1L1IA

Solution structure of the tenebrio molitor antifreeze protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of a beta-helical antifreeze protein.
pubmed doi rcsb
source organism Tenebrio molitor
molecule tags Antifreeze protein
molecule keywords Thermal hysteresis protein isoform YL-1 (2-14)
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2002-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02420 AFP Insect antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.50 Mainly Beta 3 Solenoid Pectate Lyase C-like Insect antifreeze protein 1l1iA00
1L1IA 1EZGA
chains in the Genus database with same CATH superfamily
1WXRA 1EZGA 4MR0A 1OGOX 1X0CA 3KRGA 4OJ5A 4YEIA 5C1CA 3EQOA 2BM4A 1RMGA 3N90A 2XTWA 4XORA 1LLZA 1PE9A 2YUHA 2VFOA 3VMWA 1JRGA 2X6WA 1XG2A 2X6YA 1DABA 1IA5A 2J8IA 3NB2A 1NHCA 2EWEA 3B8YA 2PECA 3VSUA 2PYHA 4XR6A 2UVEA 2QZAA 5JMCB 2VJJA 2X85A 2BM5A 3SY2A 4AVZA 4V02C 1OFDA 2O6WA 4YDTA 2G0YA 3VSTA 3P4GA 3SQVA 2O04A 3PETA 1L1IA 1IDJA 3SUCA 1QCXA 4Z03A 2NT6A 4XMYA 2F3LA 2VFNA 4YEJA 1QRCA 1JTAA 3ZSCA 1TYXA 1VBLA 1LLWA 2NSPA 1HG8A 3GQ9A 2X6XA 3AK5A 2QXZA 4Z05A 1IB4A 2O0VA 4YZAA 1KCDA 4XN3A 1WMRA 4NK8A 4OPWA 4XLAA 2O1DA 2VFPA 1O8DA 4YZXA 1O8JA 4YFOA 2BM7A 1K8FA 4XQFA 1OGMX 3WWGA 2O17A 4JRAC 4XLEA 1O8MA 2XTXA 1O8HA 4NK6A 5C1EA 3SYJA 2INVA 2O0WA 1PXZA 1QA3A 2BSPA 4MXNA 2XC1A 2XT2A 3JX8A 1CZFA 3GQAA 3PSSA 1LM1A 4XM3A 2VBEA 1AIRA 4XL9A 2NTPA 3BH6B 2W7ZA 4YC5A 3LJYA 2NSTA 1TYVA 5JLVC 3GQ7A 1KCCA 1O8FA 1IDKA 3UW0A 3GRHA 4YZ0A 1QJVA 3B4NA 1GQ8A 3PSZA 2NT9A 1KQ5A 2QYUA 4OJPA 1O8GA 1TSPA 4OM9A 4W8RA 3VSVA 4EW9A 2XTYA 3FY3A 4W8QA 4YELA 1O8EA 4XKVA 1K5CA 2ODLA 2IQ7A 2UVFA 3GQ8A 3BH7B 4W8TA 3SZEA 3VMVA 4PMHA 1K4ZA 4XNFA 1DBGA 4URRA 1QA2A 4C2LA 4XLFA 1RWRA 2QX3A 4U49A 4OZZA 2V5IA 1OFEA 3JURA 1HF2A 3B90A 4XLHA 2INUA 1QRBA 2XT4A 4HWVA 3ML3A 2VJIA 4XKWA 3LMWA 4XN0A 1H80A 2Z8GA 4YCQA 1RU4A 4Z06A 3ZPPA 1KTWA 1OFMA 2VFQA 2B0RA 4OZYA 3DU1X 4XOTA 1OFLA 2IOUG 2NZMA 1EA0A 1BN8A 2X3HA 3LYCA 2VBMA 2VFMA 4W8SA 4YZQA 2BM6A 3T9GA 1DBOA 3RIQA 1BHEA 5AMVA 4I84A 1O88A 1OOCA 4KH3A 1EE6A 5DNSA 2BX6A 2PYGA 4XONA 4XOPA 1O8IA 2NTBA 1PLUA 1TYWA 3N6ZA 1TYUA 1O8LA 2QY1A 4OJLA 4XLCA 1CLWA 1O8KA 1QQ1A 4U4BA 2VBKA 2NTQA 2J8KA 3NAWA 3TH0A 3H09A 1QA1A 4OJ6A 4OJOA 3EQNA
chains in the Genus database with same CATH topology
1EZGA 1Z2FA 3GQ8A 3GQ9A 3SUCA 1L1IA 1L0SA 1EWWA 1M8NA 3GQ7A 1N4IA 3GQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1I A;  1EZG A; 
#chains in the Genus database with same CATH topology
 1WXR A;  1EZG A;  4MR0 A;  1OGO X;  1X0C A;  3KRG A;  4OJ5 A;  4YEI A;  5C1C A;  3EQO A;  2BM4 A;  1RMG A;  3N90 A;  2XTW A;  4XOR A;  1LLZ A;  1PE9 A;  2YUH A;  2VFO A;  3VMW A;  1JRG A;  2X6W A;  1XG2 A;  2X6Y A;  1DAB A;  1IA5 A;  2J8I A;  3NB2 A;  1NHC A;  2EWE A;  3B8Y A;  2PEC A;  3VSU A;  2PYH A;  4XR6 A;  2UVE A;  2QZA A;  5JMC B;  2VJJ A;  2X85 A;  2BM5 A;  3SY2 A;  4AVZ A;  4V02 C;  1OFD A;  2O6W A;  4YDT A;  2G0Y A;  3VST A;  3P4G A;  3SQV A;  2O04 A;  3PET A;  1L1I A;  1IDJ A;  3SUC A;  1QCX A;  4Z03 A;  2NT6 A;  4XMY A;  2F3L A;  2VFN A;  4YEJ A;  1QRC A;  1JTA A;  3ZSC A;  1TYX A;  1VBL A;  1LLW A;  2NSP A;  1HG8 A;  3GQ9 A;  2X6X A;  3AK5 A;  2QXZ A;  4Z05 A;  1IB4 A;  2O0V A;  4YZA A;  1KCD A;  4XN3 A;  1WMR A;  4NK8 A;  4OPW A;  4XLA A;  2O1D A;  2VFP A;  1O8D A;  4YZX A;  1O8J A;  4YFO A;  2BM7 A;  1K8F A;  4XQF A;  1OGM X;  3WWG A;  2O17 A;  4JRA C;  4XLE A;  1O8M A;  2XTX A;  1O8H A;  4NK6 A;  5C1E A;  3SYJ A;  2INV A;  2O0W A;  1PXZ A;  1QA3 A;  2BSP A;  4MXN A;  2XC1 A;  2XT2 A;  3JX8 A;  1CZF A;  3GQA A;  3PSS A;  1LM1 A;  4XM3 A;  2VBE A;  1AIR A;  4XL9 A;  2NTP A;  3BH6 B;  2W7Z A;  4YC5 A;  3LJY A;  2NST A;  1TYV A;  5JLV C;  3GQ7 A;  1KCC A;  1O8F A;  1IDK A;  3UW0 A;  3GRH A;  4YZ0 A;  1QJV A;  3B4N A;  1GQ8 A;  3PSZ A;  2NT9 A;  1KQ5 A;  2QYU A;  4OJP A;  1O8G A;  1TSP A;  4OM9 A;  4W8R A;  3VSV A;  4EW9 A;  2XTY A;  3FY3 A;  4W8Q A;  4YEL A;  1O8E A;  4XKV A;  1K5C A;  2ODL A;  2IQ7 A;  2UVF A;  3GQ8 A;  3BH7 B;  4W8T A;  3SZE A;  3VMV A;  4PMH A;  1K4Z A;  4XNF A;  1DBG A;  4URR A;  1QA2 A;  4C2L A;  4XLF A;  1RWR A;  2QX3 A;  4U49 A;  4OZZ A;  2V5I A;  1OFE A;  3JUR A;  1HF2 A;  3B90 A;  4XLH A;  2INU A;  1QRB A;  2XT4 A;  4HWV A;  3ML3 A;  2VJI A;  4XKW A;  3LMW A;  4XN0 A;  1H80 A;  2Z8G A;  4YCQ A;  1RU4 A;  4Z06 A;  3ZPP A;  1KTW A;  1OFM A;  2VFQ A;  2B0R A;  4OZY A;  3DU1 X;  4XOT A;  1OFL A;  2IOU G;  2NZM A;  1EA0 A;  1BN8 A;  2X3H A;  3LYC A;  2VBM A;  2VFM A;  4W8S A;  4YZQ A;  2BM6 A;  3T9G A;  1DBO A;  3RIQ A;  1BHE A;  5AMV A;  4I84 A;  1O88 A;  1OOC A;  4KH3 A;  1EE6 A;  5DNS A;  2BX6 A;  2PYG A;  4XON A;  4XOP A;  1O8I A;  2NTB A;  1PLU A;  1TYW A;  3N6Z A;  1TYU A;  1O8L A;  2QY1 A;  4OJL A;  4XLC A;  1CLW A;  1O8K A;  1QQ1 A;  4U4B A;  2VBK A;  2NTQ A;  2J8K A;  3NAW A;  3TH0 A;  3H09 A;  1QA1 A;  4OJ6 A;  4OJO A;  3EQN A; 
#chains in the Genus database with same CATH homology
 1EZG A;  1Z2F A;  3GQ8 A;  3GQ9 A;  3SUC A;  1L1I A;  1L0S A;  1EWW A;  1M8N A;  3GQ7 A;  1N4I A;  3GQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...