1L1IA

Solution structure of the tenebrio molitor antifreeze protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermal hysteresis protein isoform YL-1 (2-14)
publication title Structure and dynamics of a beta-helical antifreeze protein.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Antifreeze protein
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02420 AFP Insect antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.50 Mainly Beta 3 Solenoid Pectate Lyase C-like Insect antifreeze protein 1l1iA00
1EZGA 1L1IA
chains in the Genus database with same CATH superfamily
1HG8A 3JURA 3SQVA 4XMYA 1BN8A 1OGOX 2O6WA 3PETA 1VBLA 4YCQA 4YEIA 4I84A 3LJYA 1O8FA 1EE6A 1QRBA 2O0WA 2XT2A 3EQOA 4JRAC 3VMVA 3VSTA 2O0VA 3LYCA 4XLEA 2XT4A 1QA3A 4OJPA 2BM7A 3SZEA 1O88A 1JTAA 2X6WA 3GQ8A 5C1EA 2BSPA 4XN3A 1PXZA 3N6ZA 2NSTA 4OPWA 1OFDA 2INVA 3NAWA 1QCXA 3VSUA 2Z8GA 3ZSCA 3EQNA 4C2LA 2VJIA 3B90A 2XTWA 4Z03A 2O17A 1H80A 1EA0A 4YEJA 1LLWA 1WXRA 3TH0A 2UVFA 3B8YA 1PE9A 2VFNA 4W8QA 3FY3A 1O8JA 2O04A 4XOPA 4OJOA 4OJ5A 4YZXA 2QXZA 3VMWA 2NTBA 1TYWA 1GQ8A 1PLUA 1QJVA 4PMHA 4YZ0A 4V02C 4XLCA 2W7ZA 1WMRA 2F3LA 5JMCB 4Z06A 4Z05A 4EW9A 5C1CA 1DBGA 4U49A 1BHEA 1RU4A 2VFPA 3GQAA 2PECA 2NT6A 1TYVA 4HWVA 3BH7B 2VBEA 1TSPA 3B4NA 1IA5A 2PYGA 1O8HA 2B0RA 1QQ1A 1QRCA 2PYHA 2VBMA 3N90A 2X6XA 4YZQA 2QZAA 1LM1A 1K5CA 1O8DA 3PSZA 1OGMX 1XG2A 1LLZA 3SY2A 1KCCA 1OFMA 4W8SA 2VBKA 2X85A 4XONA 3BH6B 4KH3A 2UVEA 4URRA 1X0CA 3ZPPA 1DBOA 2BX6A 3GQ7A 3P4GA 4XOTA 4AVZA 1TYXA 2NSPA 1O8MA 5AMVA 4W8TA 1RMGA 4OZYA 1KCDA 1O8EA 2NZMA 4XLAA 2O1DA 4YC5A 1L1IA 2YUHA 3SUCA 3SYJA 2V5IA 2IOUG 4XM3A 1NHCA 3T9GA 3RIQA 2NTQA 2VJJA 1IDJA 2IQ7A 3KRGA 3AK5A 4YFOA 5JLVC 2NTPA 2QX3A 2VFMA 1AIRA 2G0YA 3GRHA 3H09A 4XNFA 1CLWA 3NB2A 2VFOA 1O8IA 1JRGA 2INUA 1KQ5A 2EWEA 4XKWA 4YELA 4U4BA 1HF2A 3ML3A 2VFQA 1O8GA 3PSSA 4XLFA 4OJ6A 1O8KA 2X6YA 3UW0A 4MR0A 4W8RA 4XR6A 4NK6A 4OZZA 2BM5A 3GQ9A 2BM6A 4YZAA 3VSVA 1IB4A 4NK8A 1KTWA 4XN0A 1CZFA 2BM4A 1K4ZA 3JX8A 4XQFA 2NT9A 2XC1A 2ODLA 2QY1A 1TYUA 1OFEA 2X3HA 2QYUA 3LMWA 4XLHA 1K8FA 4OJLA 4YDTA 1IDKA 1QA1A 3WWGA 1DABA 5DNSA 2XTYA 4XL9A 1OOCA 4XKVA 2XTXA 1QA2A 1OFLA 4XORA 1O8LA 2J8IA 1EZGA 4MXNA 4OM9A 1RWRA 2J8KA 3DU1X
chains in the Genus database with same CATH topology
3GQ8A 3GQ7A 3GQ9A 1L1IA 3GQAA 3SUCA 1L0SA 1Z2FA 1N4IA 1EZGA 1EWWA 1M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZG A;  1L1I A; 
#chains in the Genus database with same CATH topology
 1HG8 A;  3JUR A;  3SQV A;  4XMY A;  1BN8 A;  1OGO X;  2O6W A;  3PET A;  1VBL A;  4YCQ A;  4YEI A;  4I84 A;  3LJY A;  1O8F A;  1EE6 A;  1QRB A;  2O0W A;  2XT2 A;  3EQO A;  4JRA C;  3VMV A;  3VST A;  2O0V A;  3LYC A;  4XLE A;  2XT4 A;  1QA3 A;  4OJP A;  2BM7 A;  3SZE A;  1O88 A;  1JTA A;  2X6W A;  3GQ8 A;  5C1E A;  2BSP A;  4XN3 A;  1PXZ A;  3N6Z A;  2NST A;  4OPW A;  1OFD A;  2INV A;  3NAW A;  1QCX A;  3VSU A;  2Z8G A;  3ZSC A;  3EQN A;  4C2L A;  2VJI A;  3B90 A;  2XTW A;  4Z03 A;  2O17 A;  1H80 A;  1EA0 A;  4YEJ A;  1LLW A;  1WXR A;  3TH0 A;  2UVF A;  3B8Y A;  1PE9 A;  2VFN A;  4W8Q A;  3FY3 A;  1O8J A;  2O04 A;  4XOP A;  4OJO A;  4OJ5 A;  4YZX A;  2QXZ A;  3VMW A;  2NTB A;  1TYW A;  1GQ8 A;  1PLU A;  1QJV A;  4PMH A;  4YZ0 A;  4V02 C;  4XLC A;  2W7Z A;  1WMR A;  2F3L A;  5JMC B;  4Z06 A;  4Z05 A;  4EW9 A;  5C1C A;  1DBG A;  4U49 A;  1BHE A;  1RU4 A;  2VFP A;  3GQA A;  2PEC A;  2NT6 A;  1TYV A;  4HWV A;  3BH7 B;  2VBE A;  1TSP A;  3B4N A;  1IA5 A;  2PYG A;  1O8H A;  2B0R A;  1QQ1 A;  1QRC A;  2PYH A;  2VBM A;  3N90 A;  2X6X A;  4YZQ A;  2QZA A;  1LM1 A;  1K5C A;  1O8D A;  3PSZ A;  1OGM X;  1XG2 A;  1LLZ A;  3SY2 A;  1KCC A;  1OFM A;  4W8S A;  2VBK A;  2X85 A;  4XON A;  3BH6 B;  4KH3 A;  2UVE A;  4URR A;  1X0C A;  3ZPP A;  1DBO A;  2BX6 A;  3GQ7 A;  3P4G A;  4XOT A;  4AVZ A;  1TYX A;  2NSP A;  1O8M A;  5AMV A;  4W8T A;  1RMG A;  4OZY A;  1KCD A;  1O8E A;  2NZM A;  4XLA A;  2O1D A;  4YC5 A;  1L1I A;  2YUH A;  3SUC A;  3SYJ A;  2V5I A;  2IOU G;  4XM3 A;  1NHC A;  3T9G A;  3RIQ A;  2NTQ A;  2VJJ A;  1IDJ A;  2IQ7 A;  3KRG A;  3AK5 A;  4YFO A;  5JLV C;  2NTP A;  2QX3 A;  2VFM A;  1AIR A;  2G0Y A;  3GRH A;  3H09 A;  4XNF A;  1CLW A;  3NB2 A;  2VFO A;  1O8I A;  1JRG A;  2INU A;  1KQ5 A;  2EWE A;  4XKW A;  4YEL A;  4U4B A;  1HF2 A;  3ML3 A;  2VFQ A;  1O8G A;  3PSS A;  4XLF A;  4OJ6 A;  1O8K A;  2X6Y A;  3UW0 A;  4MR0 A;  4W8R A;  4XR6 A;  4NK6 A;  4OZZ A;  2BM5 A;  3GQ9 A;  2BM6 A;  4YZA A;  3VSV A;  1IB4 A;  4NK8 A;  1KTW A;  4XN0 A;  1CZF A;  2BM4 A;  1K4Z A;  3JX8 A;  4XQF A;  2NT9 A;  2XC1 A;  2ODL A;  2QY1 A;  1TYU A;  1OFE A;  2X3H A;  2QYU A;  3LMW A;  4XLH A;  1K8F A;  4OJL A;  4YDT A;  1IDK A;  1QA1 A;  3WWG A;  1DAB A;  5DNS A;  2XTY A;  4XL9 A;  1OOC A;  4XKV A;  2XTX A;  1QA2 A;  1OFL A;  4XOR A;  1O8L A;  2J8I A;  1EZG A;  4MXN A;  4OM9 A;  1RWR A;  2J8K A;  3DU1 X; 
#chains in the Genus database with same CATH homology
 3GQ8 A;  3GQ7 A;  3GQ9 A;  1L1I A;  3GQA A;  3SUC A;  1L0S A;  1Z2F A;  1N4I A;  1EZG A;  1EWW A;  1M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...