1XDXA

Solution structure of the tctex1 light chain from chlamydomonas inner dynein arm i1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
MEGVDPAVEEAAFVADDVSNIIKESIDAVLQNQQYSEAKVSQWTSSCLEHCIKRLTALNKPFKYVVTCIIMQKNGAGLHTAASCWWDSTTDGSRTVRWENKSMYCICTVFGLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Tctex1 Light Chain protein
publication title Solution Structure of the Tctex1 Dimer Reveals a Mechanism for Dynein-Cargo Interactions
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 20
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 1xdxA01
2PG1E 1YGTA 3FM7A 1XDXA
chains in the Genus database with same CATH superfamily
4DV6C 4X64C 1XMQC 4DUZC 1XNQC 3J7AD 4LFCC 1FJGC 4DUYC 5IWAC 3OTOC 2UUBC 4DV2C 4LF5C 4LF8C 5LMNC 4X66C 1HR0C 5IT9D 1IBLC 3J80D 4LF6C 3FM7A 1J5EC 4DR4C 4X65C 4JI4C 4DV3C 4LFBC 4YY3C 5FLXD 4OX9C 4NXMC 1XDXA 4JI8C 1N34C 1I94C 4GKKC 4JYAC 4DV0C 3JAMD 4DR3C 4DV1C 4B3MC 2ZTBA 2VQEC 4JI7C 2UU9C 1HNXC 2PG1E 2F4VC 4LFAC 1YGTA 4JI2C 2UXBC 4YHHC 5A2QD 4LF9C 1IBKC 3T1YC 2HHHC 4DV4C 4JI6C 1HNZC 4DV7C 1HNWC 5LMUC 4DV5C 4B3SC 2E5LC 3T1HC 2UUCC 1XNRC 4JV5C 4BSZA 4JI0C 4DR6C 4KHPC 4DR7C 4DR1C 4NXNC 4LF4C 2VQFC 4AQYC 3J81D 1XMOC 2UXDC 1N36C 2ZM6C 4B3TC 4DR2C 4K0KC 4GKJC 1N32C 1N33C 2UXCC 4LF7C 4X62C 2UUAC 1IBMC 4JI1C 4JI3C 4DR5C 5BR8C 4B3RC 4JI5C
chains in the Genus database with same CATH topology
2PG1E 2ZTBA 1YGTA 3FM7A 1XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG1 E;  1YGT A;  3FM7 A;  1XDX A; 
#chains in the Genus database with same CATH topology
 4DV6 C;  4X64 C;  1XMQ C;  4DUZ C;  1XNQ C;  3J7A D;  4LFC C;  1FJG C;  4DUY C;  5IWA C;  3OTO C;  2UUB C;  4DV2 C;  4LF5 C;  4LF8 C;  5LMN C;  4X66 C;  1HR0 C;  5IT9 D;  1IBL C;  3J80 D;  4LF6 C;  3FM7 A;  1J5E C;  4DR4 C;  4X65 C;  4JI4 C;  4DV3 C;  4LFB C;  4YY3 C;  5FLX D;  4OX9 C;  4NXM C;  1XDX A;  4JI8 C;  1N34 C;  1I94 C;  4GKK C;  4JYA C;  4DV0 C;  3JAM D;  4DR3 C;  4DV1 C;  4B3M C;  2ZTB A;  2VQE C;  4JI7 C;  2UU9 C;  1HNX C;  2PG1 E;  2F4V C;  4LFA C;  1YGT A;  4JI2 C;  2UXB C;  4YHH C;  5A2Q D;  4LF9 C;  1IBK C;  3T1Y C;  2HHH C;  4DV4 C;  4JI6 C;  1HNZ C;  4DV7 C;  1HNW C;  5LMU C;  4DV5 C;  4B3S C;  2E5L C;  3T1H C;  2UUC C;  1XNR C;  4JV5 C;  4BSZ A;  4JI0 C;  4DR6 C;  4KHP C;  4DR7 C;  4DR1 C;  4NXN C;  4LF4 C;  2VQF C;  4AQY C;  3J81 D;  1XMO C;  2UXD C;  1N36 C;  2ZM6 C;  4B3T C;  4DR2 C;  4K0K C;  4GKJ C;  1N32 C;  1N33 C;  2UXC C;  4LF7 C;  4X62 C;  2UUA C;  1IBM C;  4JI1 C;  4JI3 C;  4DR5 C;  5BR8 C;  4B3R C;  4JI5 C; 
#chains in the Genus database with same CATH homology
 2PG1 E;  2ZTB A;  1YGT A;  3FM7 A;  1XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...