4DV0C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv0C02
4NOZA 4B3RC 2PT7G 1K0RA 3GKUA 4OX9C 4DR5C 4MTNA 2BJOA 1HNWC 2KZFA 3T1HC 4DV0C 1ZB8A 4DCSA 4DR1C 4K0KC 2ZM6C 4NXMC 2E8EA 4DV7C 3IEVA 1N33C 4DV2C 1IBKC 4AQYC 3AF6A 1JOSA 4DV3C 1N34C 1HH2P 3J80D 3OTOC 4B3TC 2ASBA 1L2FA 4YHHC 4JI7C 1KKGA 3J81D 1HNXC 1LQLA 3IEUA 2YCBA 4JI0C 1IBMC 1NYEA 4DR7C 2UU9C 4GKJC 4LF4C 3JAMD 2CXCA 1XNQC 4JI2C 4B3SC 1QWIA 2UUAC 1PA4A 5A2QD 5LMUC 2E8FA 4DV1C 1WH9A 2CY1A 4LFAC 1XMQC 1USPA 4LF9C 2UUCC 5FLXD 4DUYC 1N36C 1ZB9A 4DR4C 2D7VA 4KHPC 4LF6C 4DUZC 4JI4C 1XNRC 3R9XA 2QL8A 4DV5C 4JYAC 4JI8C 1VLAA 1IBLC 5LMNC 4DV6C 1J5EC 1UKKA 1EGAA 4JI3C 5BR8C 4JI1C 4DCTA 2E5LC 2OPLA 2EGTA 2JMPA 5IWAC 2PN2A 1HNZC 1USPB 1MKYA 2E8CA 2ONFA 3LUSA 3AF5A 1FJGC 4JI6C 2UXBC 4XX2A 2UUBC 2E7GA 4NXNC 2F4VC 4DV4C 4DCVA 4DR2C 2DYJA 4LF8C 3I07A 3EERA 2VQFC 2XR1A 1I94C 4LF5C 2HJGA 1ML8A 4LF7C 4JV5C 2VQEC 1N2FA 4DCUA 5IT9D 2UXDC 3CJEA 3J7AD 1HR0C 4X65C 2OPLB 2UXCC 4BSZA 3T1YC 2HHHC 4DR3C 3R9WA 4X62C 4MH4A 4JI5C 4LFBC 1N32C 2ATWA 4B3MC 1WF3A 4X66C 4YY3C 4X64C 4LFCC 1XMOC 4DR6C 4GKKC
chains in the Genus database with same CATH superfamily
3L8CA 5BSUA 1RY2A 2PT7G 3GKUA 1P4EA 2PG1E 2BJOA 1HNWC 2KDNA 3FCEA 4RVOA 2KZ0A 4I9GA 2VZEA 4GXQA 3CQ1A 2D1QA 1M6XC 1HH2P 3J80D 4B3TC 4DG9A 3PROC 3J81D 4OXIA 1HNXC 1LQLA 5BSRA 5T8TA 2YWCA 1MXCA 2M5HA 3NI2A 1WH9A 1QM4A 2CY1A 4LFAC 3DLPX 4KTVA 2Z51A 1MXAA 1YJ7A 1N36C 4ZJZA 1PU1A 4EATA 3AY0A 4DV5C 2M5OA 1T5HX 1M6XA 5KYVA 4JM1A 5AE2A 5JRHA 5LMNC 2QW0X 5BR8C 4DCTA 2OPLA 2EGTA 4G1IA 2D27A 1USPB 5H9UA 2MM9A 2UXBC 2F4VC 4LF8C 1MD9A 2VQFC 1I94C 2VQEC 2D28C 5BURA 2UXCC 3T1YC 2HHHC 4DR3C 4K0BA 3LNOA 3N54B 4MH4A 4D57A 4B3MC 1V25A 3ETCA 4LFCC 4GKKC 3GR1A 4NOZA 3DAYA 5BSTA 1K0RA 4LE5A 4OX9C 4RM3A 4RM2A 2KZFA 2WP0C 4I9FA 4K0KC 1XDXA 3IEVA 1N33C 5DV9A 3A9UA 4DV2C 1IBKC 3E7XA 4AQYC 1JOSA 5BSMA 4DV3C 3A4IA 1TH5A 3OTOC 1L2FA 4YHHC 3NPDA 4JI7C 3FCCA 1IB8A 3IEUA 5KEIA 4GKJC 3JAMD 4KTTA 4IZ6A 2CXCA 3CQ3A 1AMUA 5IFIA 2YWBA 2UUAC 3TR3A 2D1TA 2E8FA 1XMQC 1USPA 4LF9C 2UUCC 4G37A 5T8SA 4KHPC 5ADZA 4RLQA 1XNRC 3LNVA 4JI8C 1VLAA 3PBKA 1XRCA 3DHVA 4RLFA 4DV6C 1UKKA 4JI3C 4BC7A 3O2EA 5CZXA 3A25A 1HNZC 4R1MA 3PESA 4ZLPA 2QVXX 1FJGC 1V26A 3K6RA 1XRBA 2Y4NA 4DV4C 2Y4OA 4LF5C 1XRAA 2V7BA 1ML8A 1RG9A 2YX1A 4GS5A 4DCUA 4FTFA 3FM7A 4PROC 4X65C 1O93A 4BSZA 2JNVA 2P02A 1LCIA 4LFBC 3TQIA 4PHTA 2CU6A 4IR7A 2PROA 4U5YD 5K85A 3VNQA 4X66C 4YY3C 2AYAA 4G36A 2P2BA 4B3RC 3SO4A 3TUFA 1O9TA 5GTDA 1WCJA 1ZB8A 4DCSA 5A1IA 3N2QA 1VEHA 4BCAA 1O92A 4PUHA 3GR0A 5A1GA 3RV2A 1KKGA 1NY8A 2ZTBA 5BUSA 2YCBA 4R1LA 4JI0C 1IBMC 4HPVA 4LF4C 1XNQC 5BSVA 2OO4A 5E7QA 5LMUC 2P2JA 2D1SA 4DV1C 3B7WA 2DPLA 3IMLA 3A26A 4DUYC 4BC9A 1ZB9A 2P2QA 2D7VA 3UZ0A 4JI4C 4D56A 3R9XA 2QL8A 1IBLC 3IPLA 2JMPA 5IWAC 3S82A 1ULTA 2PN2A 4ODJA 3EQ6A 3VNRA 1FLOA 2VSQA 2MCQA 2ONFA 3AF5A 1MXBA 4JI6C 1BA3A 4XX2A 4D4IA 4NXNC 3TDEA 4DCVA 3I07A 1UWDA 1FUGA 2XR1A 3EERA 4JV5C 2HJGA 2UXDC 4PUGA 3J7AD 2E0GA 1HR0C 4WV3A 3L95X 2MMAB 4L4QA 3CW8X 2BH1X 4X62C 3CW9A 4L2ZA 2ATWA 5K8FA 3I08A 1WF3A 2QVYX 4FUTA 2DHMA 2P2MA 2P2FA 3H2TA 1PG4A 4DR5C 4MTNA 1O90A 3T1HC 3VNSA 2ZZNA 4DV0C 3LAXA 4DR1C 5AE3A 2NCLA 3GPCA 4NXMC 2E8EA 2ZM6C 4DV7C 1GPMA 3E7WA 3AF6A 5CZVA 1N34C 1P7LA 2ASBA 2OBVA 5KYTA 4FUQA 1NYEA 4DR7C 1XS3A 2UU9C 3KXWA 3UX2A 4JI2C 4DG8A 4B3SC 2D1RA 1QWIA 1PA4A 5A2QD 4RMNA 3LGXA 5BUQA 2WD9A 3NYRA 4RVNA 5FLXD 5BSWA 3G7SA 4GXRA 1MDFA 4DR4C 1YGTA 3C5EA 4BBYA 4LF6C 4DUZC 4JYAC 1J5EC 1EGAA 2Y27A 3UEBA 4JI1C 2E5LC 4WS9A 4TPSB 2ZZMA 1MKYA 2E8CA 3LUSA 5A19A 1P4EC 3ETOA 4L7IA 2E7GA 2UUBC 1T5DX 2QVZX 4DR2C 3UX3A 2DYJA 4OYCA 5AE1A 4LF7C 1MDBA 1N2FA 3CQ2A 5IT9D 3CJEA 2P20A 1V60A 3R44A 5LCIA 3RG2A 2OPLB 3A9VA 1PG3A 3R9WA 4R0MA 1XHJA 4JI5C 1N32C 3UOWA 4PZPA 3NYQA 4D4GA 4ISBA 4NDNA 4PUIA 4DR6C 4X64C 1XMOC
chains in the Genus database with same CATH topology
3L8CA 5BSUA 1RY2A 2PT7G 3GKUA 2BJOA 1HNWC 3FCEA 4RVOA 4I9GA 2VZEA 4GXQA 2D1QA 1HH2P 3J80D 4B3TC 4DG9A 3PROC 3J81D 4OXIA 1HNXC 1LQLA 5BSRA 5T8TA 2YWCA 1MXCA 3NI2A 1WH9A 1QM4A 2CY1A 4LFAC 3DLPX 4KTVA 1MXAA 1YJ7A 1N36C 4ZJZA 4EATA 4DV5C 1T5HX 5KYVA 4JM1A 5AE2A 5JRHA 5LMNC 2QW0X 5BR8C 4DCTA 2OPLA 2EGTA 4G1IA 2D27A 1USPB 5H9UA 2UXBC 2F4VC 4LF8C 1MD9A 2VQFC 1I94C 2VQEC 2D28C 5BURA 2UXCC 3T1YC 2HHHC 4DR3C 4K0BA 3N54B 4MH4A 4D57A 4B3MC 1V25A 3ETCA 4LFCC 4GKKC 3GR1A 4NOZA 3DAYA 5BSTA 1K0RA 4LE5A 4OX9C 4RM3A 4RM2A 2KZFA 2WP0C 4I9FA 4K0KC 3IEVA 1N33C 5DV9A 3A9UA 4DV2C 1IBKC 3E7XA 4AQYC 1JOSA 5BSMA 4DV3C 3A4IA 3OTOC 1L2FA 4YHHC 3NPDA 4JI7C 3FCCA 3IEUA 5KEIA 4GKJC 3JAMD 4KTTA 4IZ6A 2CXCA 1AMUA 5IFIA 2YWBA 2UUAC 2D1TA 2E8FA 1XMQC 1USPA 4LF9C 2UUCC 4G37A 5T8SA 4KHPC 5ADZA 4RLQA 1XNRC 3LNVA 4JI8C 1VLAA 3PBKA 1XRCA 3DHVA 4RLFA 4DV6C 1UKKA 4JI3C 4BC7A 5CZXA 1HNZC 4R1MA 3PESA 4ZLPA 2QVXX 1FJGC 1V26A 1XRBA 2Y4NA 4DV4C 2Y4OA 4LF5C 1XRAA 2V7BA 1ML8A 1RG9A 4DCUA 4GS5A 4FTFA 4PROC 4X65C 1O93A 4BSZA 2P02A 1LCIA 4LFBC 3TQIA 4PHTA 4IR7A 2PROA 4U5YD 5K85A 3VNQA 4YY3C 4X66C 2AYAA 4G36A 2P2BA 4B3RC 3SO4A 3TUFA 1O9TA 5GTDA 1ZB8A 4DCSA 5A1IA 3N2QA 4BCAA 1O92A 3GR0A 5A1GA 3RV2A 1KKGA 5BUSA 2YCBA 4R1LA 4JI0C 1IBMC 4HPVA 4LF4C 1XNQC 5BSVA 2OO4A 5E7QA 5LMUC 2P2JA 2D1SA 4DV1C 3B7WA 2DPLA 3IMLA 4DUYC 4BC9A 1ZB9A 2P2QA 2D7VA 3UZ0A 4JI4C 4D56A 3R9XA 2QL8A 1IBLC 3IPLA 2JMPA 5IWAC 3S82A 1ULTA 2PN2A 4ODJA 3EQ6A 3VNRA 2VSQA 2ONFA 3AF5A 1MXBA 4JI6C 1BA3A 4XX2A 4D4IA 4NXNC 3TDEA 4DCVA 3I07A 3EERA 1FUGA 2XR1A 4JV5C 2HJGA 2UXDC 3J7AD 2E0GA 1HR0C 4WV3A 3L95X 4L4QA 3CW8X 2BH1X 4X62C 3CW9A 4L2ZA 2ATWA 5K8FA 3I08A 1WF3A 2QVYX 4FUTA 2P2MA 2P2FA 3H2TA 1PG4A 4DR5C 4MTNA 1O90A 3T1HC 3VNSA 4DV0C 3LAXA 4DR1C 5AE3A 3GPCA 2ZM6C 4NXMC 2E8EA 4DV7C 1GPMA 3E7WA 3AF6A 5CZVA 1N34C 1P7LA 2ASBA 2OBVA 5KYTA 4FUQA 1NYEA 4DR7C 2UU9C 3KXWA 4JI2C 4DG8A 4B3SC 2D1RA 1QWIA 1PA4A 5A2QD 4RMNA 3LGXA 5BUQA 2WD9A 3NYRA 4RVNA 5FLXD 5BSWA 3G7SA 4GXRA 1MDFA 4DR4C 3C5EA 4BBYA 4LF6C 4DUZC 4JYAC 1J5EC 1EGAA 2Y27A 4JI1C 2E5LC 4WS9A 4TPSB 1MKYA 2E8CA 3LUSA 5A19A 3ETOA 4L7IA 2E7GA 2UUBC 1T5DX 2QVZX 4DR2C 2DYJA 4OYCA 5AE1A 4LF7C 1MDBA 1N2FA 5IT9D 3CJEA 2P20A 3R44A 3RG2A 2OPLB 3A9VA 1PG3A 3R9WA 4R0MA 4JI5C 1N32C 3UOWA 4PZPA 3NYQA 4D4GA 4ISBA 4NDNA 4DR6C 4X64C 1XMOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  4B3R C;  2PT7 G;  1K0R A;  3GKU A;  4OX9 C;  4DR5 C;  4MTN A;  2BJO A;  1HNW C;  2KZF A;  3T1H C;  4DV0 C;  1ZB8 A;  4DCS A;  4DR1 C;  4K0K C;  2ZM6 C;  4NXM C;  2E8E A;  4DV7 C;  3IEV A;  1N33 C;  4DV2 C;  1IBK C;  4AQY C;  3AF6 A;  1JOS A;  4DV3 C;  1N34 C;  1HH2 P;  3J80 D;  3OTO C;  4B3T C;  2ASB A;  1L2F A;  4YHH C;  4JI7 C;  1KKG A;  3J81 D;  1HNX C;  1LQL A;  3IEU A;  2YCB A;  4JI0 C;  1IBM C;  1NYE A;  4DR7 C;  2UU9 C;  4GKJ C;  4LF4 C;  3JAM D;  2CXC A;  1XNQ C;  4JI2 C;  4B3S C;  1QWI A;  2UUA C;  1PA4 A;  5A2Q D;  5LMU C;  2E8F A;  4DV1 C;  1WH9 A;  2CY1 A;  4LFA C;  1XMQ C;  1USP A;  4LF9 C;  2UUC C;  5FLX D;  4DUY C;  1N36 C;  1ZB9 A;  4DR4 C;  2D7V A;  4KHP C;  4LF6 C;  4DUZ C;  4JI4 C;  1XNR C;  3R9X A;  2QL8 A;  4DV5 C;  4JYA C;  4JI8 C;  1VLA A;  1IBL C;  5LMN C;  4DV6 C;  1J5E C;  1UKK A;  1EGA A;  4JI3 C;  5BR8 C;  4JI1 C;  4DCT A;  2E5L C;  2OPL A;  2EGT A;  2JMP A;  5IWA C;  2PN2 A;  1HNZ C;  1USP B;  1MKY A;  2E8C A;  2ONF A;  3LUS A;  3AF5 A;  1FJG C;  4JI6 C;  2UXB C;  4XX2 A;  2UUB C;  2E7G A;  4NXN C;  2F4V C;  4DV4 C;  4DCV A;  4DR2 C;  2DYJ A;  4LF8 C;  3I07 A;  3EER A;  2VQF C;  2XR1 A;  1I94 C;  4LF5 C;  2HJG A;  1ML8 A;  4LF7 C;  4JV5 C;  2VQE C;  1N2F A;  4DCU A;  5IT9 D;  2UXD C;  3CJE A;  3J7A D;  1HR0 C;  4X65 C;  2OPL B;  2UXC C;  4BSZ A;  3T1Y C;  2HHH C;  4DR3 C;  3R9W A;  4X62 C;  4MH4 A;  4JI5 C;  4LFB C;  1N32 C;  2ATW A;  4B3M C;  1WF3 A;  4X66 C;  4YY3 C;  4X64 C;  4LFC C;  1XMO C;  4DR6 C;  4GKK C; 
#chains in the Genus database with same CATH topology
 3L8C A;  5BSU A;  1RY2 A;  2PT7 G;  3GKU A;  1P4E A;  2PG1 E;  2BJO A;  1HNW C;  2KDN A;  3FCE A;  4RVO A;  2KZ0 A;  4I9G A;  2VZE A;  4GXQ A;  3CQ1 A;  2D1Q A;  1M6X C;  1HH2 P;  3J80 D;  4B3T C;  4DG9 A;  3PRO C;  3J81 D;  4OXI A;  1HNX C;  1LQL A;  5BSR A;  5T8T A;  2YWC A;  1MXC A;  2M5H A;  3NI2 A;  1WH9 A;  1QM4 A;  2CY1 A;  4LFA C;  3DLP X;  4KTV A;  2Z51 A;  1MXA A;  1YJ7 A;  1N36 C;  4ZJZ A;  1PU1 A;  4EAT A;  3AY0 A;  4DV5 C;  2M5O A;  1T5H X;  1M6X A;  5KYV A;  4JM1 A;  5AE2 A;  5JRH A;  5LMN C;  2QW0 X;  5BR8 C;  4DCT A;  2OPL A;  2EGT A;  4G1I A;  2D27 A;  1USP B;  5H9U A;  2MM9 A;  2UXB C;  2F4V C;  4LF8 C;  1MD9 A;  2VQF C;  1I94 C;  2VQE C;  2D28 C;  5BUR A;  2UXC C;  3T1Y C;  2HHH C;  4DR3 C;  4K0B A;  3LNO A;  3N54 B;  4MH4 A;  4D57 A;  4B3M C;  1V25 A;  3ETC A;  4LFC C;  4GKK C;  3GR1 A;  4NOZ A;  3DAY A;  5BST A;  1K0R A;  4LE5 A;  4OX9 C;  4RM3 A;  4RM2 A;  2KZF A;  2WP0 C;  4I9F A;  4K0K C;  1XDX A;  3IEV A;  1N33 C;  5DV9 A;  3A9U A;  4DV2 C;  1IBK C;  3E7X A;  4AQY C;  1JOS A;  5BSM A;  4DV3 C;  3A4I A;  1TH5 A;  3OTO C;  1L2F A;  4YHH C;  3NPD A;  4JI7 C;  3FCC A;  1IB8 A;  3IEU A;  5KEI A;  4GKJ C;  3JAM D;  4KTT A;  4IZ6 A;  2CXC A;  3CQ3 A;  1AMU A;  5IFI A;  2YWB A;  2UUA C;  3TR3 A;  2D1T A;  2E8F A;  1XMQ C;  1USP A;  4LF9 C;  2UUC C;  4G37 A;  5T8S A;  4KHP C;  5ADZ A;  4RLQ A;  1XNR C;  3LNV A;  4JI8 C;  1VLA A;  3PBK A;  1XRC A;  3DHV A;  4RLF A;  4DV6 C;  1UKK A;  4JI3 C;  4BC7 A;  3O2E A;  5CZX A;  3A25 A;  1HNZ C;  4R1M A;  3PES A;  4ZLP A;  2QVX X;  1FJG C;  1V26 A;  3K6R A;  1XRB A;  2Y4N A;  4DV4 C;  2Y4O A;  4LF5 C;  1XRA A;  2V7B A;  1ML8 A;  1RG9 A;  2YX1 A;  4GS5 A;  4DCU A;  4FTF A;  3FM7 A;  4PRO C;  4X65 C;  1O93 A;  4BSZ A;  2JNV A;  2P02 A;  1LCI A;  4LFB C;  3TQI A;  4PHT A;  2CU6 A;  4IR7 A;  2PRO A;  4U5Y D;  5K85 A;  3VNQ A;  4X66 C;  4YY3 C;  2AYA A;  4G36 A;  2P2B A;  4B3R C;  3SO4 A;  3TUF A;  1O9T A;  5GTD A;  1WCJ A;  1ZB8 A;  4DCS A;  5A1I A;  3N2Q A;  1VEH A;  4BCA A;  1O92 A;  4PUH A;  3GR0 A;  5A1G A;  3RV2 A;  1KKG A;  1NY8 A;  2ZTB A;  5BUS A;  2YCB A;  4R1L A;  4JI0 C;  1IBM C;  4HPV A;  4LF4 C;  1XNQ C;  5BSV A;  2OO4 A;  5E7Q A;  5LMU C;  2P2J A;  2D1S A;  4DV1 C;  3B7W A;  2DPL A;  3IML A;  3A26 A;  4DUY C;  4BC9 A;  1ZB9 A;  2P2Q A;  2D7V A;  3UZ0 A;  4JI4 C;  4D56 A;  3R9X A;  2QL8 A;  1IBL C;  3IPL A;  2JMP A;  5IWA C;  3S82 A;  1ULT A;  2PN2 A;  4ODJ A;  3EQ6 A;  3VNR A;  1FLO A;  2VSQ A;  2MCQ A;  2ONF A;  3AF5 A;  1MXB A;  4JI6 C;  1BA3 A;  4XX2 A;  4D4I A;  4NXN C;  3TDE A;  4DCV A;  3I07 A;  1UWD A;  1FUG A;  2XR1 A;  3EER A;  4JV5 C;  2HJG A;  2UXD C;  4PUG A;  3J7A D;  2E0G A;  1HR0 C;  4WV3 A;  3L95 X;  2MMA B;  4L4Q A;  3CW8 X;  2BH1 X;  4X62 C;  3CW9 A;  4L2Z A;  2ATW A;  5K8F A;  3I08 A;  1WF3 A;  2QVY X;  4FUT A;  2DHM A;  2P2M A;  2P2F A;  3H2T A;  1PG4 A;  4DR5 C;  4MTN A;  1O90 A;  3T1H C;  3VNS A;  2ZZN A;  4DV0 C;  3LAX A;  4DR1 C;  5AE3 A;  2NCL A;  3GPC A;  4NXM C;  2E8E A;  2ZM6 C;  4DV7 C;  1GPM A;  3E7W A;  3AF6 A;  5CZV A;  1N34 C;  1P7L A;  2ASB A;  2OBV A;  5KYT A;  4FUQ A;  1NYE A;  4DR7 C;  1XS3 A;  2UU9 C;  3KXW A;  3UX2 A;  4JI2 C;  4DG8 A;  4B3S C;  2D1R A;  1QWI A;  1PA4 A;  5A2Q D;  4RMN A;  3LGX A;  5BUQ A;  2WD9 A;  3NYR A;  4RVN A;  5FLX D;  5BSW A;  3G7S A;  4GXR A;  1MDF A;  4DR4 C;  1YGT A;  3C5E A;  4BBY A;  4LF6 C;  4DUZ C;  4JYA C;  1J5E C;  1EGA A;  2Y27 A;  3UEB A;  4JI1 C;  2E5L C;  4WS9 A;  4TPS B;  2ZZM A;  1MKY A;  2E8C A;  3LUS A;  5A19 A;  1P4E C;  3ETO A;  4L7I A;  2E7G A;  2UUB C;  1T5D X;  2QVZ X;  4DR2 C;  3UX3 A;  2DYJ A;  4OYC A;  5AE1 A;  4LF7 C;  1MDB A;  1N2F A;  3CQ2 A;  5IT9 D;  3CJE A;  2P20 A;  1V60 A;  3R44 A;  5LCI A;  3RG2 A;  2OPL B;  3A9V A;  1PG3 A;  3R9W A;  4R0M A;  1XHJ A;  4JI5 C;  1N32 C;  3UOW A;  4PZP A;  3NYQ A;  4D4G A;  4ISB A;  4NDN A;  4PUI A;  4DR6 C;  4X64 C;  1XMO C; 
#chains in the Genus database with same CATH homology
 3L8C A;  5BSU A;  1RY2 A;  2PT7 G;  3GKU A;  2BJO A;  1HNW C;  3FCE A;  4RVO A;  4I9G A;  2VZE A;  4GXQ A;  2D1Q A;  1HH2 P;  3J80 D;  4B3T C;  4DG9 A;  3PRO C;  3J81 D;  4OXI A;  1HNX C;  1LQL A;  5BSR A;  5T8T A;  2YWC A;  1MXC A;  3NI2 A;  1WH9 A;  1QM4 A;  2CY1 A;  4LFA C;  3DLP X;  4KTV A;  1MXA A;  1YJ7 A;  1N36 C;  4ZJZ A;  4EAT A;  4DV5 C;  1T5H X;  5KYV A;  4JM1 A;  5AE2 A;  5JRH A;  5LMN C;  2QW0 X;  5BR8 C;  4DCT A;  2OPL A;  2EGT A;  4G1I A;  2D27 A;  1USP B;  5H9U A;  2UXB C;  2F4V C;  4LF8 C;  1MD9 A;  2VQF C;  1I94 C;  2VQE C;  2D28 C;  5BUR A;  2UXC C;  3T1Y C;  2HHH C;  4DR3 C;  4K0B A;  3N54 B;  4MH4 A;  4D57 A;  4B3M C;  1V25 A;  3ETC A;  4LFC C;  4GKK C;  3GR1 A;  4NOZ A;  3DAY A;  5BST A;  1K0R A;  4LE5 A;  4OX9 C;  4RM3 A;  4RM2 A;  2KZF A;  2WP0 C;  4I9F A;  4K0K C;  3IEV A;  1N33 C;  5DV9 A;  3A9U A;  4DV2 C;  1IBK C;  3E7X A;  4AQY C;  1JOS A;  5BSM A;  4DV3 C;  3A4I A;  3OTO C;  1L2F A;  4YHH C;  3NPD A;  4JI7 C;  3FCC A;  3IEU A;  5KEI A;  4GKJ C;  3JAM D;  4KTT A;  4IZ6 A;  2CXC A;  1AMU A;  5IFI A;  2YWB A;  2UUA C;  2D1T A;  2E8F A;  1XMQ C;  1USP A;  4LF9 C;  2UUC C;  4G37 A;  5T8S A;  4KHP C;  5ADZ A;  4RLQ A;  1XNR C;  3LNV A;  4JI8 C;  1VLA A;  3PBK A;  1XRC A;  3DHV A;  4RLF A;  4DV6 C;  1UKK A;  4JI3 C;  4BC7 A;  5CZX A;  1HNZ C;  4R1M A;  3PES A;  4ZLP A;  2QVX X;  1FJG C;  1V26 A;  1XRB A;  2Y4N A;  4DV4 C;  2Y4O A;  4LF5 C;  1XRA A;  2V7B A;  1ML8 A;  1RG9 A;  4DCU A;  4GS5 A;  4FTF A;  4PRO C;  4X65 C;  1O93 A;  4BSZ A;  2P02 A;  1LCI A;  4LFB C;  3TQI A;  4PHT A;  4IR7 A;  2PRO A;  4U5Y D;  5K85 A;  3VNQ A;  4YY3 C;  4X66 C;  2AYA A;  4G36 A;  2P2B A;  4B3R C;  3SO4 A;  3TUF A;  1O9T A;  5GTD A;  1ZB8 A;  4DCS A;  5A1I A;  3N2Q A;  4BCA A;  1O92 A;  3GR0 A;  5A1G A;  3RV2 A;  1KKG A;  5BUS A;  2YCB A;  4R1L A;  4JI0 C;  1IBM C;  4HPV A;  4LF4 C;  1XNQ C;  5BSV A;  2OO4 A;  5E7Q A;  5LMU C;  2P2J A;  2D1S A;  4DV1 C;  3B7W A;  2DPL A;  3IML A;  4DUY C;  4BC9 A;  1ZB9 A;  2P2Q A;  2D7V A;  3UZ0 A;  4JI4 C;  4D56 A;  3R9X A;  2QL8 A;  1IBL C;  3IPL A;  2JMP A;  5IWA C;  3S82 A;  1ULT A;  2PN2 A;  4ODJ A;  3EQ6 A;  3VNR A;  2VSQ A;  2ONF A;  3AF5 A;  1MXB A;  4JI6 C;  1BA3 A;  4XX2 A;  4D4I A;  4NXN C;  3TDE A;  4DCV A;  3I07 A;  3EER A;  1FUG A;  2XR1 A;  4JV5 C;  2HJG A;  2UXD C;  3J7A D;  2E0G A;  1HR0 C;  4WV3 A;  3L95 X;  4L4Q A;  3CW8 X;  2BH1 X;  4X62 C;  3CW9 A;  4L2Z A;  2ATW A;  5K8F A;  3I08 A;  1WF3 A;  2QVY X;  4FUT A;  2P2M A;  2P2F A;  3H2T A;  1PG4 A;  4DR5 C;  4MTN A;  1O90 A;  3T1H C;  3VNS A;  4DV0 C;  3LAX A;  4DR1 C;  5AE3 A;  3GPC A;  2ZM6 C;  4NXM C;  2E8E A;  4DV7 C;  1GPM A;  3E7W A;  3AF6 A;  5CZV A;  1N34 C;  1P7L A;  2ASB A;  2OBV A;  5KYT A;  4FUQ A;  1NYE A;  4DR7 C;  2UU9 C;  3KXW A;  4JI2 C;  4DG8 A;  4B3S C;  2D1R A;  1QWI A;  1PA4 A;  5A2Q D;  4RMN A;  3LGX A;  5BUQ A;  2WD9 A;  3NYR A;  4RVN A;  5FLX D;  5BSW A;  3G7S A;  4GXR A;  1MDF A;  4DR4 C;  3C5E A;  4BBY A;  4LF6 C;  4DUZ C;  4JYA C;  1J5E C;  1EGA A;  2Y27 A;  4JI1 C;  2E5L C;  4WS9 A;  4TPS B;  1MKY A;  2E8C A;  3LUS A;  5A19 A;  3ETO A;  4L7I A;  2E7G A;  2UUB C;  1T5D X;  2QVZ X;  4DR2 C;  2DYJ A;  4OYC A;  5AE1 A;  4LF7 C;  1MDB A;  1N2F A;  5IT9 D;  3CJE A;  2P20 A;  3R44 A;  3RG2 A;  2OPL B;  3A9V A;  1PG3 A;  3R9W A;  4R0M A;  4JI5 C;  1N32 C;  3UOW A;  4PZP A;  3NYQ A;  4D4G A;  4ISB A;  4NDN A;  4DR6 C;  4X64 C;  1XMO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...