4DV0C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv0C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv0C02
1PA4A 2BJOA 4DV5C 4LF9C 2HJGA 4MTNA 4DV6C 1N34C 1UKKA 1XMOC 1I94C 1USPA 5LMNC 2XR1A 4X65C 2VQFC 2CXCA 3T1HC 4DCVA 4GKJC 2ATWA 2ONFA 5IT9D 2F4VC 2UXCC 1K0RA 3AF6A 4DV3C 2DYJA 2ZM6C 4DCUA 4LF4C 4JV5C 4DR5C 1KKGA 4DR6C 4DCSA 1N36C 4GKKC 4DV7C 3I07A 1ZB8A 4X62C 4KHPC 2UXBC 5LMUC 3J7AD 1HNWC 2E7GA 1USPB 2PT7G 1EGAA 2QL8A 3EERA 2KZFA 4DR7C 1HNZC 4DV2C 4JI1C 1FJGC 4YHHC 4YY3C 3GKUA 2E8FA 4B3MC 2UUAC 1NYEA 5FLXD 1JOSA 4DR1C 3J81D 4JYAC 4JI7C 2HHHC 2D7VA 2E8CA 1N2FA 4B3RC 1HNXC 2UUCC 2E5LC 1HH2P 4NOZA 4JI8C 2EGTA 4DUYC 4XX2A 4LF8C 4X64C 4JI5C 3T1YC 4DR3C 1QWIA 1L2FA 1ML8A 4NXNC 4JI6C 3AF5A 1HR0C 1IBLC 2YCBA 4DR2C 2PN2A 2OPLA 4JI3C 4B3TC 4LF5C 2VQEC 4DR4C 4MH4A 2CY1A 4DCTA 4DUZC 4LF6C 3IEUA 4DV0C 3J80D 3OTOC 2JMPA 2ASBA 3IEVA 1IBMC 3CJEA 1WH9A 1LQLA 4OX9C 4LFCC 2UXDC 1ZB9A 4LF7C 5A2QD 4BSZA 2OPLB 4K0KC 4NXMC 3JAMD 2UU9C 4JI2C 4JI4C 3LUSA 4JI0C 2E8EA 4B3SC 1N32C 3R9WA 1J5EC 1VLAA 2UUBC 1N33C 3R9XA 4AQYC 5IWAC 5BR8C 1IBKC 4DV1C 4LFAC 1MKYA 4DV4C 1XMQC 1WF3A 4LFBC 1XNQC 4X66C 1XNRC
chains in the Genus database with same CATH superfamily
2M5HA 4PUGA 1PA4A 2WD9A 2HJGA 1N34C 4K0BA 1UKKA 5JRHA 4X65C 5BSMA 2ATWA 1UWDA 5IT9D 3SO4A 3CQ1A 2D1TA 3EQ6A 3AF6A 2M5OA 4D4GA 4ZLPA 4FUTA 1XDXA 4DCUA 3VNSA 1GPMA 1KKGA 3TQIA 1N36C 2QVZX 4GKKC 1WCJA 3I07A 4X62C 4KHPC 2UXBC 5LMUC 2E7GA 2PT7G 2QL8A 4DR7C 1HNZC 2VSQA 4DV2C 4YY3C 3GKUA 4B3MC 3CQ3A 2P2JA 4L2ZA 4LE5A 4JI7C 2CU6A 1N2FA 2YX1A 3C5EA 2E5LC 5BUQA 2EGTA 4FTFA 1P4EA 3T1YC 3CQ2A 3PESA 1XRBA 2YCBA 4DR2C 4WV3A 2PN2A 3RV2A 2P2BA 4KTTA 4JI3C 4B3TC 2ZZMA 4DR4C 5IFIA 2CY1A 4GS5A 4D56A 4DUZC 3IEUA 2E0GA 4DG9A 3OTOC 1V26A 2ASBA 4U5YD 3ETOA 3CJEA 4PHTA 3TR3A 1WH9A 1XRCA 4PROC 4OX9C 4LFCC 5AE2A 4DG8A 2Y4OA 1ZB9A 4RLQA 4LF7C 1P4EC 5BUSA 4RVOA 2YWCA 1O93A 4JI2C 1O92A 1T5HX 4JI0C 4BC7A 2P20A 4B3SC 5IWAC 4LFAC 4DV1C 4DV4C 1WF3A 3LNOA 3A9UA 1ULTA 5KYVA 4WS9A 3NPDA 4X66C 1O90A 2BJOA 3IMLA 4DV5C 4LF9C 4MTNA 1XMOC 2Y27A 1USPA 4RM2A 1LCIA 5BSUA 2VQFC 2CXCA 3AY0A 2ONFA 3LGXA 4D57A 2ZZNA 2UXCC 1M6XC 4DV3C 3IPLA 3UX2A 1XHJA 2AYAA 1YGTA 4DR5C 3TUFA 3FCEA 5KYTA 4IZ6A 1HNWC 2PROA 1EGAA 1V25A 4JI1C 2E8FA 1IB8A 1NYEA 5K85A 2HHHC 2E8CA 2QW0X 3GR1A 1HNXC 3A25A 2DHMA 1HH2P 4NOZA 4R1LA 5DV9A 4X64C 5AE1A 4DR3C 1L2FA 1ML8A 3CW8X 3AF5A 1IBLC 3DHVA 2PG1E 1XS3A 4MH4A 2JNVA 5KEIA 3NYRA 2VZEA 1RY2A 5A19A 5BSWA 4DV0C 3J80D 4OYCA 5BSVA 3S82A 5A1IA 5T8SA 1IBMC 1XRAA 5ADZA 1LQLA 3PBKA 2UXDC 3VNRA 4BSZA 2Z51A 1MXBA 4L7IA 2MCQA 1BA3A 2D1QA 5CZVA 3R9WA 3FM7A 1VLAA 4G37A 1VEHA 1TH5A 1MKYA 2D1SA 3LNVA 4BC9A 3L95X 1P7LA 4RLFA 1O9TA 3A9VA 4PUIA 3O2EA 3GPCA 1MD9A 2KZ0A 4DV6C 1I94C 3N54B 2V7BA 4GKJC 2F4VC 3ETCA 1K0RA 3A4IA 5BURA 4BBYA 4DR6C 2D28C 1ZB8A 3J7AD 2NCLA 1USPB 3PROC 4G1IA 3EERA 2KZFA 3UX3A 4RVNA 1AMUA 4YHHC 4GXQA 4R0MA 1MXCA 1RG9A 3KXWA 5LCIA 4DR1C 4JYAC 3NI2A 3I08A 2D7VA 2P2QA 4B3RC 2UUCC 4JI8C 4ODJA 4XX2A 4LF8C 3CW9A 3UEBA 4JI6C 1HR0C 4ZJZA 2Y4NA 3N2QA 3GR0A 3UOWA 2OPLA 4RM3A 2VQEC 2DPLA 5AE3A 4DCTA 1T5DX 3NYQA 2MMAB 3RG2A 3L8CA 2JMPA 3DLPX 2QVYX 5BSTA 3G7SA 1FLOA 4K0KC 4NXMC 2MM9A 2P02A 2KDNA 3LUSA 1N32C 5BSRA 1J5EC 5A1GA 4AQYC 5GTDA 5BR8C 1IBKC 1MDBA 4JM1A 4NDNA 5CZXA 1XNQC 2OO4A 4L4QA 1XNRC 1NY8A 4IR7A 5LMNC 4RMNA 2XR1A 3VNQA 3T1HC 4DCVA 2ZTBA 2DYJA 2ZM6C 4LF4C 1PG4A 4JV5C 2P2MA 4DCSA 1YJ7A 1PG3A 4I9GA 4I9FA 4DV7C 2D1RA 4FUQA 3B7WA 4OXIA 4PUHA 1FJGC 1M6XA 4BCAA 2YWBA 2UUAC 1MDFA 5FLXD 1JOSA 3J81D 4G36A 3UZ0A 3E7XA 2BH1X 3DAYA 3H2TA 3LAXA 4DUYC 5H9UA 4JI5C 2OBVA 1QWIA 4NXNC 4HPVA 1PU1A 4LF5C 3R44A 1V60A 4LF6C 1MXAA 5T8TA 3IEVA 4TPSB 3E7WA 3TDEA 3FCCA 4EATA 4KTVA 2QVXX 5E7QA 5A2QD 4GXRA 2OPLB 3JAMD 3A26A 4R1MA 2UU9C 4ISBA 2D27A 4JI4C 1FUGA 2E8EA 4PZPA 4D4IA 2UUBC 2WP0C 1N33C 1QM4A 3R9XA 2P2FA 1XMQC 4LFBC 3K6RA 5K8FA
chains in the Genus database with same CATH topology
1PA4A 2WD9A 2HJGA 1N34C 4K0BA 1UKKA 5JRHA 4X65C 5BSMA 2ATWA 5IT9D 3SO4A 3EQ6A 2D1TA 3AF6A 4D4GA 4ZLPA 4FUTA 4DCUA 3VNSA 1GPMA 1KKGA 3TQIA 1N36C 2QVZX 4GKKC 2UXBC 3I07A 4X62C 4KHPC 5LMUC 2E7GA 2PT7G 2QL8A 4DR7C 1HNZC 2VSQA 4DV2C 4YY3C 3GKUA 4B3MC 2P2JA 4L2ZA 4LE5A 4JI7C 1N2FA 3C5EA 2E5LC 5BUQA 2EGTA 4FTFA 3T1YC 3PESA 1XRBA 2YCBA 4DR2C 4WV3A 2PN2A 3RV2A 2P2BA 4KTTA 4JI3C 4B3TC 4DR4C 5IFIA 2CY1A 4GS5A 4D56A 4DUZC 3IEUA 2E0GA 4DG9A 3OTOC 1V26A 2ASBA 4U5YD 3ETOA 3CJEA 4PHTA 1WH9A 1XRCA 4PROC 4OX9C 4LFCC 5AE2A 4DG8A 2Y4OA 1ZB9A 4RLQA 4LF7C 5BUSA 4RVOA 2YWCA 1O93A 4JI2C 1O92A 1T5HX 4JI0C 4BC7A 2P20A 4B3SC 5IWAC 4LFAC 4DV1C 4DV4C 1WF3A 3A9UA 1ULTA 5KYVA 4WS9A 3NPDA 4X66C 1O90A 2BJOA 3IMLA 4DV5C 4LF9C 4MTNA 1XMOC 2Y27A 1USPA 4RM2A 1LCIA 5BSUA 2VQFC 2CXCA 2ONFA 3LGXA 4D57A 2UXCC 4DV3C 3IPLA 2AYAA 4DR5C 3TUFA 3FCEA 5KYTA 4IZ6A 1HNWC 2PROA 1EGAA 1V25A 4JI1C 2E8FA 1NYEA 5K85A 2HHHC 2E8CA 2QW0X 3GR1A 1HNXC 1HH2P 4NOZA 4R1LA 5DV9A 4X64C 5AE1A 4DR3C 1L2FA 1ML8A 3CW8X 3AF5A 1IBLC 3DHVA 4MH4A 5KEIA 3NYRA 2VZEA 1RY2A 5A19A 5BSWA 4DV0C 3J80D 4OYCA 5BSVA 3S82A 5A1IA 5T8SA 1IBMC 1XRAA 5ADZA 1LQLA 3PBKA 2UXDC 3VNRA 4BSZA 1MXBA 4L7IA 1BA3A 2D1QA 5CZVA 3R9WA 1VLAA 4G37A 1MKYA 2D1SA 3LNVA 4BC9A 3L95X 1P7LA 4RLFA 1O9TA 3A9VA 3GPCA 1MD9A 4DV6C 1I94C 3N54B 2V7BA 4GKJC 2F4VC 3ETCA 1K0RA 3A4IA 5BURA 4BBYA 4DR6C 2D28C 1ZB8A 3J7AD 1USPB 3PROC 4G1IA 3EERA 2KZFA 1AMUA 4RVNA 4YHHC 4GXQA 4R0MA 1MXCA 1RG9A 3KXWA 4DR1C 4JYAC 3NI2A 3I08A 2D7VA 2P2QA 4B3RC 2UUCC 4JI8C 4ODJA 4XX2A 4LF8C 3CW9A 4JI6C 1HR0C 4ZJZA 2Y4NA 3N2QA 3GR0A 3UOWA 2OPLA 4RM3A 2VQEC 2DPLA 5AE3A 4DCTA 1T5DX 3NYQA 3RG2A 3L8CA 2JMPA 3DLPX 2QVYX 5BSTA 3G7SA 4K0KC 4NXMC 2P02A 3LUSA 1N32C 5BSRA 1J5EC 5A1GA 4AQYC 5GTDA 5BR8C 1IBKC 1MDBA 4JM1A 4NDNA 5CZXA 1XNQC 2OO4A 4L4QA 1XNRC 4IR7A 5LMNC 4RMNA 2XR1A 3VNQA 3T1HC 4DCVA 2DYJA 2ZM6C 4LF4C 1PG4A 4JV5C 2P2MA 4DCSA 1YJ7A 1PG3A 4I9GA 4I9FA 4DV7C 2D1RA 4FUQA 3B7WA 4OXIA 1FJGC 4BCAA 2YWBA 2UUAC 1MDFA 5FLXD 1JOSA 3J81D 4G36A 3UZ0A 3E7XA 2BH1X 3DAYA 3H2TA 3LAXA 4DUYC 5H9UA 4JI5C 2OBVA 1QWIA 4NXNC 4HPVA 4LF5C 3R44A 4LF6C 1MXAA 5T8TA 3IEVA 4TPSB 3E7WA 3TDEA 3FCCA 4EATA 4KTVA 2QVXX 5E7QA 5A2QD 4GXRA 2OPLB 3JAMD 4R1MA 2UU9C 4ISBA 2D27A 4JI4C 1FUGA 2E8EA 4PZPA 4D4IA 2UUBC 2WP0C 1N33C 1QM4A 3R9XA 2P2FA 1XMQC 4LFBC 5K8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA4 A;  2BJO A;  4DV5 C;  4LF9 C;  2HJG A;  4MTN A;  4DV6 C;  1N34 C;  1UKK A;  1XMO C;  1I94 C;  1USP A;  5LMN C;  2XR1 A;  4X65 C;  2VQF C;  2CXC A;  3T1H C;  4DCV A;  4GKJ C;  2ATW A;  2ONF A;  5IT9 D;  2F4V C;  2UXC C;  1K0R A;  3AF6 A;  4DV3 C;  2DYJ A;  2ZM6 C;  4DCU A;  4LF4 C;  4JV5 C;  4DR5 C;  1KKG A;  4DR6 C;  4DCS A;  1N36 C;  4GKK C;  4DV7 C;  3I07 A;  1ZB8 A;  4X62 C;  4KHP C;  2UXB C;  5LMU C;  3J7A D;  1HNW C;  2E7G A;  1USP B;  2PT7 G;  1EGA A;  2QL8 A;  3EER A;  2KZF A;  4DR7 C;  1HNZ C;  4DV2 C;  4JI1 C;  1FJG C;  4YHH C;  4YY3 C;  3GKU A;  2E8F A;  4B3M C;  2UUA C;  1NYE A;  5FLX D;  1JOS A;  4DR1 C;  3J81 D;  4JYA C;  4JI7 C;  2HHH C;  2D7V A;  2E8C A;  1N2F A;  4B3R C;  1HNX C;  2UUC C;  2E5L C;  1HH2 P;  4NOZ A;  4JI8 C;  2EGT A;  4DUY C;  4XX2 A;  4LF8 C;  4X64 C;  4JI5 C;  3T1Y C;  4DR3 C;  1QWI A;  1L2F A;  1ML8 A;  4NXN C;  4JI6 C;  3AF5 A;  1HR0 C;  1IBL C;  2YCB A;  4DR2 C;  2PN2 A;  2OPL A;  4JI3 C;  4B3T C;  4LF5 C;  2VQE C;  4DR4 C;  4MH4 A;  2CY1 A;  4DCT A;  4DUZ C;  4LF6 C;  3IEU A;  4DV0 C;  3J80 D;  3OTO C;  2JMP A;  2ASB A;  3IEV A;  1IBM C;  3CJE A;  1WH9 A;  1LQL A;  4OX9 C;  4LFC C;  2UXD C;  1ZB9 A;  4LF7 C;  5A2Q D;  4BSZ A;  2OPL B;  4K0K C;  4NXM C;  3JAM D;  2UU9 C;  4JI2 C;  4JI4 C;  3LUS A;  4JI0 C;  2E8E A;  4B3S C;  1N32 C;  3R9W A;  1J5E C;  1VLA A;  2UUB C;  1N33 C;  3R9X A;  4AQY C;  5IWA C;  5BR8 C;  1IBK C;  4DV1 C;  4LFA C;  1MKY A;  4DV4 C;  1XMQ C;  1WF3 A;  4LFB C;  1XNQ C;  4X66 C;  1XNR C; 
#chains in the Genus database with same CATH topology
 2M5H A;  4PUG A;  1PA4 A;  2WD9 A;  2HJG A;  1N34 C;  4K0B A;  1UKK A;  5JRH A;  4X65 C;  5BSM A;  2ATW A;  1UWD A;  5IT9 D;  3SO4 A;  3CQ1 A;  2D1T A;  3EQ6 A;  3AF6 A;  2M5O A;  4D4G A;  4ZLP A;  4FUT A;  1XDX A;  4DCU A;  3VNS A;  1GPM A;  1KKG A;  3TQI A;  1N36 C;  2QVZ X;  4GKK C;  1WCJ A;  3I07 A;  4X62 C;  4KHP C;  2UXB C;  5LMU C;  2E7G A;  2PT7 G;  2QL8 A;  4DR7 C;  1HNZ C;  2VSQ A;  4DV2 C;  4YY3 C;  3GKU A;  4B3M C;  3CQ3 A;  2P2J A;  4L2Z A;  4LE5 A;  4JI7 C;  2CU6 A;  1N2F A;  2YX1 A;  3C5E A;  2E5L C;  5BUQ A;  2EGT A;  4FTF A;  1P4E A;  3T1Y C;  3CQ2 A;  3PES A;  1XRB A;  2YCB A;  4DR2 C;  4WV3 A;  2PN2 A;  3RV2 A;  2P2B A;  4KTT A;  4JI3 C;  4B3T C;  2ZZM A;  4DR4 C;  5IFI A;  2CY1 A;  4GS5 A;  4D56 A;  4DUZ C;  3IEU A;  2E0G A;  4DG9 A;  3OTO C;  1V26 A;  2ASB A;  4U5Y D;  3ETO A;  3CJE A;  4PHT A;  3TR3 A;  1WH9 A;  1XRC A;  4PRO C;  4OX9 C;  4LFC C;  5AE2 A;  4DG8 A;  2Y4O A;  1ZB9 A;  4RLQ A;  4LF7 C;  1P4E C;  5BUS A;  4RVO A;  2YWC A;  1O93 A;  4JI2 C;  1O92 A;  1T5H X;  4JI0 C;  4BC7 A;  2P20 A;  4B3S C;  5IWA C;  4LFA C;  4DV1 C;  4DV4 C;  1WF3 A;  3LNO A;  3A9U A;  1ULT A;  5KYV A;  4WS9 A;  3NPD A;  4X66 C;  1O90 A;  2BJO A;  3IML A;  4DV5 C;  4LF9 C;  4MTN A;  1XMO C;  2Y27 A;  1USP A;  4RM2 A;  1LCI A;  5BSU A;  2VQF C;  2CXC A;  3AY0 A;  2ONF A;  3LGX A;  4D57 A;  2ZZN A;  2UXC C;  1M6X C;  4DV3 C;  3IPL A;  3UX2 A;  1XHJ A;  2AYA A;  1YGT A;  4DR5 C;  3TUF A;  3FCE A;  5KYT A;  4IZ6 A;  1HNW C;  2PRO A;  1EGA A;  1V25 A;  4JI1 C;  2E8F A;  1IB8 A;  1NYE A;  5K85 A;  2HHH C;  2E8C A;  2QW0 X;  3GR1 A;  1HNX C;  3A25 A;  2DHM A;  1HH2 P;  4NOZ A;  4R1L A;  5DV9 A;  4X64 C;  5AE1 A;  4DR3 C;  1L2F A;  1ML8 A;  3CW8 X;  3AF5 A;  1IBL C;  3DHV A;  2PG1 E;  1XS3 A;  4MH4 A;  2JNV A;  5KEI A;  3NYR A;  2VZE A;  1RY2 A;  5A19 A;  5BSW A;  4DV0 C;  3J80 D;  4OYC A;  5BSV A;  3S82 A;  5A1I A;  5T8S A;  1IBM C;  1XRA A;  5ADZ A;  1LQL A;  3PBK A;  2UXD C;  3VNR A;  4BSZ A;  2Z51 A;  1MXB A;  4L7I A;  2MCQ A;  1BA3 A;  2D1Q A;  5CZV A;  3R9W A;  3FM7 A;  1VLA A;  4G37 A;  1VEH A;  1TH5 A;  1MKY A;  2D1S A;  3LNV A;  4BC9 A;  3L95 X;  1P7L A;  4RLF A;  1O9T A;  3A9V A;  4PUI A;  3O2E A;  3GPC A;  1MD9 A;  2KZ0 A;  4DV6 C;  1I94 C;  3N54 B;  2V7B A;  4GKJ C;  2F4V C;  3ETC A;  1K0R A;  3A4I A;  5BUR A;  4BBY A;  4DR6 C;  2D28 C;  1ZB8 A;  3J7A D;  2NCL A;  1USP B;  3PRO C;  4G1I A;  3EER A;  2KZF A;  3UX3 A;  4RVN A;  1AMU A;  4YHH C;  4GXQ A;  4R0M A;  1MXC A;  1RG9 A;  3KXW A;  5LCI A;  4DR1 C;  4JYA C;  3NI2 A;  3I08 A;  2D7V A;  2P2Q A;  4B3R C;  2UUC C;  4JI8 C;  4ODJ A;  4XX2 A;  4LF8 C;  3CW9 A;  3UEB A;  4JI6 C;  1HR0 C;  4ZJZ A;  2Y4N A;  3N2Q A;  3GR0 A;  3UOW A;  2OPL A;  4RM3 A;  2VQE C;  2DPL A;  5AE3 A;  4DCT A;  1T5D X;  3NYQ A;  2MMA B;  3RG2 A;  3L8C A;  2JMP A;  3DLP X;  2QVY X;  5BST A;  3G7S A;  1FLO A;  4K0K C;  4NXM C;  2MM9 A;  2P02 A;  2KDN A;  3LUS A;  1N32 C;  5BSR A;  1J5E C;  5A1G A;  4AQY C;  5GTD A;  5BR8 C;  1IBK C;  1MDB A;  4JM1 A;  4NDN A;  5CZX A;  1XNQ C;  2OO4 A;  4L4Q A;  1XNR C;  1NY8 A;  4IR7 A;  5LMN C;  4RMN A;  2XR1 A;  3VNQ A;  3T1H C;  4DCV A;  2ZTB A;  2DYJ A;  2ZM6 C;  4LF4 C;  1PG4 A;  4JV5 C;  2P2M A;  4DCS A;  1YJ7 A;  1PG3 A;  4I9G A;  4I9F A;  4DV7 C;  2D1R A;  4FUQ A;  3B7W A;  4OXI A;  4PUH A;  1FJG C;  1M6X A;  4BCA A;  2YWB A;  2UUA C;  1MDF A;  5FLX D;  1JOS A;  3J81 D;  4G36 A;  3UZ0 A;  3E7X A;  2BH1 X;  3DAY A;  3H2T A;  3LAX A;  4DUY C;  5H9U A;  4JI5 C;  2OBV A;  1QWI A;  4NXN C;  4HPV A;  1PU1 A;  4LF5 C;  3R44 A;  1V60 A;  4LF6 C;  1MXA A;  5T8T A;  3IEV A;  4TPS B;  3E7W A;  3TDE A;  3FCC A;  4EAT A;  4KTV A;  2QVX X;  5E7Q A;  5A2Q D;  4GXR A;  2OPL B;  3JAM D;  3A26 A;  4R1M A;  2UU9 C;  4ISB A;  2D27 A;  4JI4 C;  1FUG A;  2E8E A;  4PZP A;  4D4I A;  2UUB C;  2WP0 C;  1N33 C;  1QM4 A;  3R9X A;  2P2F A;  1XMQ C;  4LFB C;  3K6R A;  5K8F A; 
#chains in the Genus database with same CATH homology
 1PA4 A;  2WD9 A;  2HJG A;  1N34 C;  4K0B A;  1UKK A;  5JRH A;  4X65 C;  5BSM A;  2ATW A;  5IT9 D;  3SO4 A;  3EQ6 A;  2D1T A;  3AF6 A;  4D4G A;  4ZLP A;  4FUT A;  4DCU A;  3VNS A;  1GPM A;  1KKG A;  3TQI A;  1N36 C;  2QVZ X;  4GKK C;  2UXB C;  3I07 A;  4X62 C;  4KHP C;  5LMU C;  2E7G A;  2PT7 G;  2QL8 A;  4DR7 C;  1HNZ C;  2VSQ A;  4DV2 C;  4YY3 C;  3GKU A;  4B3M C;  2P2J A;  4L2Z A;  4LE5 A;  4JI7 C;  1N2F A;  3C5E A;  2E5L C;  5BUQ A;  2EGT A;  4FTF A;  3T1Y C;  3PES A;  1XRB A;  2YCB A;  4DR2 C;  4WV3 A;  2PN2 A;  3RV2 A;  2P2B A;  4KTT A;  4JI3 C;  4B3T C;  4DR4 C;  5IFI A;  2CY1 A;  4GS5 A;  4D56 A;  4DUZ C;  3IEU A;  2E0G A;  4DG9 A;  3OTO C;  1V26 A;  2ASB A;  4U5Y D;  3ETO A;  3CJE A;  4PHT A;  1WH9 A;  1XRC A;  4PRO C;  4OX9 C;  4LFC C;  5AE2 A;  4DG8 A;  2Y4O A;  1ZB9 A;  4RLQ A;  4LF7 C;  5BUS A;  4RVO A;  2YWC A;  1O93 A;  4JI2 C;  1O92 A;  1T5H X;  4JI0 C;  4BC7 A;  2P20 A;  4B3S C;  5IWA C;  4LFA C;  4DV1 C;  4DV4 C;  1WF3 A;  3A9U A;  1ULT A;  5KYV A;  4WS9 A;  3NPD A;  4X66 C;  1O90 A;  2BJO A;  3IML A;  4DV5 C;  4LF9 C;  4MTN A;  1XMO C;  2Y27 A;  1USP A;  4RM2 A;  1LCI A;  5BSU A;  2VQF C;  2CXC A;  2ONF A;  3LGX A;  4D57 A;  2UXC C;  4DV3 C;  3IPL A;  2AYA A;  4DR5 C;  3TUF A;  3FCE A;  5KYT A;  4IZ6 A;  1HNW C;  2PRO A;  1EGA A;  1V25 A;  4JI1 C;  2E8F A;  1NYE A;  5K85 A;  2HHH C;  2E8C A;  2QW0 X;  3GR1 A;  1HNX C;  1HH2 P;  4NOZ A;  4R1L A;  5DV9 A;  4X64 C;  5AE1 A;  4DR3 C;  1L2F A;  1ML8 A;  3CW8 X;  3AF5 A;  1IBL C;  3DHV A;  4MH4 A;  5KEI A;  3NYR A;  2VZE A;  1RY2 A;  5A19 A;  5BSW A;  4DV0 C;  3J80 D;  4OYC A;  5BSV A;  3S82 A;  5A1I A;  5T8S A;  1IBM C;  1XRA A;  5ADZ A;  1LQL A;  3PBK A;  2UXD C;  3VNR A;  4BSZ A;  1MXB A;  4L7I A;  1BA3 A;  2D1Q A;  5CZV A;  3R9W A;  1VLA A;  4G37 A;  1MKY A;  2D1S A;  3LNV A;  4BC9 A;  3L95 X;  1P7L A;  4RLF A;  1O9T A;  3A9V A;  3GPC A;  1MD9 A;  4DV6 C;  1I94 C;  3N54 B;  2V7B A;  4GKJ C;  2F4V C;  3ETC A;  1K0R A;  3A4I A;  5BUR A;  4BBY A;  4DR6 C;  2D28 C;  1ZB8 A;  3J7A D;  1USP B;  3PRO C;  4G1I A;  3EER A;  2KZF A;  1AMU A;  4RVN A;  4YHH C;  4GXQ A;  4R0M A;  1MXC A;  1RG9 A;  3KXW A;  4DR1 C;  4JYA C;  3NI2 A;  3I08 A;  2D7V A;  2P2Q A;  4B3R C;  2UUC C;  4JI8 C;  4ODJ A;  4XX2 A;  4LF8 C;  3CW9 A;  4JI6 C;  1HR0 C;  4ZJZ A;  2Y4N A;  3N2Q A;  3GR0 A;  3UOW A;  2OPL A;  4RM3 A;  2VQE C;  2DPL A;  5AE3 A;  4DCT A;  1T5D X;  3NYQ A;  3RG2 A;  3L8C A;  2JMP A;  3DLP X;  2QVY X;  5BST A;  3G7S A;  4K0K C;  4NXM C;  2P02 A;  3LUS A;  1N32 C;  5BSR A;  1J5E C;  5A1G A;  4AQY C;  5GTD A;  5BR8 C;  1IBK C;  1MDB A;  4JM1 A;  4NDN A;  5CZX A;  1XNQ C;  2OO4 A;  4L4Q A;  1XNR C;  4IR7 A;  5LMN C;  4RMN A;  2XR1 A;  3VNQ A;  3T1H C;  4DCV A;  2DYJ A;  2ZM6 C;  4LF4 C;  1PG4 A;  4JV5 C;  2P2M A;  4DCS A;  1YJ7 A;  1PG3 A;  4I9G A;  4I9F A;  4DV7 C;  2D1R A;  4FUQ A;  3B7W A;  4OXI A;  1FJG C;  4BCA A;  2YWB A;  2UUA C;  1MDF A;  5FLX D;  1JOS A;  3J81 D;  4G36 A;  3UZ0 A;  3E7X A;  2BH1 X;  3DAY A;  3H2T A;  3LAX A;  4DUY C;  5H9U A;  4JI5 C;  2OBV A;  1QWI A;  4NXN C;  4HPV A;  4LF5 C;  3R44 A;  4LF6 C;  1MXA A;  5T8T A;  3IEV A;  4TPS B;  3E7W A;  3TDE A;  3FCC A;  4EAT A;  4KTV A;  2QVX X;  5E7Q A;  5A2Q D;  4GXR A;  2OPL B;  3JAM D;  4R1M A;  2UU9 C;  4ISB A;  2D27 A;  4JI4 C;  1FUG A;  2E8E A;  4PZP A;  4D4I A;  2UUB C;  2WP0 C;  1N33 C;  1QM4 A;  3R9X A;  2P2F A;  1XMQ C;  4LFB C;  5K8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...