 1IQJL 2FLGA 4E1GA 2J95B 1ATEA 1EPIA 2OYEP 1U8CB 2XBWL 2XC0L 4MMYB 3NT1A 3ZYJB 3TGFA 3QMOA 2EI7B 2EI6B 3TZIA 3K9XA 1HZ8A 3HS6A 1G2LB 3EGFA 5L30L 3RR3A 1P0SL 4O1ZA 1FJSL 1PTHA 2RHPA 1EPHA 1JL9A 1KLJL 3ELAL 4JZFL 5JVYA 2Y7ZB 3CFWA 1IQML 1DIYA 1MOXC 2Y80B 1ATBA 2B7DL 3LC5B 4BXSA 1EMNA 3NTBA 3N8XA 5E8DA 4JYUL 2XBYL 1CVUA 1M1XB 1IQLL 2DDUA 4CSYA 2BQWA 4XL1A 3CENL 2BQ7A 2K2SB 2Y7XB 1CX2A 2WG3C 1APQA 1IGXA 1IQEL 1F7MA 1CCFA 1IP0A 3HS7A 4BDXA 2Y38A 1HX2A 3ZYIB 3BPSE 4LORA 3POYA 2WPJE 3R05A 2W2OE 3M37L 2XBVL 2P16L 1LMJA 3KL6B 4COXA 4CUDA 2BOHA 3U73A 2BO2A 2WG4B 4Y7AB 2BMGA 2VVVL 1ATDA 1FFMA 1KSNB 4BTUA 1HREA 2J2UB 1W8BL 1IQKL 1Q4GA 2AYLA 4RUTA 1G1RA 1LPZA 2VVCK 2FZZL 1B9WA 4X8SL 1ZAQA 4ZXYL 3Q3KB 2H9EL 1APOA 1WU1B 3OLUA 3IJEB 1EQHA 4RRYA 2D1JB 5IKTA 6COXA 4MMXB 3HO4A 1IOEL 5I46L 3MQEA 4OTYA 3M36L 2VH0B 1N1IA 1PRHA 1NPEB 2W3IB 4BXWA 4YZUB 3FCSB 1EQGA 1EAIC 4Y6DB 2WYJB 1K36A 2KV4A 5IKRA 3N8YA 4YT7L 2F9BL 1LQDA 2Y82B 1F0SB 3N8WB 2WFTA 3F6UL 2BQ6A 4Y76B 4NA9L 4BTTA 1NFWB 3HPTA 3GCWE 4ZHAB 3TH3L 1GK5A 1NQLB 3N8VA 1LPKA 1NT0A 2M74A 3NJPC 1L5GB 5L2YL 5JB8E 3KQCL 1U67A 2RA0L 2Y5FL 4CUFA 4MMZB 2MGPA 2I9AA 2UWLB 2W2NE 2P3FN 3KCGL 3SOQA 1KLIL 5CISA 1F0RB 2RNLA 2FD6A 1ATAA 2I9BA 3LN0A 2XC5L 1V3XB 2WPKE 5IKVA 1EPGA 2WFXB 1I0UA 4X8UL 2W3KB 4ZH8B 4D0EA 5CKNA 4CUEA 1G1SA 1YGCL 4RRXA 5JBCE 3KQBL 2VWNL 1DX5I 4AQTA 1YO8A 3MDLA 3TBDA 2Y5HL 3ASIA 4X8TL 4O02B 1XFEA 2JKHL 5JBBE 1QFKL 1EZQB 1EPJA 3SOBB 4Y71B 3P5BL 4BTIA 4FM5A 2WPME 1G1TA 1NFYB 1XKBA 2BOXA 1WHEA 5IKQA 3V64C 5L2ZL 4PH9A 2WPLE 5K0HB 1CVWL 1IGZA 1TOZA 1YUGA 1YUFA 4G1MB 1UZQA 2Y5GL 1IOXA 1CCVA 3GISX 2BOKL 1MQ5L 2VJ3A 1IQIL 2K2TA 3FBYA 4RS0A 2MGRA 4Y79B 1NFXB 1HAFA 1HAEA 4LMFA 1X7AL 1G2MB 2W26B 2EI8B 3F1SB 2GD4A 1P9JA 2KB9A 4D0FA 4D90A 1ADXA 1FE2A 1HJ7A 2YGPA 1DDXA 2WPIE 1HT8A 1YUKB
chains in the Genus database with same CATH superfamily
3HO3A 2BSFA 1NFUB 5KIRA 2J34B 1DVAL 3SW2A 1N7DA 3LIWB 1CEJA 2CJIB 3HO5A 2UWPB 3ZYGA 1EGFA 3U7UG 1IQGL 2J4IB 3GCXE 1HRFA 2W2QE 5F19A 3ENSA 1Z6CA 4Z0LA 5JB9E 1AUTL 1FSBA 1WHFA 2VWLL 5JBAE 3H5CB 1DQBA 2P3UA 1G1QA 3N8ZA 1URKA 1XKAL 2WPHE 3KQDL 4A94C 5JVZA 2VWOL 1UZKA 4GU3A 5EGMB 1Z6EL 4OTJA 1OB1C 3LTGD 3SOVA 4ISIL 2VH6B 3KK6A 4C16A 2KL7A 2UWOB 1O5DL 1PXXA 4RRWA 1UZJA 2PR3B 1IJQA 4BDWA 1LMMA 2FLRL 3CS7L 1SZBA 2MHPA 4NG9L 2W86A 3IITB 3Q7DA 2FLBL 4Y7BB 3LTFB 1JV2B 2P28B 3S6XA 3QCWA 4GU4A 2YGOA 5JW1A 4XLWA 1IQNL 4A7IA 3NTGA 3N8YB 1KIGL 1FAXL 4Z6AL 4JYVL 3HS5A 4JZEL 1PGEA 2OYUP 1C5MF 2VVUL 1BF9A 3TK6B 1L3YA 2Q1JB 3KRKA 5CKQA 2P3TA 2W2PE 1UZPA 1PFXL 2JJLA 5FDQA 3C9AC 4ZAEB 2J94B 1EMOA 4Z0KB 1KKEA 2WYGB 1HCGB 1RFNB 1A3PA 2Y81B 3PGHA 1V1IA 2XC4L 1W7XL 2ADXA 4X8VL 2BOUA 2J38B 1J9CL 4JZDL 3V65B 2PHBB 2XBXL 3N8WA 2TGFA 4ZXXL 1F7EA 3DEMA 1CQEA 1FF7A 1K37A 3KQEL 4RRZA 3OLTA 1IQFL 1LPGA 1FAKL 2P93L 1IQHL 1HT5A 1NZIA 2BZ6L 3LAQA 5F1AA 2G00L 1KLOA 4XBMA 2KNIA 4M10A 2P26A 3QH0A 5CKMA 5KN5C 5COXA 2NPRA 3FFGL 3BT1A 3LC3B 1MQ6L 3BT2A 1IVOC 1COUA 2BT8A 3LN1A 1XDTR 4TGFA 4ISHL 1TPGA 2P94L 4NGAL 2P95L 2PUQL 3TK5B 1JBUL 3CA7A 1TLEA 2BT7A 2W2ME 4YT6L 2P3FL 1EBVA 4M11A 2VWMK 1IQJL 2FLGA 4E1GA 2J95B 1ATEA 1EPIA 2OYEP 1U8CB 2XBWL 2XC0L 4MMYB 3NT1A 2H9EC 3ZYJB 3TGFA 3QMOA 2EI7B 2EI6B 3TZIA 3K9XA 1HZ8A 3HS6A 1G2LB 3EGFA 5L30L 3RR3A 1P0SL 4O1ZA 1FJSL 1PTHA 2RHPA 1EPHA 1JL9A 1KLJL 3ELAL 4JZFL 5JVYA 2Y7ZB 3CFWA 1IQML 1DIYA 1MOXC 2Y80B 1ATBA 2B7DL 3LC5B 4BXSA 1EMNA 3NTBA 3N8XA 5E8DA 4JYUL 2XBYL 1CVUA 1M1XB 1IQLL 2DDUA 4CSYA 2BQWA 4XL1A 3CENL 2BQ7A 2K2SB 2Y7XB 1CX2A 2WG3C 1APQA 1IGXA 1IQEL 1F7MA 1CCFA 1IP0A 3HS7A 4BDXA 2Y38A 1HX2A 3ZYIB 3BPSE 4LORA 3POYA 2WPJE 3R05A 2W2OE 3M37L 2XBVL 2P16L 1LMJA 3KL6B 4COXA 4CUDA 2BOHA 3U73A 2BO2A 2WG4B 4Y7AB 2BMGA 2VVVL 1ATDA 1FFMA 1KSNB 4BTUA 1QIUA 1HREA 2J2UB 1W8BL 1IQKL 1Q4GA 2AYLA 4RUTA 1G1RA 1LPZA 2VVCK 2FZZL 1B9WA 4X8SL 1ZAQA 2HORA 3Q3KB 4ZXYL 2H9EL 1APOA 1LK9A 1WU1B 3OLUA 2VRSA 3IJEB 1EQHA 4RRYA 2D1JB 5IKTA 6COXA 4MMXB 3HO4A 1IOEL 5I46L 3MQEA 4OTYA 3M36L 2VH0B 1N1IA 1PRHA 1NPEB 2W3IB 4BXWA 4YZUB 3FCSB 1EQGA 1EAIC 4Y6DB 2WYJB 1K36A 2KV4A 5IKRA 3N8YA 4YT7L 2F9BL 1LQDA 2Y82B 1F0SB 3N8WB 2WFTA 3F6UL 2BQ6A 1V1HA 4Y76B 4NA9L 4BTTA 1NFWB 3HPTA 3GCWE 4ZHAB 3TH3L 1GK5A 1NQLB 3N8VA 1LPKA 1NT0A 2M74A 3NJPC 1L5GB 5L2YL 2WZPP 5JB8E 3KQCL 1U67A 2RA0L 2Y5FL 4CUFA 4MMZB 2MGPA 2I9AA 2UWLB 2W2NE 2P3FN 3KCGL 3SOQA 1KLIL 5CISA 1F0RB 2RNLA 2FD6A 1ATAA 2I9BA 3LN0A 2XC5L 1V3XB 2WPKE 2YGQA 5IKVA 1EPGA 2WFXB 1I0UA 4X8UL 2W3KB 4ZH8B 4D0EA 5CKNA 4CUEA 1G1SA 1YGCL 4RRXA 5JBCE 3KQBL 2VWNL 1DX5I 4AQTA 1YO8A 3MDLA 3TBDA 2Y5HL 3ASIA 4X8TL 4O02B 1XFEA 2JKHL 5JBBE 1QFKL 1EZQB 1EPJA 3SOBB 4Y71B 3P5BL 4BTIA 4FM5A 2WPME 1G1TA 1NFYB 1XKBA 2BOXA 1WHEA 5IKQA 3V64C 5L2ZL 4PH9A 2WPLE 5K0HB 1CVWL 1IGZA 1TOZA 1YUGA 1YUFA 4G1MB 1UZQA 2Y5GL 1IOXA 1CCVA 3GISX 2BOKL 1MQ5L 2VJ3A 1IQIL 2K2TA 3FBYA 4RS0A 2MGRA 4Y79B 1NFXB 1HAFA 1HAEA 4LMFA 1X7AL 1G2MB 2W26B 2HOXA 2EI8B 3F1SB 2GD4A 1P9JA 2KB9A 4D0FA 4D90A 1ADXA 1FE2A 1HJ7A 2YGPA 1DDXA 2WPIE 1HT8A 1YUKB
chains in the Genus database with same CATH topology
3HO3A 1NFUB 5KIRA 2J34B 1DVAL 3SW2A 1N7DA 3LIWB 1CEJA 2CJIB 3HO5A 2UWPB 3ZYGA 1EGFA 3U7UG 1IQGL 2J4IB 3GCXE 1HRFA 2W2QE 5F19A 3ENSA 1Z6CA 4Z0LA 5JB9E 1AUTL 1FSBA 1WHFA 2VWLL 5JBAE 3H5CB 1DQBA 2P3UA 1G1QA 3N8ZA 1URKA 1XKAL 2WPHE 3KQDL 4A94C 5JVZA 2VWOL 1UZKA 5EGMB 1Z6EL 4OTJA 1OB1C 3LTGD 3SOVA 4ISIL 2VH6B 3KK6A 4C16A 2KL7A 2UWOB 1O5DL 1PXXA 4RRWA 1UZJA 2PR3B 1IJQA 4BDWA 1LMMA 2FLRL 3CS7L 1SZBA 2MHPA 4NG9L 2W86A 3IITB 3Q7DA 2FLBL 4Y7BB 3LTFB 1JV2B 2P28B 3S6XA 3QCWA 2YGOA 5JW1A 4XLWA 1IQNL 4A7IA 3NTGA 3N8YB 1KIGL 1FAXL 4Z6AL 4JYVL 3HS5A 4JZEL 1PGEA 2OYUP 1C5MF 2VVUL 1BF9A 3TK6B 1L3YA 2Q1JB 3KRKA 5CKQA 2P3TA 2W2PE 1UZPA 1PFXL 5FDQA 3C9AC 4ZAEB 2J94B 1EMOA 4Z0KB 2WYGB 1HCGB 1RFNB 1A3PA 2Y81B 3PGHA 2XC4L 1W7XL 2ADXA 4X8VL 2BOUA 2J38B 1J9CL 4JZDL 3V65B 2PHBB 2XBXL 3N8WA 2TGFA 4ZXXL 1F7EA 3DEMA 1CQEA 1FF7A 1K37A 3KQEL 4RRZA 3OLTA 1IQFL 1LPGA 1FAKL 2P93L 1IQHL 1HT5A 1NZIA 2BZ6L 3LAQA 5F1AA 2G00L 1KLOA 4XBMA 2KNIA 4M10A 2P26A 3QH0A 5CKMA 5KN5C 5COXA 2NPRA 3FFGL 3BT1A 3LC3B 1MQ6L 3BT2A 1IVOC 1COUA 3LN1A 1XDTR 4TGFA 4ISHL 1TPGA 2P94L 4NGAL 2P95L 2PUQL 3TK5B 1JBUL 3CA7A 1TLEA 2W2ME 4YT6L 2P3FL 1EBVA 4M11A 2VWMK 1IQJL 2FLGA 4E1GA 2J95B 1ATEA 1EPIA 2OYEP 1U8CB 2XBWL 2XC0L 4MMYB 3NT1A 2H9EC 3ZYJB 3TGFA 3QMOA 2EI7B 2EI6B 3TZIA 3K9XA 1HZ8A 3HS6A 1G2LB 3EGFA 5L30L 3RR3A 1P0SL 4O1ZA 1FJSL 1PTHA 2RHPA 1EPHA 1JL9A 1KLJL 3ELAL 4JZFL 5JVYA 2Y7ZB 3CFWA 1IQML 1DIYA 1MOXC 2Y80B 1ATBA 2B7DL 3LC5B 4BXSA 1EMNA 3NTBA 3N8XA 5E8DA 4JYUL 2XBYL 1CVUA 1M1XB 1IQLL 2DDUA 4CSYA 2BQWA 4XL1A 3CENL 2BQ7A 2K2SB 2Y7XB 1CX2A 2WG3C 1APQA 1IGXA 1IQEL 1F7MA 1CCFA 1IP0A 3HS7A 4BDXA 2Y38A 1HX2A 3ZYIB 3BPSE 4LORA 3POYA 2WPJE 3R05A 2W2OE 3M37L 2XBVL 2P16L 1LMJA 3KL6B 4COXA 4CUDA 2BOHA 3U73A 2BO2A 2WG4B 4Y7AB 2BMGA 2VVVL 1ATDA 1FFMA 1KSNB 4BTUA 1HREA 2J2UB 1W8BL 1IQKL 1Q4GA 2AYLA 4RUTA 1G1RA 1LPZA 2VVCK 2FZZL 1B9WA 4X8SL 1ZAQA 4ZXYL 3Q3KB 2H9EL 1APOA 1WU1B 3OLUA 3IJEB 1EQHA 4RRYA 2D1JB 5IKTA 6COXA 4MMXB 3HO4A 1IOEL 5I46L 3MQEA 4OTYA 3M36L 2VH0B 1N1IA 1PRHA 1NPEB 2W3IB 4BXWA 4YZUB 3FCSB 1EQGA 1EAIC 4Y6DB 2WYJB 1K36A 2KV4A 5IKRA 3N8YA 4YT7L 2F9BL 1LQDA 2Y82B 1F0SB 3N8WB 2WFTA 3F6UL 2BQ6A 4Y76B 4NA9L 4BTTA 1NFWB 3HPTA 3GCWE 4ZHAB 3TH3L 1GK5A 1NQLB 3N8VA 1LPKA 1NT0A 2M74A 3NJPC 1L5GB 5L2YL 2WZPP 5JB8E 3KQCL 1U67A 2RA0L 2Y5FL 4CUFA 4MMZB 2MGPA 2I9AA 2UWLB 2W2NE 2P3FN 3KCGL 3SOQA 1KLIL 5CISA 1F0RB 2RNLA 2FD6A 1ATAA 2I9BA 3LN0A 2XC5L 1V3XB 2WPKE 2YGQA 5IKVA 1EPGA 2WFXB 1I0UA 4X8UL 2W3KB 4ZH8B 4D0EA 5CKNA 4CUEA 1G1SA 1YGCL 4RRXA 5JBCE 3KQBL 2VWNL 1DX5I 4AQTA 1YO8A 3MDLA 3TBDA 2Y5HL 3ASIA 4X8TL 4O02B 1XFEA 2JKHL 5JBBE 1QFKL 1EZQB 1EPJA 3SOBB 4Y71B 3P5BL 4BTIA 4FM5A 2WPME 1G1TA 1NFYB 1XKBA 2BOXA 1WHEA 5IKQA 3V64C 5L2ZL 4PH9A 2WPLE 5K0HB 1CVWL 1IGZA 1TOZA 1YUGA 1YUFA 4G1MB 1UZQA 2Y5GL 1IOXA 1CCVA 3GISX 2BOKL 1MQ5L 2VJ3A 1IQIL 2K2TA 3FBYA 4RS0A 2MGRA 4Y79B 1NFXB 1HAFA 1HAEA 4LMFA 1X7AL 1G2MB 2W26B 2EI8B 3F1SB 2GD4A 1P9JA 2KB9A 4D0FA 4D90A 1ADXA 1FE2A 1HJ7A 2YGPA 1DDXA 2WPIE 1HT8A 1YUKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HO3 A;  1NFU B;  5KIR A;  2J34 B;  1DVA L;  3SW2 A;  1N7D A;  3LIW B;  1CEJ A;  2CJI B;  3HO5 A;  2UWP B;  3ZYG A;  1EGF A;  3U7U G;  1IQG L;  2J4I B;  3GCX E;  1HRF A;  2W2Q E;  5F19 A;  3ENS A;  1Z6C A;  4Z0L A;  5JB9 E;  1AUT L;  1FSB A;  1WHF A;  2VWL L;  5JBA E;  3H5C B;  1DQB A;  2P3U A;  1G1Q A;  3N8Z A;  1URK A;  1XKA L;  2WPH E;  3KQD L;  5JVZ A;  2VWO L;  1UZK A;  5EGM B;  1Z6E L;  4OTJ A;  1OB1 C;  3LTG D;  3SOV A;  4ISI L;  2VH6 B;  3KK6 A;  4C16 A;  2KL7 A;  2UWO B;  1O5D L;  1PXX A;  4RRW A;  1UZJ A;  2PR3 B;  1IJQ A;  4BDW A;  2FLR L;  3CS7 L;  1SZB A;  2MHP A;  4NG9 L;  2W86 A;  3IIT B;  3Q7D A;  2FLB L;  4Y7B B;  3LTF B;  1JV2 B;  2P28 B;  3QCW A;  2YGO A;  5JW1 A;  4XLW A;  1IQN L;  4A7I A;  3NTG A;  3N8Y B;  1KIG L;  1FAX L;  4Z6A L;  4JYV L;  3HS5 A;  4JZE L;  1PGE A;  2OYU P;  1C5M F;  2VVU L;  1BF9 A;  3TK6 B;  1L3Y A;  2Q1J B;  3KRK A;  5CKQ A;  2P3T A;  2W2P E;  1UZP A;  1PFX L;  5FDQ A;  3C9A C;  4ZAE B;  2J94 B;  1EMO A;  4Z0K B;  2WYG B;  1HCG B;  1RFN B;  1A3P A;  2Y81 B;  3PGH A;  2XC4 L;  1W7X L;  2ADX A;  4X8V L;  2BOU A;  2J38 B;  1J9C L;  4JZD L;  3V65 B;  2PHB B;  2XBX L;  3N8W A;  2TGF A;  4ZXX L;  1F7E A;  3DEM A;  1CQE A;  1FF7 A;  1K37 A;  3KQE L;  4RRZ A;  3OLT A;  1IQF L;  1LPG A;  1FAK L;  2P93 L;  1IQH L;  1HT5 A;  1NZI A;  2BZ6 L;  3LAQ A;  5F1A A;  2G00 L;  1KLO A;  4XBM A;  4M10 A;  2P26 A;  3QH0 A;  5CKM A;  5KN5 C;  5COX A;  2NPR A;  3FFG L;  3BT1 A;  3LC3 B;  1MQ6 L;  3BT2 A;  1IVO C;  1COU A;  3LN1 A;  1XDT R;  4TGF A;  4ISH L;  1TPG A;  2P94 L;  4NGA L;  2P95 L;  2PUQ L;  3TK5 B;  1JBU L;  3CA7 A;  1TLE A;  2W2M E;  4YT6 L;  2P3F L;  1EBV A;  4M11 A;  2VWM K;  1IQJ L;  2FLG A;  4E1G A;  2J95 B;  1ATE A;  1EPI A;  2OYE P;  1U8C B;  2XBW L;  2XC0 L;  4MMY B;  3NT1 A;  3ZYJ B;  3TGF A;  3QMO A;  2EI7 B;  2EI6 B;  3TZI A;  3K9X A;  1HZ8 A;  3HS6 A;  1G2L B;  3EGF A;  5L30 L;  3RR3 A;  1P0S L;  4O1Z A;  1FJS L;  1PTH A;  2RHP A;  1EPH A;  1JL9 A;  1KLJ L;  3ELA L;  4JZF L;  5JVY A;  2Y7Z B;  3CFW A;  1IQM L;  1DIY A;  1MOX C;  2Y80 B;  1ATB A;  2B7D L;  3LC5 B;  4BXS A;  1EMN A;  3NTB A;  3N8X A;  5E8D A;  4JYU L;  2XBY L;  1CVU A;  1M1X B;  1IQL L;  2DDU A;  4CSY A;  2BQW A;  4XL1 A;  3CEN L;  2BQ7 A;  2K2S B;  2Y7X B;  1CX2 A;  2WG3 C;  1APQ A;  1IGX A;  1IQE L;  1F7M A;  1CCF A;  1IP0 A;  3HS7 A;  4BDX A;  2Y38 A;  1HX2 A;  3ZYI B;  3BPS E;  4LOR A;  3POY A;  2WPJ E;  3R05 A;  2W2O E;  3M37 L;  2XBV L;  2P16 L;  1LMJ A;  3KL6 B;  4COX A;  4CUD A;  2BOH A;  3U73 A;  2BO2 A;  2WG4 B;  4Y7A B;  2BMG A;  2VVV L;  1ATD A;  1FFM A;  1KSN B;  4BTU A;  1HRE A;  2J2U B;  1W8B L;  1IQK L;  1Q4G A;  2AYL A;  4RUT A;  1G1R A;  1LPZ A;  2VVC K;  2FZZ L;  1B9W A;  4X8S L;  1ZAQ A;  4ZXY L;  3Q3K B;  2H9E L;  1APO A;  1WU1 B;  3OLU A;  3IJE B;  1EQH A;  4RRY A;  2D1J B;  5IKT A;  6COX A;  4MMX B;  3HO4 A;  1IOE L;  5I46 L;  3MQE A;  4OTY A;  3M36 L;  2VH0 B;  1N1I A;  1PRH A;  1NPE B;  2W3I B;  4BXW A;  4YZU B;  3FCS B;  1EQG A;  1EAI C;  4Y6D B;  2WYJ B;  1K36 A;  2KV4 A;  5IKR A;  3N8Y A;  4YT7 L;  2F9B L;  1LQD A;  2Y82 B;  1F0S B;  3N8W B;  2WFT A;  3F6U L;  2BQ6 A;  4Y76 B;  4NA9 L;  4BTT A;  1NFW B;  3HPT A;  3GCW E;  4ZHA B;  3TH3 L;  1GK5 A;  1NQL B;  3N8V A;  1LPK A;  1NT0 A;  2M74 A;  3NJP C;  1L5G B;  5L2Y L;  5JB8 E;  3KQC L;  1U67 A;  2RA0 L;  2Y5F L;  4CUF A;  4MMZ B;  2MGP A;  2I9A A;  2UWL B;  2W2N E;  2P3F N;  3KCG L;  3SOQ A;  1KLI L;  5CIS A;  1F0R B;  2RNL A;  2FD6 A;  1ATA A;  2I9B A;  3LN0 A;  2XC5 L;  1V3X B;  2WPK E;  5IKV A;  1EPG A;  2WFX B;  1I0U A;  4X8U L;  2W3K B;  4ZH8 B;  4D0E A;  5CKN A;  4CUE A;  1G1S A;  1YGC L;  4RRX A;  5JBC E;  3KQB L;  2VWN L;  1DX5 I;  4AQT A;  1YO8 A;  3MDL A;  3TBD A;  2Y5H L;  3ASI A;  4X8T L;  4O02 B;  1XFE A;  2JKH L;  5JBB E;  1QFK L;  1EZQ B;  1EPJ A;  3SOB B;  4Y71 B;  3P5B L;  4BTI A;  4FM5 A;  2WPM E;  1G1T A;  1NFY B;  1XKB A;  2BOX A;  1WHE A;  5IKQ A;  3V64 C;  5L2Z L;  4PH9 A;  2WPL E;  5K0H B;  1CVW L;  1IGZ A;  1TOZ A;  1YUG A;  1YUF A;  4G1M B;  1UZQ A;  2Y5G L;  1IOX A;  1CCV A;  3GIS X;  2BOK L;  1MQ5 L;  2VJ3 A;  1IQI L;  2K2T A;  3FBY A;  4RS0 A;  2MGR A;  4Y79 B;  1NFX B;  1HAF A;  1HAE A;  4LMF A;  1X7A L;  1G2M B;  2W26 B;  2EI8 B;  3F1S B;  2GD4 A;  1P9J A;  2KB9 A;  4D0F A;  4D90 A;  1ADX A;  1FE2 A;  1HJ7 A;  2YGP A;  1DDX A;  2WPI E;  1HT8 A;  1YUK B; 
#chains in the Genus database with same CATH topology
 3HO3 A;  2BSF A;  1NFU B;  5KIR A;  2J34 B;  1DVA L;  3SW2 A;  1N7D A;  3LIW B;  1CEJ A;  2CJI B;  3HO5 A;  2UWP B;  3ZYG A;  1EGF A;  3U7U G;  1IQG L;  2J4I B;  3GCX E;  1HRF A;  2W2Q E;  5F19 A;  3ENS A;  1Z6C A;  4Z0L A;  5JB9 E;  1AUT L;  1FSB A;  1WHF A;  2VWL L;  5JBA E;  3H5C B;  1DQB A;  2P3U A;  1G1Q A;  3N8Z A;  1URK A;  1XKA L;  2WPH E;  3KQD L;  4A94 C;  5JVZ A;  2VWO L;  1UZK A;  4GU3 A;  5EGM B;  1Z6E L;  4OTJ A;  1OB1 C;  3LTG D;  3SOV A;  4ISI L;  2VH6 B;  3KK6 A;  4C16 A;  2KL7 A;  2UWO B;  1O5D L;  1PXX A;  4RRW A;  1UZJ A;  2PR3 B;  1IJQ A;  4BDW A;  1LMM A;  2FLR L;  3CS7 L;  1SZB A;  2MHP A;  4NG9 L;  2W86 A;  3IIT B;  3Q7D A;  2FLB L;  4Y7B B;  3LTF B;  1JV2 B;  2P28 B;  3S6X A;  3QCW A;  4GU4 A;  2YGO A;  5JW1 A;  4XLW A;  1IQN L;  4A7I A;  3NTG A;  3N8Y B;  1KIG L;  1FAX L;  4Z6A L;  4JYV L;  3HS5 A;  4JZE L;  1PGE A;  2OYU P;  1C5M F;  2VVU L;  1BF9 A;  3TK6 B;  1L3Y A;  2Q1J B;  3KRK A;  5CKQ A;  2P3T A;  2W2P E;  1UZP A;  1PFX L;  2JJL A;  5FDQ A;  3C9A C;  4ZAE B;  2J94 B;  1EMO A;  4Z0K B;  1KKE A;  2WYG B;  1HCG B;  1RFN B;  1A3P A;  2Y81 B;  3PGH A;  1V1I A;  2XC4 L;  1W7X L;  2ADX A;  4X8V L;  2BOU A;  2J38 B;  1J9C L;  4JZD L;  3V65 B;  2PHB B;  2XBX L;  3N8W A;  2TGF A;  4ZXX L;  1F7E A;  3DEM A;  1CQE A;  1FF7 A;  1K37 A;  3KQE L;  4RRZ A;  3OLT A;  1IQF L;  1LPG A;  1FAK L;  2P93 L;  1IQH L;  1HT5 A;  1NZI A;  2BZ6 L;  3LAQ A;  5F1A A;  2G00 L;  1KLO A;  4XBM A;  2KNI A;  4M10 A;  2P26 A;  3QH0 A;  5CKM A;  5KN5 C;  5COX A;  2NPR A;  3FFG L;  3BT1 A;  3LC3 B;  1MQ6 L;  3BT2 A;  1IVO C;  1COU A;  2BT8 A;  3LN1 A;  1XDT R;  4TGF A;  4ISH L;  1TPG A;  2P94 L;  4NGA L;  2P95 L;  2PUQ L;  3TK5 B;  1JBU L;  3CA7 A;  1TLE A;  2BT7 A;  2W2M E;  4YT6 L;  2P3F L;  1EBV A;  4M11 A;  2VWM K;  1IQJ L;  2FLG A;  4E1G A;  2J95 B;  1ATE A;  1EPI A;  2OYE P;  1U8C B;  2XBW L;  2XC0 L;  4MMY B;  3NT1 A;  2H9E C;  3ZYJ B;  3TGF A;  3QMO A;  2EI7 B;  2EI6 B;  3TZI A;  3K9X A;  1HZ8 A;  3HS6 A;  1G2L B;  3EGF A;  5L30 L;  3RR3 A;  1P0S L;  4O1Z A;  1FJS L;  1PTH A;  2RHP A;  1EPH A;  1JL9 A;  1KLJ L;  3ELA L;  4JZF L;  5JVY A;  2Y7Z B;  3CFW A;  1IQM L;  1DIY A;  1MOX C;  2Y80 B;  1ATB A;  2B7D L;  3LC5 B;  4BXS A;  1EMN A;  3NTB A;  3N8X A;  5E8D A;  4JYU L;  2XBY L;  1CVU A;  1M1X B;  1IQL L;  2DDU A;  4CSY A;  2BQW A;  4XL1 A;  3CEN L;  2BQ7 A;  2K2S B;  2Y7X B;  1CX2 A;  2WG3 C;  1APQ A;  1IGX A;  1IQE L;  1F7M A;  1CCF A;  1IP0 A;  3HS7 A;  4BDX A;  2Y38 A;  1HX2 A;  3ZYI B;  3BPS E;  4LOR A;  3POY A;  2WPJ E;  3R05 A;  2W2O E;  3M37 L;  2XBV L;  2P16 L;  1LMJ A;  3KL6 B;  4COX A;  4CUD A;  2BOH A;  3U73 A;  2BO2 A;  2WG4 B;  4Y7A B;  2BMG A;  2VVV L;  1ATD A;  1FFM A;  1KSN B;  4BTU A;  1QIU A;  1HRE A;  2J2U B;  1W8B L;  1IQK L;  1Q4G A;  2AYL A;  4RUT A;  1G1R A;  1LPZ A;  2VVC K;  2FZZ L;  1B9W A;  4X8S L;  1ZAQ A;  2HOR A;  3Q3K B;  4ZXY L;  2H9E L;  1APO A;  1LK9 A;  1WU1 B;  3OLU A;  2VRS A;  3IJE B;  1EQH A;  4RRY A;  2D1J B;  5IKT A;  6COX A;  4MMX B;  3HO4 A;  1IOE L;  5I46 L;  3MQE A;  4OTY A;  3M36 L;  2VH0 B;  1N1I A;  1PRH A;  1NPE B;  2W3I B;  4BXW A;  4YZU B;  3FCS B;  1EQG A;  1EAI C;  4Y6D B;  2WYJ B;  1K36 A;  2KV4 A;  5IKR A;  3N8Y A;  4YT7 L;  2F9B L;  1LQD A;  2Y82 B;  1F0S B;  3N8W B;  2WFT A;  3F6U L;  2BQ6 A;  1V1H A;  4Y76 B;  4NA9 L;  4BTT A;  1NFW B;  3HPT A;  3GCW E;  4ZHA B;  3TH3 L;  1GK5 A;  1NQL B;  3N8V A;  1LPK A;  1NT0 A;  2M74 A;  3NJP C;  1L5G B;  5L2Y L;  2WZP P;  5JB8 E;  3KQC L;  1U67 A;  2RA0 L;  2Y5F L;  4CUF A;  4MMZ B;  2MGP A;  2I9A A;  2UWL B;  2W2N E;  2P3F N;  3KCG L;  3SOQ A;  1KLI L;  5CIS A;  1F0R B;  2RNL A;  2FD6 A;  1ATA A;  2I9B A;  3LN0 A;  2XC5 L;  1V3X B;  2WPK E;  2YGQ A;  5IKV A;  1EPG A;  2WFX B;  1I0U A;  4X8U L;  2W3K B;  4ZH8 B;  4D0E A;  5CKN A;  4CUE A;  1G1S A;  1YGC L;  4RRX A;  5JBC E;  3KQB L;  2VWN L;  1DX5 I;  4AQT A;  1YO8 A;  3MDL A;  3TBD A;  2Y5H L;  3ASI A;  4X8T L;  4O02 B;  1XFE A;  2JKH L;  5JBB E;  1QFK L;  1EZQ B;  1EPJ A;  3SOB B;  4Y71 B;  3P5B L;  4BTI A;  4FM5 A;  2WPM E;  1G1T A;  1NFY B;  1XKB A;  2BOX A;  1WHE A;  5IKQ A;  3V64 C;  5L2Z L;  4PH9 A;  2WPL E;  5K0H B;  1CVW L;  1IGZ A;  1TOZ A;  1YUG A;  1YUF A;  4G1M B;  1UZQ A;  2Y5G L;  1IOX A;  1CCV A;  3GIS X;  2BOK L;  1MQ5 L;  2VJ3 A;  1IQI L;  2K2T A;  3FBY A;  4RS0 A;  2MGR A;  4Y79 B;  1NFX B;  1HAF A;  1HAE A;  4LMF A;  1X7A L;  1G2M B;  2W26 B;  2HOX A;  2EI8 B;  3F1S B;  2GD4 A;  1P9J A;  2KB9 A;  4D0F A;  4D90 A;  1ADX A;  1FE2 A;  1HJ7 A;  2YGP A;  1DDX A;  2WPI E;  1HT8 A;  1YUK B; 
#chains in the Genus database with same CATH homology
 3HO3 A;  1NFU B;  5KIR A;  2J34 B;  1DVA L;  3SW2 A;  1N7D A;  3LIW B;  1CEJ A;  2CJI B;  3HO5 A;  2UWP B;  3ZYG A;  1EGF A;  3U7U G;  1IQG L;  2J4I B;  3GCX E;  1HRF A;  2W2Q E;  5F19 A;  3ENS A;  1Z6C A;  4Z0L A;  5JB9 E;  1AUT L;  1FSB A;  1WHF A;  2VWL L;  5JBA E;  3H5C B;  1DQB A;  2P3U A;  1G1Q A;  3N8Z A;  1URK A;  1XKA L;  2WPH E;  3KQD L;  4A94 C;  5JVZ A;  2VWO L;  1UZK A;  5EGM B;  1Z6E L;  4OTJ A;  1OB1 C;  3LTG D;  3SOV A;  4ISI L;  2VH6 B;  3KK6 A;  4C16 A;  2KL7 A;  2UWO B;  1O5D L;  1PXX A;  4RRW A;  1UZJ A;  2PR3 B;  1IJQ A;  4BDW A;  1LMM A;  2FLR L;  3CS7 L;  1SZB A;  2MHP A;  4NG9 L;  2W86 A;  3IIT B;  3Q7D A;  2FLB L;  4Y7B B;  3LTF B;  1JV2 B;  2P28 B;  3S6X A;  3QCW A;  2YGO A;  5JW1 A;  4XLW A;  1IQN L;  4A7I A;  3NTG A;  3N8Y B;  1KIG L;  1FAX L;  4Z6A L;  4JYV L;  3HS5 A;  4JZE L;  1PGE A;  2OYU P;  1C5M F;  2VVU L;  1BF9 A;  3TK6 B;  1L3Y A;  2Q1J B;  3KRK A;  5CKQ A;  2P3T A;  2W2P E;  1UZP A;  1PFX L;  5FDQ A;  3C9A C;  4ZAE B;  2J94 B;  1EMO A;  4Z0K B;  2WYG B;  1HCG B;  1RFN B;  1A3P A;  2Y81 B;  3PGH A;  2XC4 L;  1W7X L;  2ADX A;  4X8V L;  2BOU A;  2J38 B;  1J9C L;  4JZD L;  3V65 B;  2PHB B;  2XBX L;  3N8W A;  2TGF A;  4ZXX L;  1F7E A;  3DEM A;  1CQE A;  1FF7 A;  1K37 A;  3KQE L;  4RRZ A;  3OLT A;  1IQF L;  1LPG A;  1FAK L;  2P93 L;  1IQH L;  1HT5 A;  1NZI A;  2BZ6 L;  3LAQ A;  5F1A A;  2G00 L;  1KLO A;  4XBM A;  2KNI A;  4M10 A;  2P26 A;  3QH0 A;  5CKM A;  5KN5 C;  5COX A;  2NPR A;  3FFG L;  3BT1 A;  3LC3 B;  1MQ6 L;  3BT2 A;  1IVO C;  1COU A;  3LN1 A;  1XDT R;  4TGF A;  4ISH L;  1TPG A;  2P94 L;  4NGA L;  2P95 L;  2PUQ L;  3TK5 B;  1JBU L;  3CA7 A;  1TLE A;  2W2M E;  4YT6 L;  2P3F L;  1EBV A;  4M11 A;  2VWM K;  1IQJ L;  2FLG A;  4E1G A;  2J95 B;  1ATE A;  1EPI A;  2OYE P;  1U8C B;  2XBW L;  2XC0 L;  4MMY B;  3NT1 A;  2H9E C;  3ZYJ B;  3TGF A;  3QMO A;  2EI7 B;  2EI6 B;  3TZI A;  3K9X A;  1HZ8 A;  3HS6 A;  1G2L B;  3EGF A;  5L30 L;  3RR3 A;  1P0S L;  4O1Z A;  1FJS L;  1PTH A;  2RHP A;  1EPH A;  1JL9 A;  1KLJ L;  3ELA L;  4JZF L;  5JVY A;  2Y7Z B;  3CFW A;  1IQM L;  1DIY A;  1MOX C;  2Y80 B;  1ATB A;  2B7D L;  3LC5 B;  4BXS A;  1EMN A;  3NTB A;  3N8X A;  5E8D A;  4JYU L;  2XBY L;  1CVU A;  1M1X B;  1IQL L;  2DDU A;  4CSY A;  2BQW A;  4XL1 A;  3CEN L;  2BQ7 A;  2K2S B;  2Y7X B;  1CX2 A;  2WG3 C;  1APQ A;  1IGX A;  1IQE L;  1F7M A;  1CCF A;  1IP0 A;  3HS7 A;  4BDX A;  2Y38 A;  1HX2 A;  3ZYI B;  3BPS E;  4LOR A;  3POY A;  2WPJ E;  3R05 A;  2W2O E;  3M37 L;  2XBV L;  2P16 L;  1LMJ A;  3KL6 B;  4COX A;  4CUD A;  2BOH A;  3U73 A;  2BO2 A;  2WG4 B;  4Y7A B;  2BMG A;  2VVV L;  1ATD A;  1FFM A;  1KSN B;  4BTU A;  1HRE A;  2J2U B;  1W8B L;  1IQK L;  1Q4G A;  2AYL A;  4RUT A;  1G1R A;  1LPZ A;  2VVC K;  2FZZ L;  1B9W A;  4X8S L;  1ZAQ A;  4ZXY L;  3Q3K B;  2H9E L;  1APO A;  1WU1 B;  3OLU A;  3IJE B;  1EQH A;  4RRY A;  2D1J B;  5IKT A;  6COX A;  4MMX B;  3HO4 A;  1IOE L;  5I46 L;  3MQE A;  4OTY A;  3M36 L;  2VH0 B;  1N1I A;  1PRH A;  1NPE B;  2W3I B;  4BXW A;  4YZU B;  3FCS B;  1EQG A;  1EAI C;  4Y6D B;  2WYJ B;  1K36 A;  2KV4 A;  5IKR A;  3N8Y A;  4YT7 L;  2F9B L;  1LQD A;  2Y82 B;  1F0S B;  3N8W B;  2WFT A;  3F6U L;  2BQ6 A;  4Y76 B;  4NA9 L;  4BTT A;  1NFW B;  3HPT A;  3GCW E;  4ZHA B;  3TH3 L;  1GK5 A;  1NQL B;  3N8V A;  1LPK A;  1NT0 A;  2M74 A;  3NJP C;  1L5G B;  5L2Y L;  2WZP P;  5JB8 E;  3KQC L;  1U67 A;  2RA0 L;  2Y5F L;  4CUF A;  4MMZ B;  2MGP A;  2I9A A;  2UWL B;  2W2N E;  2P3F N;  3KCG L;  3SOQ A;  1KLI L;  5CIS A;  1F0R B;  2RNL A;  2FD6 A;  1ATA A;  2I9B A;  3LN0 A;  2XC5 L;  1V3X B;  2WPK E;  2YGQ A;  5IKV A;  1EPG A;  2WFX B;  1I0U A;  4X8U L;  2W3K B;  4ZH8 B;  4D0E A;  5CKN A;  4CUE A;  1G1S A;  1YGC L;  4RRX A;  5JBC E;  3KQB L;  2VWN L;  1DX5 I;  4AQT A;  1YO8 A;  3MDL A;  3TBD A;  2Y5H L;  3ASI A;  4X8T L;  4O02 B;  1XFE A;  2JKH L;  5JBB E;  1QFK L;  1EZQ B;  1EPJ A;  3SOB B;  4Y71 B;  3P5B L;  4BTI A;  4FM5 A;  2WPM E;  1G1T A;  1NFY B;  1XKB A;  2BOX A;  1WHE A;  5IKQ A;  3V64 C;  5L2Z L;  4PH9 A;  2WPL E;  5K0H B;  1CVW L;  1IGZ A;  1TOZ A;  1YUG A;  1YUF A;  4G1M B;  1UZQ A;  2Y5G L;  1IOX A;  1CCV A;  3GIS X;  2BOK L;  1MQ5 L;  2VJ3 A;  1IQI L;  2K2T A;  3FBY A;  4RS0 A;  2MGR A;  4Y79 B;  1NFX B;  1HAF A;  1HAE A;  4LMF A;  1X7A L;  1G2M B;  2W26 B;  2EI8 B;  3F1S B;  2GD4 A;  1P9J A;  2KB9 A;  4D0F A;  4D90 A;  1ADX A;  1FE2 A;  1HJ7 A;  2YGP A;  1DDX A;  2WPI E;  1HT8 A;  1YUK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...