1XDXA

Solution structure of the tctex1 light chain from chlamydomonas inner dynein arm i1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
MEGVDPAVEEAAFVADDVSNIIKESIDAVLQNQQYSEAKVSQWTSSCLEHCIKRLTALNKPFKYVVTCIIMQKNGAGLHTAASCWWDSTTDGSRTVRWENKSMYCICTVFGLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tctex1 Light Chain protein
publication title Solution Structure of the Tctex1 Dimer Reveals a Mechanism for Dynein-Cargo Interactions
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Contractile protein
total genus 20
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 1xdxA01
2PG1E 1YGTA 3FM7A 1XDXA
chains in the Genus database with same CATH superfamily
4JI7C 5IT9D 4DR5C 3J80D 2PG1E 2E5LC 4DR4C 4JI6C 4YHHC 2UUBC 4LF9C 3OTOC 1HNWC 4B3SC 4B3TC 1YGTA 1I94C 4LFCC 5FLXD 4DV7C 4DUYC 1IBMC 4X66C 4BSZA 4B3MC 1HNZC 1XMOC 4X65C 1XMQC 4NXMC 2ZM6C 5LMNC 1XNQC 4DR7C 4DV1C 3JAMD 4DR1C 2HHHC 1N33C 4JI1C 4DR3C 4JI8C 3J7AD 2UUCC 2VQFC 1HR0C 4JI3C 4GKJC 2UUAC 4DR6C 4LFAC 4LF8C 1J5EC 4X62C 4JI0C 4DV5C 1IBKC 2F4VC 3FM7A 1FJGC 5LMUC 1XNRC 2ZTBA 4GKKC 4YY3C 4DUZC 5IWAC 4DV0C 4JI2C 4DV3C 4OX9C 3T1YC 1IBLC 5BR8C 2UU9C 2UXBC 1HNXC 4LFBC 4AQYC 4JYAC 4LF6C 4NXNC 2VQEC 1N32C 4LF5C 4DV6C 1N36C 4DV4C 3T1HC 1N34C 4JI5C 4JV5C 2UXCC 4DV2C 4B3RC 5A2QD 4LF7C 4KHPC 4X64C 2UXDC 3J81D 4LF4C 1XDXA 4JI4C 4K0KC 4DR2C
chains in the Genus database with same CATH topology
1YGTA 2ZTBA 3FM7A 2PG1E 1XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG1 E;  1YGT A;  3FM7 A;  1XDX A; 
#chains in the Genus database with same CATH topology
 4JI7 C;  5IT9 D;  4DR5 C;  3J80 D;  2PG1 E;  2E5L C;  4DR4 C;  4JI6 C;  4YHH C;  2UUB C;  4LF9 C;  3OTO C;  1HNW C;  4B3S C;  4B3T C;  1YGT A;  1I94 C;  4LFC C;  5FLX D;  4DV7 C;  4DUY C;  1IBM C;  4X66 C;  4BSZ A;  4B3M C;  1HNZ C;  1XMO C;  4X65 C;  1XMQ C;  4NXM C;  2ZM6 C;  5LMN C;  1XNQ C;  4DR7 C;  4DV1 C;  3JAM D;  4DR1 C;  2HHH C;  1N33 C;  4JI1 C;  4DR3 C;  4JI8 C;  3J7A D;  2UUC C;  2VQF C;  1HR0 C;  4JI3 C;  4GKJ C;  2UUA C;  4DR6 C;  4LFA C;  4LF8 C;  1J5E C;  4X62 C;  4JI0 C;  4DV5 C;  1IBK C;  2F4V C;  3FM7 A;  1FJG C;  5LMU C;  1XNR C;  2ZTB A;  4GKK C;  4YY3 C;  4DUZ C;  5IWA C;  4DV0 C;  4JI2 C;  4DV3 C;  4OX9 C;  3T1Y C;  1IBL C;  5BR8 C;  2UU9 C;  2UXB C;  1HNX C;  4LFB C;  4AQY C;  4JYA C;  4LF6 C;  4NXN C;  2VQE C;  1N32 C;  4LF5 C;  4DV6 C;  1N36 C;  4DV4 C;  3T1H C;  1N34 C;  4JI5 C;  4JV5 C;  2UXC C;  4DV2 C;  4B3R C;  5A2Q D;  4LF7 C;  4KHP C;  4X64 C;  2UXD C;  3J81 D;  4LF4 C;  1XDX A;  4JI4 C;  4K0K C;  4DR2 C; 
#chains in the Genus database with same CATH homology
 1YGT A;  2ZTB A;  3FM7 A;  2PG1 E;  1XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...