4GKJC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkjC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkjC02
1KKGA 4DR2C 2KZFA 1N34C 4DV4C 2DYJA 3IEUA 1J5EC 4X64C 4LF5C 1L2FA 2E8FA 4MTNA 2OPLA 4NXMC 1VLAA 3J80D 3LUSA 3EERA 3AF5A 4LFBC 1N33C 2QL8A 4DR5C 3T1YC 2JMPA 2F4VC 4GKKC 1K0RA 2E8CA 2E7GA 4BSZA 4YY3C 1HH2P 4JI0C 4MH4A 5FLXD 4DUZC 1WF3A 3AF6A 1IBKC 4DV7C 2VQEC 2BJOA 1HR0C 1I94C 4DV2C 4JI4C 2CY1A 1XNRC 3R9WA 1N36C 1ML8A 1USPA 1HNXC 4DCTA 4DV6C 4DR6C 4JV5C 2E5LC 4JI1C 4JI6C 5BR8C 4LF6C 1ZB8A 4NXNC 2UXCC 2UXDC 4DR7C 4LF4C 4B3SC 2ATWA 4JI7C 4JI2C 3GKUA 1HNWC 2CXCA 3OTOC 2PT7G 5IT9D 4OX9C 2ASBA 3T1HC 4DR4C 1XMQC 1HNZC 4DV1C 1JOSA 2YCBA 4DCUA 4JI3C 1IBLC 1PA4A 1XMOC 1USPB 2HJGA 2VQFC 4JI5C 2XR1A 5IWAC 3IEVA 2ZM6C 4X65C 3I07A 1EGAA 4X66C 1IBMC 2D7VA 4K0KC 4DCVA 4DV3C 1WH9A 4XX2A 3J81D 2PN2A 2UUBC 2EGTA 4DUYC 1N2FA 1MKYA 2UUCC 5LMUC 3R9XA 2UUAC 1QWIA 1N32C 4LF9C 5LMNC 4DV5C 2UU9C 1XNQC 4DCSA 3CJEA 4KHPC 4LF8C 2OPLB 4X62C 2HHHC 4JYAC 4LFCC 4JI8C 3J7AD 4NOZA 4YHHC 1LQLA 4B3RC 4DR3C 4DV0C 1ZB9A 1NYEA 4LF7C 2E8EA 4DR1C 5A2QD 4AQYC 1FJGC 2UXBC 1UKKA 4B3TC 2ONFA 4GKJC 4B3MC 4LFAC 3JAMD
chains in the Genus database with same CATH superfamily
1N34C 2DHMA 4G37A 4RM3A 4OXIA 5BSRA 1T5HX 3A9UA 1L2FA 4D56A 4NXMC 3LUSA 2P2JA 3EERA 5K85A 4LFBC 5GTDA 3T1YC 2F4VC 4GKKC 4R1LA 3NYQA 2E7GA 5A19A 4JI0C 4MH4A 4DUZC 3AF6A 1IBKC 3A9VA 1ULTA 4U5YD 2MMAB 1XNRC 3R9WA 4D4IA 2OO4A 2P2QA 4DCTA 2Y4OA 2JNVA 4DR6C 3VNQA 4JV5C 1MXCA 2E0GA 3ETOA 3A25A 3K6RA 5AE1A 1ZB8A 4NXNC 3KXWA 2UXCC 2OBVA 5BSTA 4BC7A 4JI7C 3GKUA 2CXCA 3OTOC 4G36A 2D1TA 4RVNA 5BSUA 3G7SA 1T5DX 1RG9A 2PT7G 4I9FA 3NYRA 2ZZMA 2NCLA 1PU1A 4ODJA 2D28C 4I9GA 4DCUA 1USPB 2HJGA 1P4EC 2VQFC 2XR1A 3UZ0A 5KYTA 3FCEA 5IWAC 3IEVA 3GR0A 3TR3A 4GXRA 4X66C 2P2MA 2D7VA 3FM7A 1O92A 3PESA 4DCVA 4DV3C 3L95X 1IB8A 3LAXA 4L2ZA 2PN2A 4PROC 1V25A 2QVYX 2QVZX 4EATA 1NY8A 2UU9C 1AMUA 4KHPC 3GPCA 1V60A 4NDNA 1NYEA 3GR1A 2KZFA 4IZ6A 4RLFA 3IEUA 3UX3A 4BBYA 1J5EC 4LF5C 1PG3A 3LNOA 3J80D 4G1IA 1N33C 1K0RA 3A4IA 2E8CA 4FUTA 4YY3C 1HH2P 3N2QA 5BURA 5KEIA 4DV7C 2BJOA 2VQEC 1HR0C 4JI4C 3DHVA 2CY1A 5A1IA 4OYCA 4DV6C 2P2BA 2E5LC 4BC9A 4JI6C 3PROC 5BR8C 4LF6C 2KDNA 4DR7C 4ZJZA 4LF4C 2BH1X 3NPDA 5BSWA 3NI2A 5BUQA 1MXAA 5IT9D 4OX9C 2M5OA 3T1HC 4DR4C 3UX2A 2M5HA 3ETCA 4KTVA 1UWDA 4JI3C 1PG4A 3CQ1A 2KZ0A 4ZLPA 2P20A 1BA3A 5BSMA 4X65C 2Y27A 1GPMA 1QM4A 1IBMC 4K0KC 1WH9A 2CU6A 3J81D 1MKYA 1XRCA 5LMUC 2PROA 3EQ6A 3R9XA 4WS9A 1QWIA 1XRBA 5LMNC 3H2TA 4DG9A 4DCSA 3CJEA 1FLOA 2OPLB 1XDXA 1LQLA 4B3RC 3IMLA 5H9UA 5AE3A 2D27A 2UXBC 4B3TC 3N54B 2ZZNA 4GKJC 2P2FA 1FUGA 2ZTBA 5AE2A 4WV3A 4DR2C 2DYJA 2E8FA 4MTNA 2OPLA 1YJ7A 2QL8A 3TQIA 4BSZA 1XS3A 4FTFA 5FLXD 1WF3A 3C5EA 4GXQA 4DV2C 3R44A 5IFIA 1MDBA 3CW9A 5LCIA 5K8FA 4JI1C 3RV2A 2WP0C 4HPVA 1XRAA 2UXDC 2D1SA 2ATWA 4RVOA 2ASBA 4K0BA 4BCAA 3DAYA 5E7QA 4RLQA 1XMQC 3UEBA 5JRHA 1JOSA 1P7LA 2P02A 1MXBA 3LGXA 1IBLC 5KYVA 1XMOC 3SO4A 1O93A 2QVXX 4PZPA 3I07A 4DG8A 3AY0A 2D1QA 3I08A 4XX2A 5CZVA 4DUYC 1N2FA 2UUCC 2QW0X 2UUAC 1N32C 4LF9C 4DV5C 5A1GA 3CQ2A 3B7WA 1M6XA 4NOZA 4YHHC 4FUQA 3CQ3A 4D4GA 4RMNA 4LE5A 2YWCA 3TUFA 3VNSA 1RY2A 4LF7C 4DR1C 1FJGC 1UKKA 2PG1E 4B3MC 1TH5A 5ADZA 3JAMD 1KKGA 4DV4C 4X64C 3E7XA 3E7WA 3PBKA 1VLAA 4KTTA 3AF5A 3UOWA 4DR5C 2JMPA 4R0MA 3FCCA 5CZXA 2WD9A 5T8TA 1I94C 4JM1A 3CW8X 1N36C 1ML8A 1USPA 1HNXC 4PUHA 5BUSA 3S82A 4L4QA 3VNRA 4B3SC 2Z51A 4JI2C 1HNWC 1XHJA 2Y4NA 3L8CA 1P4EA 4L7IA 5DV9A 1WCJA 2YWBA 1HNZC 1V26A 4DV1C 4IR7A 2YCBA 4PUGA 1PA4A 5T8SA 4JI5C 1MDFA 2MCQA 2VZEA 3LNVA 4GS5A 2ZM6C 1EGAA 3IPLA 2D1RA 4ISBA 3DLPX 4D57A 2UUBC 2EGTA 3A26A 4PUIA 1VEHA 1XNQC 5BSVA 1M6XC 4LF8C 4X62C 2HHHC 4JYAC 2AYAA 4LFCC 4JI8C 3J7AD 2YX1A 4DR3C 4PHTA 4DV0C 4RM2A 1ZB9A 4R1MA 4TPSB 1MD9A 1O9TA 2V7BA 3TDEA 2E8EA 4AQYC 5A2QD 1O90A 1YGTA 1LCIA 2ONFA 3O2EA 2MM9A 4LFAC 2VSQA 2DPLA 3RG2A
chains in the Genus database with same CATH topology
1N34C 4G37A 4RM3A 4OXIA 5BSRA 1T5HX 3A9UA 1L2FA 4D56A 4NXMC 3LUSA 2P2JA 3EERA 5K85A 4LFBC 5GTDA 3T1YC 2F4VC 4GKKC 4R1LA 3NYQA 2E7GA 5A19A 4JI0C 4MH4A 4DUZC 3AF6A 1IBKC 3A9VA 1ULTA 4U5YD 1XNRC 3R9WA 4D4IA 2OO4A 2P2QA 4DCTA 2Y4OA 4DR6C 3VNQA 4JV5C 1MXCA 2E0GA 3ETOA 5AE1A 1ZB8A 4NXNC 3KXWA 2UXCC 2OBVA 5BSTA 4BC7A 4JI7C 3GKUA 2CXCA 3OTOC 4G36A 2D1TA 4RVNA 5BSUA 3G7SA 1T5DX 1RG9A 2PT7G 4I9FA 3NYRA 4ODJA 2D28C 4I9GA 4DCUA 1USPB 2HJGA 2VQFC 2XR1A 3UZ0A 5KYTA 3FCEA 5IWAC 3IEVA 3GR0A 4GXRA 4X66C 2P2MA 2D7VA 1O92A 3PESA 4DCVA 4DV3C 3L95X 3LAXA 4L2ZA 2PN2A 4PROC 1V25A 2QVYX 2QVZX 4EATA 2UU9C 1AMUA 4KHPC 3GPCA 4NDNA 1NYEA 3GR1A 2KZFA 4IZ6A 4RLFA 3IEUA 4BBYA 1J5EC 4LF5C 1PG3A 3J80D 4G1IA 1N33C 1K0RA 3A4IA 2E8CA 4FUTA 4YY3C 1HH2P 3N2QA 5BURA 5KEIA 4DV7C 2BJOA 2VQEC 1HR0C 4JI4C 3DHVA 2CY1A 5A1IA 4OYCA 4DV6C 2P2BA 2E5LC 4BC9A 4JI6C 3PROC 5BR8C 4LF6C 4DR7C 4ZJZA 4LF4C 2BH1X 3NPDA 5BSWA 3NI2A 5BUQA 1MXAA 5IT9D 4OX9C 3T1HC 4DR4C 3ETCA 4KTVA 4JI3C 1PG4A 4ZLPA 2P20A 1BA3A 5BSMA 4X65C 2Y27A 1GPMA 1QM4A 1IBMC 4K0KC 1WH9A 3J81D 1MKYA 1XRCA 5LMUC 2PROA 3EQ6A 3R9XA 4WS9A 1QWIA 1XRBA 5LMNC 3H2TA 4DG9A 4DCSA 3CJEA 2OPLB 1LQLA 4B3RC 3IMLA 5H9UA 5AE3A 2D27A 2UXBC 4B3TC 3N54B 4GKJC 2P2FA 1FUGA 5AE2A 4WV3A 4DR2C 2DYJA 2E8FA 4MTNA 2OPLA 1YJ7A 2QL8A 3TQIA 4BSZA 4FTFA 5FLXD 1WF3A 3C5EA 4GXQA 4DV2C 3R44A 5IFIA 1MDBA 3CW9A 5K8FA 4JI1C 3RV2A 2WP0C 4HPVA 1XRAA 2UXDC 2D1SA 2ATWA 4RVOA 2ASBA 4K0BA 4BCAA 3DAYA 5E7QA 4RLQA 1XMQC 5JRHA 1JOSA 1P7LA 2P02A 1MXBA 3LGXA 1IBLC 5KYVA 1XMOC 3SO4A 1O93A 2QVXX 4PZPA 3I07A 3I08A 2D1QA 4DG8A 4XX2A 5CZVA 4DUYC 1N2FA 2UUCC 2QW0X 2UUAC 1N32C 4LF9C 4DV5C 5A1GA 3B7WA 4NOZA 4YHHC 4FUQA 4D4GA 4RMNA 4LE5A 2YWCA 3TUFA 3VNSA 1RY2A 4LF7C 4DR1C 1FJGC 1UKKA 4B3MC 5ADZA 3JAMD 1KKGA 4DV4C 4X64C 3E7XA 3E7WA 3PBKA 1VLAA 4KTTA 3AF5A 3UOWA 4DR5C 2JMPA 4R0MA 3FCCA 5CZXA 2WD9A 5T8TA 1I94C 4JM1A 3CW8X 1N36C 1ML8A 1USPA 1HNXC 5BUSA 3S82A 4L4QA 3VNRA 4B3SC 4JI2C 1HNWC 2Y4NA 3L8CA 4L7IA 5DV9A 2YWBA 1HNZC 1V26A 4DV1C 4IR7A 2YCBA 1PA4A 5T8SA 4JI5C 1MDFA 2VZEA 3LNVA 4GS5A 2ZM6C 1EGAA 3IPLA 2D1RA 4ISBA 3DLPX 4D57A 2UUBC 2EGTA 1XNQC 5BSVA 4LF8C 4X62C 2HHHC 4JYAC 2AYAA 4LFCC 4JI8C 3J7AD 4DR3C 4PHTA 4DV0C 4RM2A 1ZB9A 4R1MA 4TPSB 1MD9A 1O9TA 2V7BA 3TDEA 2E8EA 4AQYC 5A2QD 1O90A 1LCIA 2ONFA 4LFAC 2VSQA 2DPLA 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKG A;  4DR2 C;  2KZF A;  1N34 C;  4DV4 C;  2DYJ A;  3IEU A;  1J5E C;  4X64 C;  4LF5 C;  1L2F A;  2E8F A;  4MTN A;  2OPL A;  4NXM C;  1VLA A;  3J80 D;  3LUS A;  3EER A;  3AF5 A;  4LFB C;  1N33 C;  2QL8 A;  4DR5 C;  3T1Y C;  2JMP A;  2F4V C;  4GKK C;  1K0R A;  2E8C A;  2E7G A;  4BSZ A;  4YY3 C;  1HH2 P;  4JI0 C;  4MH4 A;  5FLX D;  4DUZ C;  1WF3 A;  3AF6 A;  1IBK C;  4DV7 C;  2VQE C;  2BJO A;  1HR0 C;  1I94 C;  4DV2 C;  4JI4 C;  2CY1 A;  1XNR C;  3R9W A;  1N36 C;  1ML8 A;  1USP A;  1HNX C;  4DCT A;  4DV6 C;  4DR6 C;  4JV5 C;  2E5L C;  4JI1 C;  4JI6 C;  5BR8 C;  4LF6 C;  1ZB8 A;  4NXN C;  2UXC C;  2UXD C;  4DR7 C;  4LF4 C;  4B3S C;  2ATW A;  4JI7 C;  4JI2 C;  3GKU A;  1HNW C;  2CXC A;  3OTO C;  2PT7 G;  5IT9 D;  4OX9 C;  2ASB A;  3T1H C;  4DR4 C;  1XMQ C;  1HNZ C;  4DV1 C;  1JOS A;  2YCB A;  4DCU A;  4JI3 C;  1IBL C;  1PA4 A;  1XMO C;  1USP B;  2HJG A;  2VQF C;  4JI5 C;  2XR1 A;  5IWA C;  3IEV A;  2ZM6 C;  4X65 C;  3I07 A;  1EGA A;  4X66 C;  1IBM C;  2D7V A;  4K0K C;  4DCV A;  4DV3 C;  1WH9 A;  4XX2 A;  3J81 D;  2PN2 A;  2UUB C;  2EGT A;  4DUY C;  1N2F A;  1MKY A;  2UUC C;  5LMU C;  3R9X A;  2UUA C;  1QWI A;  1N32 C;  4LF9 C;  5LMN C;  4DV5 C;  2UU9 C;  1XNQ C;  4DCS A;  3CJE A;  4KHP C;  4LF8 C;  2OPL B;  4X62 C;  2HHH C;  4JYA C;  4LFC C;  4JI8 C;  3J7A D;  4NOZ A;  4YHH C;  1LQL A;  4B3R C;  4DR3 C;  4DV0 C;  1ZB9 A;  1NYE A;  4LF7 C;  2E8E A;  4DR1 C;  5A2Q D;  4AQY C;  1FJG C;  2UXB C;  1UKK A;  4B3T C;  2ONF A;  4GKJ C;  4B3M C;  4LFA C;  3JAM D; 
#chains in the Genus database with same CATH topology
 1N34 C;  2DHM A;  4G37 A;  4RM3 A;  4OXI A;  5BSR A;  1T5H X;  3A9U A;  1L2F A;  4D56 A;  4NXM C;  3LUS A;  2P2J A;  3EER A;  5K85 A;  4LFB C;  5GTD A;  3T1Y C;  2F4V C;  4GKK C;  4R1L A;  3NYQ A;  2E7G A;  5A19 A;  4JI0 C;  4MH4 A;  4DUZ C;  3AF6 A;  1IBK C;  3A9V A;  1ULT A;  4U5Y D;  2MMA B;  1XNR C;  3R9W A;  4D4I A;  2OO4 A;  2P2Q A;  4DCT A;  2Y4O A;  2JNV A;  4DR6 C;  3VNQ A;  4JV5 C;  1MXC A;  2E0G A;  3ETO A;  3A25 A;  3K6R A;  5AE1 A;  1ZB8 A;  4NXN C;  3KXW A;  2UXC C;  2OBV A;  5BST A;  4BC7 A;  4JI7 C;  3GKU A;  2CXC A;  3OTO C;  4G36 A;  2D1T A;  4RVN A;  5BSU A;  3G7S A;  1T5D X;  1RG9 A;  2PT7 G;  4I9F A;  3NYR A;  2ZZM A;  2NCL A;  1PU1 A;  4ODJ A;  2D28 C;  4I9G A;  4DCU A;  1USP B;  2HJG A;  1P4E C;  2VQF C;  2XR1 A;  3UZ0 A;  5KYT A;  3FCE A;  5IWA C;  3IEV A;  3GR0 A;  3TR3 A;  4GXR A;  4X66 C;  2P2M A;  2D7V A;  3FM7 A;  1O92 A;  3PES A;  4DCV A;  4DV3 C;  3L95 X;  1IB8 A;  3LAX A;  4L2Z A;  2PN2 A;  4PRO C;  1V25 A;  2QVY X;  2QVZ X;  4EAT A;  1NY8 A;  2UU9 C;  1AMU A;  4KHP C;  3GPC A;  1V60 A;  4NDN A;  1NYE A;  3GR1 A;  2KZF A;  4IZ6 A;  4RLF A;  3IEU A;  3UX3 A;  4BBY A;  1J5E C;  4LF5 C;  1PG3 A;  3LNO A;  3J80 D;  4G1I A;  1N33 C;  1K0R A;  3A4I A;  2E8C A;  4FUT A;  4YY3 C;  1HH2 P;  3N2Q A;  5BUR A;  5KEI A;  4DV7 C;  2BJO A;  2VQE C;  1HR0 C;  4JI4 C;  3DHV A;  2CY1 A;  5A1I A;  4OYC A;  4DV6 C;  2P2B A;  2E5L C;  4BC9 A;  4JI6 C;  3PRO C;  5BR8 C;  4LF6 C;  2KDN A;  4DR7 C;  4ZJZ A;  4LF4 C;  2BH1 X;  3NPD A;  5BSW A;  3NI2 A;  5BUQ A;  1MXA A;  5IT9 D;  4OX9 C;  2M5O A;  3T1H C;  4DR4 C;  3UX2 A;  2M5H A;  3ETC A;  4KTV A;  1UWD A;  4JI3 C;  1PG4 A;  3CQ1 A;  2KZ0 A;  4ZLP A;  2P20 A;  1BA3 A;  5BSM A;  4X65 C;  2Y27 A;  1GPM A;  1QM4 A;  1IBM C;  4K0K C;  1WH9 A;  2CU6 A;  3J81 D;  1MKY A;  1XRC A;  5LMU C;  2PRO A;  3EQ6 A;  3R9X A;  4WS9 A;  1QWI A;  1XRB A;  5LMN C;  3H2T A;  4DG9 A;  4DCS A;  3CJE A;  1FLO A;  2OPL B;  1XDX A;  1LQL A;  4B3R C;  3IML A;  5H9U A;  5AE3 A;  2D27 A;  2UXB C;  4B3T C;  3N54 B;  2ZZN A;  4GKJ C;  2P2F A;  1FUG A;  2ZTB A;  5AE2 A;  4WV3 A;  4DR2 C;  2DYJ A;  2E8F A;  4MTN A;  2OPL A;  1YJ7 A;  2QL8 A;  3TQI A;  4BSZ A;  1XS3 A;  4FTF A;  5FLX D;  1WF3 A;  3C5E A;  4GXQ A;  4DV2 C;  3R44 A;  5IFI A;  1MDB A;  3CW9 A;  5LCI A;  5K8F A;  4JI1 C;  3RV2 A;  2WP0 C;  4HPV A;  1XRA A;  2UXD C;  2D1S A;  2ATW A;  4RVO A;  2ASB A;  4K0B A;  4BCA A;  3DAY A;  5E7Q A;  4RLQ A;  1XMQ C;  3UEB A;  5JRH A;  1JOS A;  1P7L A;  2P02 A;  1MXB A;  3LGX A;  1IBL C;  5KYV A;  1XMO C;  3SO4 A;  1O93 A;  2QVX X;  4PZP A;  3I07 A;  4DG8 A;  3AY0 A;  2D1Q A;  3I08 A;  4XX2 A;  5CZV A;  4DUY C;  1N2F A;  2UUC C;  2QW0 X;  2UUA C;  1N32 C;  4LF9 C;  4DV5 C;  5A1G A;  3CQ2 A;  3B7W A;  1M6X A;  4NOZ A;  4YHH C;  4FUQ A;  3CQ3 A;  4D4G A;  4RMN A;  4LE5 A;  2YWC A;  3TUF A;  3VNS A;  1RY2 A;  4LF7 C;  4DR1 C;  1FJG C;  1UKK A;  2PG1 E;  4B3M C;  1TH5 A;  5ADZ A;  3JAM D;  1KKG A;  4DV4 C;  4X64 C;  3E7X A;  3E7W A;  3PBK A;  1VLA A;  4KTT A;  3AF5 A;  3UOW A;  4DR5 C;  2JMP A;  4R0M A;  3FCC A;  5CZX A;  2WD9 A;  5T8T A;  1I94 C;  4JM1 A;  3CW8 X;  1N36 C;  1ML8 A;  1USP A;  1HNX C;  4PUH A;  5BUS A;  3S82 A;  4L4Q A;  3VNR A;  4B3S C;  2Z51 A;  4JI2 C;  1HNW C;  1XHJ A;  2Y4N A;  3L8C A;  1P4E A;  4L7I A;  5DV9 A;  1WCJ A;  2YWB A;  1HNZ C;  1V26 A;  4DV1 C;  4IR7 A;  2YCB A;  4PUG A;  1PA4 A;  5T8S A;  4JI5 C;  1MDF A;  2MCQ A;  2VZE A;  3LNV A;  4GS5 A;  2ZM6 C;  1EGA A;  3IPL A;  2D1R A;  4ISB A;  3DLP X;  4D57 A;  2UUB C;  2EGT A;  3A26 A;  4PUI A;  1VEH A;  1XNQ C;  5BSV A;  1M6X C;  4LF8 C;  4X62 C;  2HHH C;  4JYA C;  2AYA A;  4LFC C;  4JI8 C;  3J7A D;  2YX1 A;  4DR3 C;  4PHT A;  4DV0 C;  4RM2 A;  1ZB9 A;  4R1M A;  4TPS B;  1MD9 A;  1O9T A;  2V7B A;  3TDE A;  2E8E A;  4AQY C;  5A2Q D;  1O90 A;  1YGT A;  1LCI A;  2ONF A;  3O2E A;  2MM9 A;  4LFA C;  2VSQ A;  2DPL A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 1N34 C;  4G37 A;  4RM3 A;  4OXI A;  5BSR A;  1T5H X;  3A9U A;  1L2F A;  4D56 A;  4NXM C;  3LUS A;  2P2J A;  3EER A;  5K85 A;  4LFB C;  5GTD A;  3T1Y C;  2F4V C;  4GKK C;  4R1L A;  3NYQ A;  2E7G A;  5A19 A;  4JI0 C;  4MH4 A;  4DUZ C;  3AF6 A;  1IBK C;  3A9V A;  1ULT A;  4U5Y D;  1XNR C;  3R9W A;  4D4I A;  2OO4 A;  2P2Q A;  4DCT A;  2Y4O A;  4DR6 C;  3VNQ A;  4JV5 C;  1MXC A;  2E0G A;  3ETO A;  5AE1 A;  1ZB8 A;  4NXN C;  3KXW A;  2UXC C;  2OBV A;  5BST A;  4BC7 A;  4JI7 C;  3GKU A;  2CXC A;  3OTO C;  4G36 A;  2D1T A;  4RVN A;  5BSU A;  3G7S A;  1T5D X;  1RG9 A;  2PT7 G;  4I9F A;  3NYR A;  4ODJ A;  2D28 C;  4I9G A;  4DCU A;  1USP B;  2HJG A;  2VQF C;  2XR1 A;  3UZ0 A;  5KYT A;  3FCE A;  5IWA C;  3IEV A;  3GR0 A;  4GXR A;  4X66 C;  2P2M A;  2D7V A;  1O92 A;  3PES A;  4DCV A;  4DV3 C;  3L95 X;  3LAX A;  4L2Z A;  2PN2 A;  4PRO C;  1V25 A;  2QVY X;  2QVZ X;  4EAT A;  2UU9 C;  1AMU A;  4KHP C;  3GPC A;  4NDN A;  1NYE A;  3GR1 A;  2KZF A;  4IZ6 A;  4RLF A;  3IEU A;  4BBY A;  1J5E C;  4LF5 C;  1PG3 A;  3J80 D;  4G1I A;  1N33 C;  1K0R A;  3A4I A;  2E8C A;  4FUT A;  4YY3 C;  1HH2 P;  3N2Q A;  5BUR A;  5KEI A;  4DV7 C;  2BJO A;  2VQE C;  1HR0 C;  4JI4 C;  3DHV A;  2CY1 A;  5A1I A;  4OYC A;  4DV6 C;  2P2B A;  2E5L C;  4BC9 A;  4JI6 C;  3PRO C;  5BR8 C;  4LF6 C;  4DR7 C;  4ZJZ A;  4LF4 C;  2BH1 X;  3NPD A;  5BSW A;  3NI2 A;  5BUQ A;  1MXA A;  5IT9 D;  4OX9 C;  3T1H C;  4DR4 C;  3ETC A;  4KTV A;  4JI3 C;  1PG4 A;  4ZLP A;  2P20 A;  1BA3 A;  5BSM A;  4X65 C;  2Y27 A;  1GPM A;  1QM4 A;  1IBM C;  4K0K C;  1WH9 A;  3J81 D;  1MKY A;  1XRC A;  5LMU C;  2PRO A;  3EQ6 A;  3R9X A;  4WS9 A;  1QWI A;  1XRB A;  5LMN C;  3H2T A;  4DG9 A;  4DCS A;  3CJE A;  2OPL B;  1LQL A;  4B3R C;  3IML A;  5H9U A;  5AE3 A;  2D27 A;  2UXB C;  4B3T C;  3N54 B;  4GKJ C;  2P2F A;  1FUG A;  5AE2 A;  4WV3 A;  4DR2 C;  2DYJ A;  2E8F A;  4MTN A;  2OPL A;  1YJ7 A;  2QL8 A;  3TQI A;  4BSZ A;  4FTF A;  5FLX D;  1WF3 A;  3C5E A;  4GXQ A;  4DV2 C;  3R44 A;  5IFI A;  1MDB A;  3CW9 A;  5K8F A;  4JI1 C;  3RV2 A;  2WP0 C;  4HPV A;  1XRA A;  2UXD C;  2D1S A;  2ATW A;  4RVO A;  2ASB A;  4K0B A;  4BCA A;  3DAY A;  5E7Q A;  4RLQ A;  1XMQ C;  5JRH A;  1JOS A;  1P7L A;  2P02 A;  1MXB A;  3LGX A;  1IBL C;  5KYV A;  1XMO C;  3SO4 A;  1O93 A;  2QVX X;  4PZP A;  3I07 A;  3I08 A;  2D1Q A;  4DG8 A;  4XX2 A;  5CZV A;  4DUY C;  1N2F A;  2UUC C;  2QW0 X;  2UUA C;  1N32 C;  4LF9 C;  4DV5 C;  5A1G A;  3B7W A;  4NOZ A;  4YHH C;  4FUQ A;  4D4G A;  4RMN A;  4LE5 A;  2YWC A;  3TUF A;  3VNS A;  1RY2 A;  4LF7 C;  4DR1 C;  1FJG C;  1UKK A;  4B3M C;  5ADZ A;  3JAM D;  1KKG A;  4DV4 C;  4X64 C;  3E7X A;  3E7W A;  3PBK A;  1VLA A;  4KTT A;  3AF5 A;  3UOW A;  4DR5 C;  2JMP A;  4R0M A;  3FCC A;  5CZX A;  2WD9 A;  5T8T A;  1I94 C;  4JM1 A;  3CW8 X;  1N36 C;  1ML8 A;  1USP A;  1HNX C;  5BUS A;  3S82 A;  4L4Q A;  3VNR A;  4B3S C;  4JI2 C;  1HNW C;  2Y4N A;  3L8C A;  4L7I A;  5DV9 A;  2YWB A;  1HNZ C;  1V26 A;  4DV1 C;  4IR7 A;  2YCB A;  1PA4 A;  5T8S A;  4JI5 C;  1MDF A;  2VZE A;  3LNV A;  4GS5 A;  2ZM6 C;  1EGA A;  3IPL A;  2D1R A;  4ISB A;  3DLP X;  4D57 A;  2UUB C;  2EGT A;  1XNQ C;  5BSV A;  4LF8 C;  4X62 C;  2HHH C;  4JYA C;  2AYA A;  4LFC C;  4JI8 C;  3J7A D;  4DR3 C;  4PHT A;  4DV0 C;  4RM2 A;  1ZB9 A;  4R1M A;  4TPS B;  1MD9 A;  1O9T A;  2V7B A;  3TDE A;  2E8E A;  4AQY C;  5A2Q D;  1O90 A;  1LCI A;  2ONF A;  4LFA C;  2VSQ A;  2DPL A;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...