1L1IA

Solution structure of the tenebrio molitor antifreeze protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
b'QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermal hysteresis protein isoform YL-1 (2-14)
molecule tags Antifreeze protein
source organism Tenebrio molitor
publication title Structure and dynamics of a beta-helical antifreeze protein.
pubmed doi rcsb
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02420 AFP Insect antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.50 Mainly Beta 3 Solenoid Pectate Lyase C-like Insect antifreeze protein 1l1iA00
1L1IA 1EZGA
chains in the Genus database with same CATH superfamily
4OJ6A 4HWVA 4YC5A 2IOUG 4YZXA 1IA5A 1RMGA 4XR6A 4XOTA 2INVA 2XT2A 2B0RA 2O04A 2QX3A 1LLZA 1AIRA 4W8SA 4XN0A 3SZEA 1O8MA 1O8LA 2J8IA 2BM4A 4XORA 4I84A 5AMVA 1KTWA 4YCQA 1TYUA 2EWEA 2O6WA 3UW0A 3B4NA 3VSTA 3N6ZA 1PXZA 2F3LA 2XTYA 1LLWA 2NSPA 3NB2A 3BH6B 2BX6A 4XLCA 3EQNA 2X6XA 1DBGA 2VFNA 2XTWA 4PMHA 4W8QA 1NHCA 4KH3A 2X3HA 2O0WA 2VBKA 4XKVA 3KRGA 4AVZA 1JTAA 4XOPA 1O8KA 4XNFA 2O17A 2VBEA 3GQ8A 4YEIA 1LM1A 1OGMX 2VFOA 4NK8A 4XL9A 4EW9A 1KCCA 3AK5A 2NTBA 4XLHA 3GQ9A 1OGOX 3BH7B 1HG8A 1BN8A 1VBLA 2PYGA 2QZAA 2X85A 4MXNA 1OOCA 2VFPA 1O8IA 4XN3A 1PLUA 1OFDA 2VBMA 1HF2A 1RU4A 4XONA 4V02C 4YZQA 1CLWA 3PETA 1O8JA 4OJ5A 4C2LA 4XQFA 2X6YA 3VMWA 1O8EA 1XG2A 5C1CA 4XLFA 1O8FA 2VFMA 4MR0A 1K8FA 4YELA 1O8HA 1TYVA 2NSTA 1PE9A 2X6WA 4XMYA 1QCXA 2BM5A 3PSSA 4OJLA 2INUA 4YZAA 2NZMA 3EQOA 3NAWA 1RWRA 4U4BA 1EZGA 4URRA 2QXZA 4W8RA 3SYJA 2XTXA 5JLVC 3ML3A 3RIQA 2NTQA 2XT4A 2NT9A 1O8GA 4OM9A 2VFQA 4YDTA 1X0CA 1O88A 1K5CA 3SUCA 3JX8A 4OJPA 2V5IA 4U49A 4XKWA 1QA1A 2BM6A 1QJVA 5JMCB 1JRGA 3B90A 2YUHA 2W7ZA 2PYHA 1IDJA 2BSPA 3GQ7A 2QY1A 1QA2A 4JRAC 3DU1X 3VSVA 1QA3A 4XLAA 3LMWA 5C1EA 1QRBA 1TSPA 3TH0A 3LJYA 2BM7A 2O0VA 2UVFA 4XLEA 1DABA 1L1IA 3T9GA 1CZFA 4YFOA 3GRHA 4Z05A 3WWGA 1TYXA 2VJIA 1OFMA 3GQAA 2Z8GA 1KQ5A 3PSZA 2NTPA 2UVEA 3VSUA 4Z06A 2J8KA 2O1DA 4Z03A 1BHEA 1WXRA 1KCDA 1GQ8A 3H09A 3JURA 3FY3A 2ODLA 3P4GA 4NK6A 4OPWA 4OZYA 1IDKA 5DNSA 4OJOA 2VJJA 2XC1A 4YEJA 3B8YA 3ZPPA 3LYCA 4XM3A 3SY2A 2NT6A 1IB4A 1EA0A 4W8TA 4YZ0A 1OFEA 1OFLA 3N90A 1EE6A 1QQ1A 2IQ7A 4OZZA 3SQVA 3VMVA 1O8DA 1DBOA 1WMRA 1QRCA 1K4ZA 2G0YA 1H80A 3ZSCA 2QYUA 2PECA 1TYWA
chains in the Genus database with same CATH topology
3SUCA 3GQ7A 3GQ9A 1N4IA 1M8NA 1EZGA 1Z2FA 1EWWA 3GQAA 3GQ8A 1L1IA 1L0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1I A;  1EZG A; 
#chains in the Genus database with same CATH topology
 4OJ6 A;  4HWV A;  4YC5 A;  2IOU G;  4YZX A;  1IA5 A;  1RMG A;  4XR6 A;  4XOT A;  2INV A;  2XT2 A;  2B0R A;  2O04 A;  2QX3 A;  1LLZ A;  1AIR A;  4W8S A;  4XN0 A;  3SZE A;  1O8M A;  1O8L A;  2J8I A;  2BM4 A;  4XOR A;  4I84 A;  5AMV A;  1KTW A;  4YCQ A;  1TYU A;  2EWE A;  2O6W A;  3UW0 A;  3B4N A;  3VST A;  3N6Z A;  1PXZ A;  2F3L A;  2XTY A;  1LLW A;  2NSP A;  3NB2 A;  3BH6 B;  2BX6 A;  4XLC A;  3EQN A;  2X6X A;  1DBG A;  2VFN A;  2XTW A;  4PMH A;  4W8Q A;  1NHC A;  4KH3 A;  2X3H A;  2O0W A;  2VBK A;  4XKV A;  3KRG A;  4AVZ A;  1JTA A;  4XOP A;  1O8K A;  4XNF A;  2O17 A;  2VBE A;  3GQ8 A;  4YEI A;  1LM1 A;  1OGM X;  2VFO A;  4NK8 A;  4XL9 A;  4EW9 A;  1KCC A;  3AK5 A;  2NTB A;  4XLH A;  3GQ9 A;  1OGO X;  3BH7 B;  1HG8 A;  1BN8 A;  1VBL A;  2PYG A;  2QZA A;  2X85 A;  4MXN A;  1OOC A;  2VFP A;  1O8I A;  4XN3 A;  1PLU A;  1OFD A;  2VBM A;  1HF2 A;  1RU4 A;  4XON A;  4V02 C;  4YZQ A;  1CLW A;  3PET A;  1O8J A;  4OJ5 A;  4C2L A;  4XQF A;  2X6Y A;  3VMW A;  1O8E A;  1XG2 A;  5C1C A;  4XLF A;  1O8F A;  2VFM A;  4MR0 A;  1K8F A;  4YEL A;  1O8H A;  1TYV A;  2NST A;  1PE9 A;  2X6W A;  4XMY A;  1QCX A;  2BM5 A;  3PSS A;  4OJL A;  2INU A;  4YZA A;  2NZM A;  3EQO A;  3NAW A;  1RWR A;  4U4B A;  1EZG A;  4URR A;  2QXZ A;  4W8R A;  3SYJ A;  2XTX A;  5JLV C;  3ML3 A;  3RIQ A;  2NTQ A;  2XT4 A;  2NT9 A;  1O8G A;  4OM9 A;  2VFQ A;  4YDT A;  1X0C A;  1O88 A;  1K5C A;  3SUC A;  3JX8 A;  4OJP A;  2V5I A;  4U49 A;  4XKW A;  1QA1 A;  2BM6 A;  1QJV A;  5JMC B;  1JRG A;  3B90 A;  2YUH A;  2W7Z A;  2PYH A;  1IDJ A;  2BSP A;  3GQ7 A;  2QY1 A;  1QA2 A;  4JRA C;  3DU1 X;  3VSV A;  1QA3 A;  4XLA A;  3LMW A;  5C1E A;  1QRB A;  1TSP A;  3TH0 A;  3LJY A;  2BM7 A;  2O0V A;  2UVF A;  4XLE A;  1DAB A;  1L1I A;  3T9G A;  1CZF A;  4YFO A;  3GRH A;  4Z05 A;  3WWG A;  1TYX A;  2VJI A;  1OFM A;  3GQA A;  2Z8G A;  1KQ5 A;  3PSZ A;  2NTP A;  2UVE A;  3VSU A;  4Z06 A;  2J8K A;  2O1D A;  4Z03 A;  1BHE A;  1WXR A;  1KCD A;  1GQ8 A;  3H09 A;  3JUR A;  3FY3 A;  2ODL A;  3P4G A;  4NK6 A;  4OPW A;  4OZY A;  1IDK A;  5DNS A;  4OJO A;  2VJJ A;  2XC1 A;  4YEJ A;  3B8Y A;  3ZPP A;  3LYC A;  4XM3 A;  3SY2 A;  2NT6 A;  1IB4 A;  1EA0 A;  4W8T A;  4YZ0 A;  1OFE A;  1OFL A;  3N90 A;  1EE6 A;  1QQ1 A;  2IQ7 A;  4OZZ A;  3SQV A;  3VMV A;  1O8D A;  1DBO A;  1WMR A;  1QRC A;  1K4Z A;  2G0Y A;  1H80 A;  3ZSC A;  2QYU A;  2PEC A;  1TYW A; 
#chains in the Genus database with same CATH homology
 3SUC A;  3GQ7 A;  3GQ9 A;  1N4I A;  1M8N A;  1EZG A;  1Z2F A;  1EWW A;  3GQA A;  3GQ8 A;  1L1I A;  1L0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...