1XDXA

Solution structure of the tctex1 light chain from chlamydomonas inner dynein arm i1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'MEGVDPAVEEAAFVADDVSNIIKESIDAVLQNQQYSEAKVSQWTSSCLEHCIKRLTALNKPFKYVVTCIIMQKNGAGLHTAASCWWDSTTDGSRTVRWENKSMYCICTVFGLAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tctex1 Light Chain protein
publication title Solution Structure of the Tctex1 Dimer Reveals a Mechanism for Dynein-Cargo Interactions
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Contractile protein
total genus 20
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 1xdxA01
1YGTA 2PG1E 3FM7A 1XDXA
chains in the Genus database with same CATH superfamily
1HNWC 4YY3C 3OTOC 4LFAC 1XNQC 2UUCC 5FLXD 4JI1C 1HR0C 4LF7C 4BSZA 3JAMD 2UUBC 4GKKC 4X65C 2UXCC 4LF9C 4JI3C 2UU9C 3J7AD 3J80D 1IBLC 4DV4C 4JI0C 4K0KC 3FM7A 4B3MC 4DV2C 2F4VC 5IWAC 1HNZC 4JYAC 5LMUC 4OX9C 4DV6C 3J81D 4DV7C 4DR3C 2VQFC 2HHHC 1J5EC 4X64C 4X62C 4YHHC 1XMQC 1HNXC 4AQYC 4KHPC 1N32C 2PG1E 1IBKC 5A2QD 4JI7C 4B3TC 4JI8C 4LFCC 4DV0C 4B3SC 5BR8C 2UUAC 4DV1C 1XMOC 1IBMC 4JI5C 4LF5C 2UXBC 1XDXA 5LMNC 4DR5C 4NXNC 1N36C 5IT9D 2VQEC 4JI2C 4NXMC 4JV5C 2E5LC 4JI6C 1FJGC 3T1HC 4DR4C 4LF6C 4X66C 4DUZC 4DUYC 4LF4C 1I94C 3T1YC 1YGTA 4DR2C 1N33C 2ZTBA 4DR1C 4JI4C 4DV3C 4B3RC 4DV5C 2UXDC 4GKJC 1XNRC 4DR7C 4LFBC 2ZM6C 4DR6C 4LF8C 1N34C
chains in the Genus database with same CATH topology
1YGTA 2PG1E 1XDXA 2ZTBA 3FM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGT A;  2PG1 E;  3FM7 A;  1XDX A; 
#chains in the Genus database with same CATH topology
 1HNW C;  4YY3 C;  3OTO C;  4LFA C;  1XNQ C;  2UUC C;  5FLX D;  4JI1 C;  1HR0 C;  4LF7 C;  4BSZ A;  3JAM D;  2UUB C;  4GKK C;  4X65 C;  2UXC C;  4LF9 C;  4JI3 C;  2UU9 C;  3J7A D;  3J80 D;  1IBL C;  4DV4 C;  4JI0 C;  4K0K C;  3FM7 A;  4B3M C;  4DV2 C;  2F4V C;  5IWA C;  1HNZ C;  4JYA C;  5LMU C;  4OX9 C;  4DV6 C;  3J81 D;  4DV7 C;  4DR3 C;  2VQF C;  2HHH C;  1J5E C;  4X64 C;  4X62 C;  4YHH C;  1XMQ C;  1HNX C;  4AQY C;  4KHP C;  1N32 C;  2PG1 E;  1IBK C;  5A2Q D;  4JI7 C;  4B3T C;  4JI8 C;  4LFC C;  4DV0 C;  4B3S C;  5BR8 C;  2UUA C;  4DV1 C;  1XMO C;  1IBM C;  4JI5 C;  4LF5 C;  2UXB C;  1XDX A;  5LMN C;  4DR5 C;  4NXN C;  1N36 C;  5IT9 D;  2VQE C;  4JI2 C;  4NXM C;  4JV5 C;  2E5L C;  4JI6 C;  1FJG C;  3T1H C;  4DR4 C;  4LF6 C;  4X66 C;  4DUZ C;  4DUY C;  4LF4 C;  1I94 C;  3T1Y C;  1YGT A;  4DR2 C;  1N33 C;  2ZTB A;  4DR1 C;  4JI4 C;  4DV3 C;  4B3R C;  4DV5 C;  2UXD C;  4GKJ C;  1XNR C;  4DR7 C;  4LFB C;  2ZM6 C;  4DR6 C;  4LF8 C;  1N34 C; 
#chains in the Genus database with same CATH homology
 1YGT A;  2PG1 E;  1XDX A;  2ZTB A;  3FM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...