1L1IA

Solution structure of the tenebrio molitor antifreeze protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of a beta-helical antifreeze protein.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Antifreeze protein
molecule keywords Thermal hysteresis protein isoform YL-1 (2-14)
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02420 AFP Insect antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.50 Mainly Beta 3 Solenoid Pectate Lyase C-like Insect antifreeze protein 1l1iA00
1EZGA 1L1IA
chains in the Genus database with same CATH superfamily
4MR0A 3N90A 1EE6A 4U4BA 4Z06A 1TSPA 2VFNA 2PECA 1JTAA 1DBGA 1TYUA 3GQAA 4XONA 4XORA 2NTQA 2NT6A 4XM3A 5JLVC 2BM5A 2VFOA 3B8YA 4OJPA 4YEIA 1RU4A 4JRAC 4V02C 1OFLA 1LLZA 3LYCA 4XKVA 1PLUA 1L1IA 3PETA 1KTWA 4YFOA 2VBEA 2X85A 1QCXA 1QRCA 4XLEA 1TYVA 2B0RA 2EWEA 1EZGA 3JX8A 4YC5A 5AMVA 4YDTA 4KH3A 3N6ZA 3GQ9A 2NTBA 4NK8A 4XKWA 1IDKA 1QQ1A 1O8JA 4YELA 2XC1A 3B90A 4XQFA 2F3LA 4XLHA 2INUA 1IB4A 1QA1A 2QXZA 3H09A 2X3HA 4I84A 4Z03A 1PE9A 3VSVA 2VJJA 4OZZA 3GQ8A 1IDJA 2O0WA 4URRA 1BHEA 3JURA 3GRHA 4YZXA 2QZAA 1OGMX 1RMGA 2UVFA 3AK5A 4XL9A 1EA0A 1O88A 1OFMA 3ML3A 2O1DA 4YZAA 1BN8A 3EQOA 1O8MA 1OFEA 4YZQA 4MXNA 3PSZA 4U49A 4XN3A 1IA5A 4W8TA 1KCCA 2VFPA 3B4NA 2J8IA 1KQ5A 2BSPA 1NHCA 1TYXA 2QYUA 4XNFA 2NTPA 1HG8A 3PSSA 3VSUA 2YUHA 2X6XA 3SUCA 4XLAA 1O8LA 2XTYA 4OJ6A 2UVEA 3RIQA 1LLWA 1OFDA 1O8IA 4C2LA 2BM6A 1QA3A 1K8FA 2NSPA 2VFMA 3FY3A 3VMWA 1HF2A 2INVA 4EW9A 3EQNA 1AIRA 2VBKA 1O8FA 2BM7A 2NZMA 2VBMA 1X0CA 2X6YA 3T9GA 3VSTA 1CZFA 1PXZA 2BM4A 4XLFA 1WXRA 1QRBA 2O0VA 2QY1A 1JRGA 2VFQA 3LMWA 1O8DA 3LJYA 5DNSA 1XG2A 1CLWA 2XTXA 4NK6A 1O8HA 4OJ5A 3BH6B 4OPWA 1QA2A 3P4GA 1O8GA 3KRGA 3NB2A 2XT4A 5C1CA 2O04A 1LM1A 2NT9A 1K4ZA 4OJLA 4XOTA 3TH0A 4XOPA 3SZEA 1OGOX 3SQVA 2PYHA 2ODLA 3BH7B 4XR6A 3VMVA 2IOUG 4AVZA 2NSTA 3ZSCA 2IQ7A 4YZ0A 4XMYA 3ZPPA 2W7ZA 1QJVA 1K5CA 2VJIA 1GQ8A 1TYWA 2O17A 2XTWA 3SY2A 3SYJA 2BX6A 4OZYA 3DU1X 3WWGA 1WMRA 2O6WA 1DBOA 4XN0A 5C1EA 2PYGA 2Z8GA 3NAWA 4Z05A 3GQ7A 4PMHA 2XT2A 2G0YA 4W8SA 4W8QA 3UW0A 1DABA 1RWRA 4XLCA 1O8EA 2QX3A 4OM9A 1O8KA 4HWVA 1H80A 5JMCB 2X6WA 1OOCA 1KCDA 4YCQA 4OJOA 4YEJA 2J8KA 2V5IA 1VBLA 4W8RA
chains in the Genus database with same CATH topology
1EWWA 1L1IA 1N4IA 3GQ7A 3GQ9A 1Z2FA 1M8NA 3GQ8A 3GQAA 3SUCA 1EZGA 1L0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZG A;  1L1I A; 
#chains in the Genus database with same CATH topology
 4MR0 A;  3N90 A;  1EE6 A;  4U4B A;  4Z06 A;  1TSP A;  2VFN A;  2PEC A;  1JTA A;  1DBG A;  1TYU A;  3GQA A;  4XON A;  4XOR A;  2NTQ A;  2NT6 A;  4XM3 A;  5JLV C;  2BM5 A;  2VFO A;  3B8Y A;  4OJP A;  4YEI A;  1RU4 A;  4JRA C;  4V02 C;  1OFL A;  1LLZ A;  3LYC A;  4XKV A;  1PLU A;  1L1I A;  3PET A;  1KTW A;  4YFO A;  2VBE A;  2X85 A;  1QCX A;  1QRC A;  4XLE A;  1TYV A;  2B0R A;  2EWE A;  1EZG A;  3JX8 A;  4YC5 A;  5AMV A;  4YDT A;  4KH3 A;  3N6Z A;  3GQ9 A;  2NTB A;  4NK8 A;  4XKW A;  1IDK A;  1QQ1 A;  1O8J A;  4YEL A;  2XC1 A;  3B90 A;  4XQF A;  2F3L A;  4XLH A;  2INU A;  1IB4 A;  1QA1 A;  2QXZ A;  3H09 A;  2X3H A;  4I84 A;  4Z03 A;  1PE9 A;  3VSV A;  2VJJ A;  4OZZ A;  3GQ8 A;  1IDJ A;  2O0W A;  4URR A;  1BHE A;  3JUR A;  3GRH A;  4YZX A;  2QZA A;  1OGM X;  1RMG A;  2UVF A;  3AK5 A;  4XL9 A;  1EA0 A;  1O88 A;  1OFM A;  3ML3 A;  2O1D A;  4YZA A;  1BN8 A;  3EQO A;  1O8M A;  1OFE A;  4YZQ A;  4MXN A;  3PSZ A;  4U49 A;  4XN3 A;  1IA5 A;  4W8T A;  1KCC A;  2VFP A;  3B4N A;  2J8I A;  1KQ5 A;  2BSP A;  1NHC A;  1TYX A;  2QYU A;  4XNF A;  2NTP A;  1HG8 A;  3PSS A;  3VSU A;  2YUH A;  2X6X A;  3SUC A;  4XLA A;  1O8L A;  2XTY A;  4OJ6 A;  2UVE A;  3RIQ A;  1LLW A;  1OFD A;  1O8I A;  4C2L A;  2BM6 A;  1QA3 A;  1K8F A;  2NSP A;  2VFM A;  3FY3 A;  3VMW A;  1HF2 A;  2INV A;  4EW9 A;  3EQN A;  1AIR A;  2VBK A;  1O8F A;  2BM7 A;  2NZM A;  2VBM A;  1X0C A;  2X6Y A;  3T9G A;  3VST A;  1CZF A;  1PXZ A;  2BM4 A;  4XLF A;  1WXR A;  1QRB A;  2O0V A;  2QY1 A;  1JRG A;  2VFQ A;  3LMW A;  1O8D A;  3LJY A;  5DNS A;  1XG2 A;  1CLW A;  2XTX A;  4NK6 A;  1O8H A;  4OJ5 A;  3BH6 B;  4OPW A;  1QA2 A;  3P4G A;  1O8G A;  3KRG A;  3NB2 A;  2XT4 A;  5C1C A;  2O04 A;  1LM1 A;  2NT9 A;  1K4Z A;  4OJL A;  4XOT A;  3TH0 A;  4XOP A;  3SZE A;  1OGO X;  3SQV A;  2PYH A;  2ODL A;  3BH7 B;  4XR6 A;  3VMV A;  2IOU G;  4AVZ A;  2NST A;  3ZSC A;  2IQ7 A;  4YZ0 A;  4XMY A;  3ZPP A;  2W7Z A;  1QJV A;  1K5C A;  2VJI A;  1GQ8 A;  1TYW A;  2O17 A;  2XTW A;  3SY2 A;  3SYJ A;  2BX6 A;  4OZY A;  3DU1 X;  3WWG A;  1WMR A;  2O6W A;  1DBO A;  4XN0 A;  5C1E A;  2PYG A;  2Z8G A;  3NAW A;  4Z05 A;  3GQ7 A;  4PMH A;  2XT2 A;  2G0Y A;  4W8S A;  4W8Q A;  3UW0 A;  1DAB A;  1RWR A;  4XLC A;  1O8E A;  2QX3 A;  4OM9 A;  1O8K A;  4HWV A;  1H80 A;  5JMC B;  2X6W A;  1OOC A;  1KCD A;  4YCQ A;  4OJO A;  4YEJ A;  2J8K A;  2V5I A;  1VBL A;  4W8R A; 
#chains in the Genus database with same CATH homology
 1EWW A;  1L1I A;  1N4I A;  3GQ7 A;  3GQ9 A;  1Z2F A;  1M8N A;  3GQ8 A;  3GQA A;  3SUC A;  1EZG A;  1L0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...