1L1IA

Solution structure of the tenebrio molitor antifreeze protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords Thermal hysteresis protein isoform YL-1 (2-14)
publication title Structure and dynamics of a beta-helical antifreeze protein.
pubmed doi rcsb
source organism Tenebrio molitor
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02420 AFP Insect antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.50 Mainly Beta 3 Solenoid Pectate Lyase C-like Insect antifreeze protein 1l1iA00
1L1IA 1EZGA
chains in the Genus database with same CATH superfamily
1OFDA 2O1DA 4YCQA 4YZXA 1DBGA 1K4ZA 2XT4A 5AMVA 2NT9A 4XLFA 2BSPA 2PYHA 3NAWA 1OGOX 2O17A 4W8TA 4YDTA 1KQ5A 4U4BA 2XT2A 4OZYA 4XLEA 3VSTA 4HWVA 1AIRA 1O8LA 1QRCA 3N90A 1K5CA 3SYJA 2BM7A 5JMCB 2X6WA 2O6WA 3RIQA 4XKWA 2EWEA 4YZ0A 1JTAA 1QJVA 3JURA 1QA2A 1RMGA 3EQOA 3KRGA 4XMYA 1OFEA 2XTWA 3AK5A 4XKVA 1KCCA 3GQ7A 2VBEA 1VBLA 2O04A 2B0RA 2X6YA 4YC5A 4Z05A 1OGMX 1EA0A 1TYWA 4U49A 4V02C 4Z06A 4XONA 1IA5A 3TH0A 2YUHA 3B8YA 4NK8A 2QZAA 4C2LA 2NSPA 4OPWA 1K8FA 3NB2A 2VBMA 3UW0A 2X85A 1OFMA 2VFNA 2VJIA 3DU1X 2V5IA 1O8DA 4KH3A 3B90A 3BH6B 1O8IA 3VSVA 1KCDA 1HG8A 3VSUA 1LM1A 2J8KA 2QX3A 1LLWA 2VFQA 2O0WA 1KTWA 1RU4A 2NZMA 4YELA 4YEIA 2BM5A 1O8HA 2VFPA 4OJ6A 4YEJA 3GQAA 4Z03A 3B4NA 1X0CA 3T9GA 2PECA 1QQ1A 4I84A 4URRA 2VFMA 4AVZA 2Z8GA 3H09A 1QA3A 3VMWA 4EW9A 4XN3A 3GQ8A 1O8GA 4MR0A 3WWGA 1OOCA 3SUCA 4NK6A 1BHEA 1O8JA 1TYXA 3BH7B 3SZEA 5C1EA 1IDKA 1O8EA 2IQ7A 3ZSCA 1WXRA 2X6XA 1LLZA 1QA1A 5JLVC 2X3HA 2G0YA 2XTYA 4XM3A 3VMVA 2INVA 2ODLA 1PLUA 2UVFA 3JX8A 1BN8A 2QYUA 4YZAA 3SY2A 1NHCA 2IOUG 1O8FA 1O8KA 2QXZA 4XORA 3SQVA 1WMRA 4MXNA 4OJOA 4OZZA 1O8MA 2XTXA 4XQFA 3ML3A 1EE6A 4YFOA 1IDJA 4XLAA 4OJPA 2NSTA 1PE9A 1XG2A 1HF2A 4XL9A 4OM9A 2VBKA 2UVEA 4JRAC 1TYUA 2O0VA 2W7ZA 2QY1A 3LMWA 4W8QA 3LYCA 3N6ZA 1TSPA 4XNFA 1CLWA 1JRGA 1H80A 2BX6A 2J8IA 4XN0A 3GQ9A 2BM4A 1GQ8A 1DBOA 2NT6A 2VFOA 4XLCA 3ZPPA 4XOPA 2NTPA 1QRBA 2NTBA 1CZFA 3FY3A 2BM6A 1IB4A 2F3LA 3P4GA 3GRHA 3EQNA 3PETA 5DNSA 4XLHA 3LJYA 2XC1A 1OFLA 4W8RA 4W8SA 3PSSA 4OJLA 1O88A 1L1IA 1PXZA 2VJJA 2PYGA 4PMHA 4XR6A 1TYVA 2NTQA 2INUA 4OJ5A 4XOTA 1EZGA 4YZQA 1QCXA 5C1CA 1RWRA 3PSZA 1DABA
chains in the Genus database with same CATH topology
3GQ9A 3GQ8A 1Z2FA 1EWWA 3SUCA 1EZGA 3GQAA 1M8NA 1L0SA 1L1IA 3GQ7A 1N4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1I A;  1EZG A; 
#chains in the Genus database with same CATH topology
 1OFD A;  2O1D A;  4YCQ A;  4YZX A;  1DBG A;  1K4Z A;  2XT4 A;  5AMV A;  2NT9 A;  4XLF A;  2BSP A;  2PYH A;  3NAW A;  1OGO X;  2O17 A;  4W8T A;  4YDT A;  1KQ5 A;  4U4B A;  2XT2 A;  4OZY A;  4XLE A;  3VST A;  4HWV A;  1AIR A;  1O8L A;  1QRC A;  3N90 A;  1K5C A;  3SYJ A;  2BM7 A;  5JMC B;  2X6W A;  2O6W A;  3RIQ A;  4XKW A;  2EWE A;  4YZ0 A;  1JTA A;  1QJV A;  3JUR A;  1QA2 A;  1RMG A;  3EQO A;  3KRG A;  4XMY A;  1OFE A;  2XTW A;  3AK5 A;  4XKV A;  1KCC A;  3GQ7 A;  2VBE A;  1VBL A;  2O04 A;  2B0R A;  2X6Y A;  4YC5 A;  4Z05 A;  1OGM X;  1EA0 A;  1TYW A;  4U49 A;  4V02 C;  4Z06 A;  4XON A;  1IA5 A;  3TH0 A;  2YUH A;  3B8Y A;  4NK8 A;  2QZA A;  4C2L A;  2NSP A;  4OPW A;  1K8F A;  3NB2 A;  2VBM A;  3UW0 A;  2X85 A;  1OFM A;  2VFN A;  2VJI A;  3DU1 X;  2V5I A;  1O8D A;  4KH3 A;  3B90 A;  3BH6 B;  1O8I A;  3VSV A;  1KCD A;  1HG8 A;  3VSU A;  1LM1 A;  2J8K A;  2QX3 A;  1LLW A;  2VFQ A;  2O0W A;  1KTW A;  1RU4 A;  2NZM A;  4YEL A;  4YEI A;  2BM5 A;  1O8H A;  2VFP A;  4OJ6 A;  4YEJ A;  3GQA A;  4Z03 A;  3B4N A;  1X0C A;  3T9G A;  2PEC A;  1QQ1 A;  4I84 A;  4URR A;  2VFM A;  4AVZ A;  2Z8G A;  3H09 A;  1QA3 A;  3VMW A;  4EW9 A;  4XN3 A;  3GQ8 A;  1O8G A;  4MR0 A;  3WWG A;  1OOC A;  3SUC A;  4NK6 A;  1BHE A;  1O8J A;  1TYX A;  3BH7 B;  3SZE A;  5C1E A;  1IDK A;  1O8E A;  2IQ7 A;  3ZSC A;  1WXR A;  2X6X A;  1LLZ A;  1QA1 A;  5JLV C;  2X3H A;  2G0Y A;  2XTY A;  4XM3 A;  3VMV A;  2INV A;  2ODL A;  1PLU A;  2UVF A;  3JX8 A;  1BN8 A;  2QYU A;  4YZA A;  3SY2 A;  1NHC A;  2IOU G;  1O8F A;  1O8K A;  2QXZ A;  4XOR A;  3SQV A;  1WMR A;  4MXN A;  4OJO A;  4OZZ A;  1O8M A;  2XTX A;  4XQF A;  3ML3 A;  1EE6 A;  4YFO A;  1IDJ A;  4XLA A;  4OJP A;  2NST A;  1PE9 A;  1XG2 A;  1HF2 A;  4XL9 A;  4OM9 A;  2VBK A;  2UVE A;  4JRA C;  1TYU A;  2O0V A;  2W7Z A;  2QY1 A;  3LMW A;  4W8Q A;  3LYC A;  3N6Z A;  1TSP A;  4XNF A;  1CLW A;  1JRG A;  1H80 A;  2BX6 A;  2J8I A;  4XN0 A;  3GQ9 A;  2BM4 A;  1GQ8 A;  1DBO A;  2NT6 A;  2VFO A;  4XLC A;  3ZPP A;  4XOP A;  2NTP A;  1QRB A;  2NTB A;  1CZF A;  3FY3 A;  2BM6 A;  1IB4 A;  2F3L A;  3P4G A;  3GRH A;  3EQN A;  3PET A;  5DNS A;  4XLH A;  3LJY A;  2XC1 A;  1OFL A;  4W8R A;  4W8S A;  3PSS A;  4OJL A;  1O88 A;  1L1I A;  1PXZ A;  2VJJ A;  2PYG A;  4PMH A;  4XR6 A;  1TYV A;  2NTQ A;  2INU A;  4OJ5 A;  4XOT A;  1EZG A;  4YZQ A;  1QCX A;  5C1C A;  1RWR A;  3PSZ A;  1DAB A; 
#chains in the Genus database with same CATH homology
 3GQ9 A;  3GQ8 A;  1Z2F A;  1EWW A;  3SUC A;  1EZG A;  3GQA A;  1M8N A;  1L0S A;  1L1I A;  3GQ7 A;  1N4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...