1L1IA

Solution structure of the tenebrio molitor antifreeze protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermal hysteresis protein isoform YL-1 (2-14)
publication title Structure and dynamics of a beta-helical antifreeze protein.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Antifreeze protein
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02420 AFP Insect antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.50 Mainly Beta 3 Solenoid Pectate Lyase C-like Insect antifreeze protein 1l1iA00
1L1IA 1EZGA
chains in the Genus database with same CATH superfamily
1O8LA 4YZAA 2O1DA 3AK5A 3VSTA 4YELA 4OZZA 1DABA 3VMWA 1O8IA 1O8DA 3SY2A 4V02C 1HF2A 2NTPA 3FY3A 4MR0A 4OPWA 3PETA 1K8FA 1OGOX 2O0WA 2UVEA 4YEIA 2NZMA 1XG2A 3EQOA 3EQNA 1TYXA 2IQ7A 1PE9A 2VFNA 3T9GA 1RWRA 1QA3A 4XMYA 4OJLA 1K5CA 2BM6A 2NT6A 1QRBA 2XT2A 2O17A 3NAWA 4MXNA 4OM9A 4XL9A 4XLEA 2XC1A 4Z03A 4XONA 3SUCA 1QA2A 2VJJA 1L1IA 3JURA 1X0CA 3GQAA 1BHEA 1K4ZA 4OJ5A 1JRGA 2X85A 2ODLA 2BX6A 2EWEA 2PECA 4XR6A 2V5IA 2J8IA 2XTWA 1IDJA 4XNFA 5C1EA 3GQ9A 4YZ0A 1TSPA 2NTBA 1OFDA 2NSTA 4XKVA 5DNSA 4YC5A 3ZPPA 2QXZA 4XLAA 4XOTA 1OFEA 2X6YA 3TH0A 2XT4A 2XTYA 1NHCA 4U4BA 4YZXA 1H80A 1O8KA 2VFQA 4XKWA 1EA0A 3SYJA 1QJVA 4OJ6A 4XN0A 2VFPA 4EW9A 1OOCA 3GQ8A 1CZFA 2NTQA 3LJYA 1KCDA 1O8JA 3BH7B 2BM7A 1WXRA 4YCQA 4W8RA 1GQ8A 1IA5A 1QA1A 2IOUG 3SZEA 2VFMA 4XOPA 1TYVA 5JMCB 4W8QA 3UW0A 2W7ZA 4I84A 3RIQA 2Z8GA 1VBLA 2VJIA 4OJPA 2QX3A 4XM3A 2X3HA 2QYUA 1EE6A 1DBGA 2O6WA 1O8EA 2X6XA 4NK6A 3ML3A 4Z05A 3B90A 1EZGA 2O0VA 5JLVC 1O8MA 2PYHA 2QY1A 4XN3A 1TYWA 4KH3A 4YZQA 3SQVA 2BM4A 1O8GA 3B4NA 4YFOA 5C1CA 3N90A 1PLUA 3NB2A 4YEJA 1KTWA 1DBOA 1PXZA 1QCXA 1IDKA 4YDTA 4OJOA 3WWGA 4JRAC 3GQ7A 2QZAA 2VFOA 4XORA 5AMVA 1OFMA 2INUA 2UVFA 4PMHA 3GRHA 1HG8A 2F3LA 1BN8A 4XQFA 1JTAA 3N6ZA 1IB4A 3DU1X 2VBMA 2VBEA 2PYGA 3B8YA 2INVA 2X6WA 3PSSA 4OZYA 4XLFA 3BH6B 1KQ5A 1LLZA 1LLWA 2G0YA 1AIRA 3LYCA 2O04A 1RMGA 4NK8A 1QRCA 4HWVA 1O8FA 4W8SA 2XTXA 3P4GA 4U49A 2J8KA 3KRGA 2B0RA 4URRA 1LM1A 1TYUA 2YUHA 2NSPA 3H09A 1OFLA 3LMWA 1RU4A 1O8HA 4AVZA 3ZSCA 3VSVA 4Z06A 2BM5A 3VMVA 1KCCA 4XLHA 1O88A 2VBKA 2BSPA 2NT9A 1QQ1A 4XLCA 1CLWA 1WMRA 1OGMX 3JX8A 4W8TA 3VSUA 3PSZA 4C2LA
chains in the Genus database with same CATH topology
3GQ9A 1EWWA 3GQ8A 1N4IA 3SUCA 1L1IA 1L0SA 3GQ7A 1EZGA 1M8NA 1Z2FA 3GQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1I A;  1EZG A; 
#chains in the Genus database with same CATH topology
 1O8L A;  4YZA A;  2O1D A;  3AK5 A;  3VST A;  4YEL A;  4OZZ A;  1DAB A;  3VMW A;  1O8I A;  1O8D A;  3SY2 A;  4V02 C;  1HF2 A;  2NTP A;  3FY3 A;  4MR0 A;  4OPW A;  3PET A;  1K8F A;  1OGO X;  2O0W A;  2UVE A;  4YEI A;  2NZM A;  1XG2 A;  3EQO A;  3EQN A;  1TYX A;  2IQ7 A;  1PE9 A;  2VFN A;  3T9G A;  1RWR A;  1QA3 A;  4XMY A;  4OJL A;  1K5C A;  2BM6 A;  2NT6 A;  1QRB A;  2XT2 A;  2O17 A;  3NAW A;  4MXN A;  4OM9 A;  4XL9 A;  4XLE A;  2XC1 A;  4Z03 A;  4XON A;  3SUC A;  1QA2 A;  2VJJ A;  1L1I A;  3JUR A;  1X0C A;  3GQA A;  1BHE A;  1K4Z A;  4OJ5 A;  1JRG A;  2X85 A;  2ODL A;  2BX6 A;  2EWE A;  2PEC A;  4XR6 A;  2V5I A;  2J8I A;  2XTW A;  1IDJ A;  4XNF A;  5C1E A;  3GQ9 A;  4YZ0 A;  1TSP A;  2NTB A;  1OFD A;  2NST A;  4XKV A;  5DNS A;  4YC5 A;  3ZPP A;  2QXZ A;  4XLA A;  4XOT A;  1OFE A;  2X6Y A;  3TH0 A;  2XT4 A;  2XTY A;  1NHC A;  4U4B A;  4YZX A;  1H80 A;  1O8K A;  2VFQ A;  4XKW A;  1EA0 A;  3SYJ A;  1QJV A;  4OJ6 A;  4XN0 A;  2VFP A;  4EW9 A;  1OOC A;  3GQ8 A;  1CZF A;  2NTQ A;  3LJY A;  1KCD A;  1O8J A;  3BH7 B;  2BM7 A;  1WXR A;  4YCQ A;  4W8R A;  1GQ8 A;  1IA5 A;  1QA1 A;  2IOU G;  3SZE A;  2VFM A;  4XOP A;  1TYV A;  5JMC B;  4W8Q A;  3UW0 A;  2W7Z A;  4I84 A;  3RIQ A;  2Z8G A;  1VBL A;  2VJI A;  4OJP A;  2QX3 A;  4XM3 A;  2X3H A;  2QYU A;  1EE6 A;  1DBG A;  2O6W A;  1O8E A;  2X6X A;  4NK6 A;  3ML3 A;  4Z05 A;  3B90 A;  1EZG A;  2O0V A;  5JLV C;  1O8M A;  2PYH A;  2QY1 A;  4XN3 A;  1TYW A;  4KH3 A;  4YZQ A;  3SQV A;  2BM4 A;  1O8G A;  3B4N A;  4YFO A;  5C1C A;  3N90 A;  1PLU A;  3NB2 A;  4YEJ A;  1KTW A;  1DBO A;  1PXZ A;  1QCX A;  1IDK A;  4YDT A;  4OJO A;  3WWG A;  4JRA C;  3GQ7 A;  2QZA A;  2VFO A;  4XOR A;  5AMV A;  1OFM A;  2INU A;  2UVF A;  4PMH A;  3GRH A;  1HG8 A;  2F3L A;  1BN8 A;  4XQF A;  1JTA A;  3N6Z A;  1IB4 A;  3DU1 X;  2VBM A;  2VBE A;  2PYG A;  3B8Y A;  2INV A;  2X6W A;  3PSS A;  4OZY A;  4XLF A;  3BH6 B;  1KQ5 A;  1LLZ A;  1LLW A;  2G0Y A;  1AIR A;  3LYC A;  2O04 A;  1RMG A;  4NK8 A;  1QRC A;  4HWV A;  1O8F A;  4W8S A;  2XTX A;  3P4G A;  4U49 A;  2J8K A;  3KRG A;  2B0R A;  4URR A;  1LM1 A;  1TYU A;  2YUH A;  2NSP A;  3H09 A;  1OFL A;  3LMW A;  1RU4 A;  1O8H A;  4AVZ A;  3ZSC A;  3VSV A;  4Z06 A;  2BM5 A;  3VMV A;  1KCC A;  4XLH A;  1O88 A;  2VBK A;  2BSP A;  2NT9 A;  1QQ1 A;  4XLC A;  1CLW A;  1WMR A;  1OGM X;  3JX8 A;  4W8T A;  3VSU A;  3PSZ A;  4C2L A; 
#chains in the Genus database with same CATH homology
 3GQ9 A;  1EWW A;  3GQ8 A;  1N4I A;  3SUC A;  1L1I A;  1L0S A;  3GQ7 A;  1EZG A;  1M8N A;  1Z2F A;  3GQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...