4GKJC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkjC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkjC02
4DV5C 1USPB 2UXDC 2ATWA 1N32C 4DV1C 4JI0C 4DR4C 2HJGA 4LFAC 2CXCA 1ML8A 3I07A 1HNXC 1XNQC 2UXCC 3J81D 4DR3C 2YCBA 1J5EC 4DCVA 3IEVA 1WH9A 1N34C 4B3MC 4AQYC 4GKJC 1NYEA 5LMNC 1XMQC 3JAMD 1LQLA 1XMOC 4JI3C 3AF6A 4LF6C 3J7AD 4DR2C 4DR1C 4KHPC 4YHHC 1HH2P 4JI8C 4K0KC 4JI2C 4DCSA 4NOZA 5IT9D 1PA4A 4LF4C 1XNRC 1UKKA 2UUAC 1L2FA 4B3SC 4X62C 4DCUA 4XX2A 5A2QD 4DUYC 4JI7C 4JI4C 4DV0C 2ONFA 2PT7G 3CJEA 4B3RC 4DV6C 1VLAA 4GKKC 1IBMC 2E8CA 2UXBC 4MTNA 2UU9C 2OPLA 1FJGC 4X64C 4DR7C 1K0RA 2UUBC 4YY3C 4DV7C 3T1YC 2UUCC 1EGAA 3OTOC 2CY1A 5IWAC 1IBKC 4LFBC 1USPA 2QL8A 4B3TC 2HHHC 2DYJA 2E8FA 5LMUC 3R9WA 2BJOA 2D7VA 1QWIA 2XR1A 2EGTA 3EERA 2E7GA 4JI5C 1WF3A 1JOSA 1I94C 3J80D 4DCTA 3R9XA 4JV5C 4JI1C 2ZM6C 3T1HC 2JMPA 4BSZA 1HR0C 2PN2A 4LF9C 1KKGA 4MH4A 4OX9C 4DUZC 1IBLC 3AF5A 1N2FA 4LFCC 2VQFC 3IEUA 5BR8C 3GKUA 4DR5C 4DV4C 5FLXD 4X65C 3LUSA 1ZB8A 4JI6C 4LF7C 1N36C 1N33C 4LF5C 2E5LC 2ASBA 4X66C 1HNZC 4LF8C 4DV2C 4NXMC 1HNWC 2KZFA 2OPLB 4DV3C 2E8EA 2F4VC 4NXNC 4DR6C 1ZB9A 4JYAC 2VQEC 1MKYA
chains in the Genus database with same CATH superfamily
3UX2A 2P2BA 2HJGA 3RG2A 4PZPA 2P2JA 5ADZA 1P7LA 4DR3C 4AQYC 3E7XA 1XMQC 1O9TA 2PROA 3AF6A 1T5DX 4DR1C 4KHPC 3NPDA 4DCSA 4RVNA 2VZEA 2QVXX 1XNRC 4BBYA 2AYAA 3CW8X 2UUAC 4B3SC 3L8CA 3TDEA 4XX2A 4JI7C 1M6XA 4DV0C 5BSVA 2VSQA 4PROC 3C5EA 4FTFA 4G37A 5CZXA 2JNVA 1K0RA 2UUBC 3VNSA 1MXAA 3IMLA 2CU6A 1USPA 1WCJA 2QL8A 1RG9A 2E8FA 3R9WA 2BJOA 1T5HX 3EERA 2MCQA 2P20A 1XDXA 2KDNA 4DCTA 2M5OA 2D27A 1XRBA 5K8FA 2ZM6C 4BSZA 2Y4NA 5BSMA 1UWDA 2WP0C 3PROC 2Y4OA 4DR5C 5BUSA 4JI6C 2E5LC 2D1TA 3O2EA 2QVZX 3A25A 2QW0X 4X66C 1XS3A 3R44A 2YX1A 3NI2A 5T8TA 1ULTA 1YJ7A 2KZFA 2ZZNA 2BH1X 4JYAC 4ISBA 3UEBA 1MKYA 1USPB 2UXDC 1N32C 1V25A 2Z51A 3CW9A 4I9GA 4JI0C 4DR4C 2V7BA 2E0GA 1XNQC 3GR0A 4PUGA 4RLQA 4WS9A 2WD9A 2YCBA 4DCVA 4DG9A 1J5EC 3IEVA 5BSRA 4GKJC 5LMNC 4R1MA 4JI3C 1MXBA 3J7AD 3SO4A 3CQ3A 3A26A 3DLPX 5A19A 2QVYX 1PG4A 2DHMA 5A2QD 3LAXA 5KYVA 3G7SA 5GTDA 1PG3A 2ONFA 3CJEA 4DV6C 4GKKC 5T8SA 1IBMC 4DG8A 1MD9A 4MTNA 5AE2A 2UU9C 1V60A 4X64C 4DR7C 1EGAA 3OTOC 2CY1A 5IWAC 5AE1A 4LFBC 4KTVA 2OO4A 2DYJA 4FUTA 5LMUC 2D7VA 1BA3A 1FLOA 4U5YD 2EGTA 1WF3A 3AY0A 5KYTA 1AMUA 3N2QA 3PESA 4JV5C 2JMPA 4G36A 4GS5A 2Y27A 3A4IA 4ZJZA 4LF9C 3CQ2A 4TPSB 1P4EA 4BC9A 1N2FA 4JM1A 4WV3A 4LF7C 2ZTBA 2ASBA 4PUHA 3DHVA 5K85A 2MMAB 4D56A 2OBVA 4DR6C 3PBKA 1MDFA 1XHJA 1M6XC 2PG1E 3TQIA 2DPLA 4RLFA 3K6RA 1XRCA 5BURA 3I07A 1XRAA 1HNXC 4PHTA 3GPCA 2D1QA 3J81D 1N34C 1NY8A 1O92A 3RV2A 1P4EC 1NYEA 1TH5A 1LQLA 1XMOC 3CQ1A 4LF6C 2KZ0A 4DR2C 4YHHC 4K0KC 4NOZA 4RM2A 3TR3A 1PA4A 4LF4C 1UKKA 3IPLA 1L2FA 2P2FA 3A9VA 4R0MA 3ETCA 4RVOA 2PT7G 4B3RC 3FCCA 3VNRA 4LE5A 1RY2A 2OPLA 2P2MA 3N54B 3T1YC 2UUCC 3ETOA 4ZLPA 4L7IA 1IBKC 3UX3A 1VEHA 2HHHC 2ZZMA 2YWCA 4RM3A 5E7QA 4JI5C 1LCIA 1JOSA 1I94C 2D28C 2MM9A 3KXWA 4IZ6A 3A9UA 5AE3A 3J80D 3R9XA 4JI1C 1IB8A 3T1HC 1MXCA 4D4IA 3LNVA 4OX9C 4DUZC 1IBLC 4LFCC 2VQFC 5BR8C 4KTTA 2M5HA 4K0BA 3S82A 2YWBA 4DV2C 4NXMC 1HNWC 4BC7A 2OPLB 2F4VC 5BSUA 1ZB9A 5BUQA 2P02A 4L2ZA 2VQEC 5DV9A 4DV3C 4DV5C 2ATWA 3FM7A 4DV1C 3NYQA 3EQ6A 3TUFA 4LFAC 2CXCA 1ML8A 2UXCC 1O90A 5A1GA 1V26A 1WH9A 4B3MC 4R1LA 3JAMD 1HH2P 4G1IA 4JI8C 4JI2C 5IT9D 1QM4A 4GXRA 4X62C 3H2TA 1O93A 4DCUA 5H9UA 4DUYC 3NYRA 4HPVA 5BSTA 4JI4C 4NDNA 2D1SA 5IFIA 3I08A 2P2QA 1YGTA 1VLAA 2E8CA 2UXBC 5BSWA 2NCLA 1FJGC 1PU1A 4YY3C 4DV7C 4RMNA 4D57A 4L4QA 5CZVA 4B3TC 4OYCA 4FUQA 1FUGA 2XR1A 1QWIA 3DAYA 3L95X 4IR7A 2E7GA 4D4GA 3LGXA 4ODJA 3FCEA 4PUIA 1GPMA 3LNOA 1HR0C 2PN2A 3B7WA 4EATA 4BCAA 1KKGA 4MH4A 5LCIA 3AF5A 3VNQA 3UOWA 3IEUA 3GKUA 4DV4C 3E7WA 5FLXD 4X65C 3LUSA 1ZB8A 1N36C 1N33C 4LF5C 5KEIA 5A1IA 2D1RA 1HNZC 4LF8C 1MDBA 5JRHA 3GR1A 2E8EA 4NXNC 4OXIA 3UZ0A 4GXQA 4I9FA
chains in the Genus database with same CATH topology
2P2BA 2HJGA 3RG2A 4PZPA 2P2JA 5ADZA 1P7LA 4DR3C 4AQYC 3E7XA 1XMQC 1O9TA 2PROA 3AF6A 1T5DX 4DR1C 4KHPC 3NPDA 4DCSA 4RVNA 2VZEA 2QVXX 1XNRC 4BBYA 2AYAA 3CW8X 2UUAC 4B3SC 3L8CA 3TDEA 4XX2A 4JI7C 4DV0C 5BSVA 2VSQA 4PROC 3C5EA 4FTFA 4G37A 5CZXA 1K0RA 2UUBC 3VNSA 1MXAA 3IMLA 1USPA 2QL8A 1RG9A 2E8FA 3R9WA 2BJOA 1T5HX 3EERA 2P20A 4DCTA 2D27A 1XRBA 5K8FA 2ZM6C 4BSZA 2Y4NA 5BSMA 2WP0C 3PROC 2Y4OA 4DR5C 5BUSA 4JI6C 2E5LC 2D1TA 2QVZX 2QW0X 4X66C 3R44A 3NI2A 5T8TA 1ULTA 1YJ7A 2KZFA 2BH1X 4JYAC 4ISBA 1MKYA 1USPB 2UXDC 1N32C 1V25A 3CW9A 4I9GA 4JI0C 4DR4C 2V7BA 2E0GA 1XNQC 3GR0A 4RLQA 4WS9A 2WD9A 2YCBA 4DCVA 4DG9A 1J5EC 3IEVA 5BSRA 4GKJC 5LMNC 4R1MA 4JI3C 1MXBA 3J7AD 3SO4A 3DLPX 5A19A 2QVYX 1PG4A 5A2QD 3LAXA 5KYVA 3G7SA 5GTDA 1PG3A 2ONFA 3CJEA 4DV6C 4GKKC 5T8SA 1IBMC 4DG8A 1MD9A 4MTNA 5AE2A 2UU9C 4X64C 4DR7C 1EGAA 3OTOC 2CY1A 5IWAC 5AE1A 4LFBC 4KTVA 2OO4A 2DYJA 4FUTA 5LMUC 2D7VA 1BA3A 4U5YD 2EGTA 1WF3A 5KYTA 1AMUA 3N2QA 3PESA 4JV5C 2JMPA 4G36A 4GS5A 2Y27A 3A4IA 4ZJZA 4LF9C 4TPSB 4BC9A 1N2FA 4JM1A 4WV3A 4LF7C 2ASBA 3DHVA 5K85A 4D56A 2OBVA 4DR6C 3PBKA 1MDFA 3TQIA 2DPLA 4RLFA 1XRCA 5BURA 3I07A 1XRAA 1HNXC 4PHTA 3GPCA 2D1QA 3J81D 1N34C 1O92A 3RV2A 1NYEA 1LQLA 1XMOC 4LF6C 4DR2C 4YHHC 4K0KC 4NOZA 4RM2A 1PA4A 4LF4C 1UKKA 3IPLA 1L2FA 2P2FA 3A9VA 4R0MA 3ETCA 4RVOA 2PT7G 4B3RC 3FCCA 3VNRA 4LE5A 1RY2A 2OPLA 2P2MA 3N54B 3T1YC 2UUCC 3ETOA 4ZLPA 4L7IA 1IBKC 2HHHC 2YWCA 4RM3A 5E7QA 4JI5C 1LCIA 1JOSA 1I94C 2D28C 3J80D 3KXWA 4IZ6A 3A9UA 5AE3A 3R9XA 4JI1C 3T1HC 1MXCA 4D4IA 3LNVA 4OX9C 4DUZC 1IBLC 4LFCC 2VQFC 5BR8C 4KTTA 4K0BA 3S82A 2YWBA 4DV2C 4NXMC 1HNWC 4BC7A 2OPLB 2F4VC 5BSUA 1ZB9A 5BUQA 2P02A 4L2ZA 4DV3C 5DV9A 2VQEC 4DV5C 2ATWA 4DV1C 3NYQA 3EQ6A 3TUFA 4LFAC 2CXCA 1ML8A 2UXCC 1O90A 5A1GA 1V26A 1WH9A 4B3MC 4R1LA 3JAMD 1HH2P 4G1IA 4JI8C 4JI2C 5IT9D 1QM4A 4GXRA 4X62C 3H2TA 1O93A 4DCUA 5H9UA 4DUYC 3NYRA 4HPVA 5BSTA 4JI4C 4NDNA 2D1SA 5IFIA 3I08A 2P2QA 1VLAA 2E8CA 2UXBC 5BSWA 1FJGC 4YY3C 4DV7C 4RMNA 4D57A 4L4QA 5CZVA 4B3TC 4OYCA 4FUQA 1FUGA 2XR1A 1QWIA 3DAYA 3L95X 4IR7A 2E7GA 4D4GA 3LGXA 4ODJA 3FCEA 1GPMA 1HR0C 2PN2A 3B7WA 4EATA 4BCAA 1KKGA 4MH4A 3AF5A 3VNQA 3UOWA 3IEUA 3GKUA 4DV4C 3E7WA 5FLXD 4X65C 3LUSA 1ZB8A 1N36C 1N33C 4LF5C 5KEIA 5A1IA 2D1RA 1HNZC 4LF8C 1MDBA 5JRHA 3GR1A 2E8EA 4NXNC 4OXIA 3UZ0A 4GXQA 4I9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 C;  1USP B;  2UXD C;  2ATW A;  1N32 C;  4DV1 C;  4JI0 C;  4DR4 C;  2HJG A;  4LFA C;  2CXC A;  1ML8 A;  3I07 A;  1HNX C;  1XNQ C;  2UXC C;  3J81 D;  4DR3 C;  2YCB A;  1J5E C;  4DCV A;  3IEV A;  1WH9 A;  1N34 C;  4B3M C;  4AQY C;  4GKJ C;  1NYE A;  5LMN C;  1XMQ C;  3JAM D;  1LQL A;  1XMO C;  4JI3 C;  3AF6 A;  4LF6 C;  3J7A D;  4DR2 C;  4DR1 C;  4KHP C;  4YHH C;  1HH2 P;  4JI8 C;  4K0K C;  4JI2 C;  4DCS A;  4NOZ A;  5IT9 D;  1PA4 A;  4LF4 C;  1XNR C;  1UKK A;  2UUA C;  1L2F A;  4B3S C;  4X62 C;  4DCU A;  4XX2 A;  5A2Q D;  4DUY C;  4JI7 C;  4JI4 C;  4DV0 C;  2ONF A;  2PT7 G;  3CJE A;  4B3R C;  4DV6 C;  1VLA A;  4GKK C;  1IBM C;  2E8C A;  2UXB C;  4MTN A;  2UU9 C;  2OPL A;  1FJG C;  4X64 C;  4DR7 C;  1K0R A;  2UUB C;  4YY3 C;  4DV7 C;  3T1Y C;  2UUC C;  1EGA A;  3OTO C;  2CY1 A;  5IWA C;  1IBK C;  4LFB C;  1USP A;  2QL8 A;  4B3T C;  2HHH C;  2DYJ A;  2E8F A;  5LMU C;  3R9W A;  2BJO A;  2D7V A;  1QWI A;  2XR1 A;  2EGT A;  3EER A;  2E7G A;  4JI5 C;  1WF3 A;  1JOS A;  1I94 C;  3J80 D;  4DCT A;  3R9X A;  4JV5 C;  4JI1 C;  2ZM6 C;  3T1H C;  2JMP A;  4BSZ A;  1HR0 C;  2PN2 A;  4LF9 C;  1KKG A;  4MH4 A;  4OX9 C;  4DUZ C;  1IBL C;  3AF5 A;  1N2F A;  4LFC C;  2VQF C;  3IEU A;  5BR8 C;  3GKU A;  4DR5 C;  4DV4 C;  5FLX D;  4X65 C;  3LUS A;  1ZB8 A;  4JI6 C;  4LF7 C;  1N36 C;  1N33 C;  4LF5 C;  2E5L C;  2ASB A;  4X66 C;  1HNZ C;  4LF8 C;  4DV2 C;  4NXM C;  1HNW C;  2KZF A;  2OPL B;  4DV3 C;  2E8E A;  2F4V C;  4NXN C;  4DR6 C;  1ZB9 A;  4JYA C;  2VQE C;  1MKY A; 
#chains in the Genus database with same CATH topology
 3UX2 A;  2P2B A;  2HJG A;  3RG2 A;  4PZP A;  2P2J A;  5ADZ A;  1P7L A;  4DR3 C;  4AQY C;  3E7X A;  1XMQ C;  1O9T A;  2PRO A;  3AF6 A;  1T5D X;  4DR1 C;  4KHP C;  3NPD A;  4DCS A;  4RVN A;  2VZE A;  2QVX X;  1XNR C;  4BBY A;  2AYA A;  3CW8 X;  2UUA C;  4B3S C;  3L8C A;  3TDE A;  4XX2 A;  4JI7 C;  1M6X A;  4DV0 C;  5BSV A;  2VSQ A;  4PRO C;  3C5E A;  4FTF A;  4G37 A;  5CZX A;  2JNV A;  1K0R A;  2UUB C;  3VNS A;  1MXA A;  3IML A;  2CU6 A;  1USP A;  1WCJ A;  2QL8 A;  1RG9 A;  2E8F A;  3R9W A;  2BJO A;  1T5H X;  3EER A;  2MCQ A;  2P20 A;  1XDX A;  2KDN A;  4DCT A;  2M5O A;  2D27 A;  1XRB A;  5K8F A;  2ZM6 C;  4BSZ A;  2Y4N A;  5BSM A;  1UWD A;  2WP0 C;  3PRO C;  2Y4O A;  4DR5 C;  5BUS A;  4JI6 C;  2E5L C;  2D1T A;  3O2E A;  2QVZ X;  3A25 A;  2QW0 X;  4X66 C;  1XS3 A;  3R44 A;  2YX1 A;  3NI2 A;  5T8T A;  1ULT A;  1YJ7 A;  2KZF A;  2ZZN A;  2BH1 X;  4JYA C;  4ISB A;  3UEB A;  1MKY A;  1USP B;  2UXD C;  1N32 C;  1V25 A;  2Z51 A;  3CW9 A;  4I9G A;  4JI0 C;  4DR4 C;  2V7B A;  2E0G A;  1XNQ C;  3GR0 A;  4PUG A;  4RLQ A;  4WS9 A;  2WD9 A;  2YCB A;  4DCV A;  4DG9 A;  1J5E C;  3IEV A;  5BSR A;  4GKJ C;  5LMN C;  4R1M A;  4JI3 C;  1MXB A;  3J7A D;  3SO4 A;  3CQ3 A;  3A26 A;  3DLP X;  5A19 A;  2QVY X;  1PG4 A;  2DHM A;  5A2Q D;  3LAX A;  5KYV A;  3G7S A;  5GTD A;  1PG3 A;  2ONF A;  3CJE A;  4DV6 C;  4GKK C;  5T8S A;  1IBM C;  4DG8 A;  1MD9 A;  4MTN A;  5AE2 A;  2UU9 C;  1V60 A;  4X64 C;  4DR7 C;  1EGA A;  3OTO C;  2CY1 A;  5IWA C;  5AE1 A;  4LFB C;  4KTV A;  2OO4 A;  2DYJ A;  4FUT A;  5LMU C;  2D7V A;  1BA3 A;  1FLO A;  4U5Y D;  2EGT A;  1WF3 A;  3AY0 A;  5KYT A;  1AMU A;  3N2Q A;  3PES A;  4JV5 C;  2JMP A;  4G36 A;  4GS5 A;  2Y27 A;  3A4I A;  4ZJZ A;  4LF9 C;  3CQ2 A;  4TPS B;  1P4E A;  4BC9 A;  1N2F A;  4JM1 A;  4WV3 A;  4LF7 C;  2ZTB A;  2ASB A;  4PUH A;  3DHV A;  5K85 A;  2MMA B;  4D56 A;  2OBV A;  4DR6 C;  3PBK A;  1MDF A;  1XHJ A;  1M6X C;  2PG1 E;  3TQI A;  2DPL A;  4RLF A;  3K6R A;  1XRC A;  5BUR A;  3I07 A;  1XRA A;  1HNX C;  4PHT A;  3GPC A;  2D1Q A;  3J81 D;  1N34 C;  1NY8 A;  1O92 A;  3RV2 A;  1P4E C;  1NYE A;  1TH5 A;  1LQL A;  1XMO C;  3CQ1 A;  4LF6 C;  2KZ0 A;  4DR2 C;  4YHH C;  4K0K C;  4NOZ A;  4RM2 A;  3TR3 A;  1PA4 A;  4LF4 C;  1UKK A;  3IPL A;  1L2F A;  2P2F A;  3A9V A;  4R0M A;  3ETC A;  4RVO A;  2PT7 G;  4B3R C;  3FCC A;  3VNR A;  4LE5 A;  1RY2 A;  2OPL A;  2P2M A;  3N54 B;  3T1Y C;  2UUC C;  3ETO A;  4ZLP A;  4L7I A;  1IBK C;  3UX3 A;  1VEH A;  2HHH C;  2ZZM A;  2YWC A;  4RM3 A;  5E7Q A;  4JI5 C;  1LCI A;  1JOS A;  1I94 C;  2D28 C;  2MM9 A;  3KXW A;  4IZ6 A;  3A9U A;  5AE3 A;  3J80 D;  3R9X A;  4JI1 C;  1IB8 A;  3T1H C;  1MXC A;  4D4I A;  3LNV A;  4OX9 C;  4DUZ C;  1IBL C;  4LFC C;  2VQF C;  5BR8 C;  4KTT A;  2M5H A;  4K0B A;  3S82 A;  2YWB A;  4DV2 C;  4NXM C;  1HNW C;  4BC7 A;  2OPL B;  2F4V C;  5BSU A;  1ZB9 A;  5BUQ A;  2P02 A;  4L2Z A;  2VQE C;  5DV9 A;  4DV3 C;  4DV5 C;  2ATW A;  3FM7 A;  4DV1 C;  3NYQ A;  3EQ6 A;  3TUF A;  4LFA C;  2CXC A;  1ML8 A;  2UXC C;  1O90 A;  5A1G A;  1V26 A;  1WH9 A;  4B3M C;  4R1L A;  3JAM D;  1HH2 P;  4G1I A;  4JI8 C;  4JI2 C;  5IT9 D;  1QM4 A;  4GXR A;  4X62 C;  3H2T A;  1O93 A;  4DCU A;  5H9U A;  4DUY C;  3NYR A;  4HPV A;  5BST A;  4JI4 C;  4NDN A;  2D1S A;  5IFI A;  3I08 A;  2P2Q A;  1YGT A;  1VLA A;  2E8C A;  2UXB C;  5BSW A;  2NCL A;  1FJG C;  1PU1 A;  4YY3 C;  4DV7 C;  4RMN A;  4D57 A;  4L4Q A;  5CZV A;  4B3T C;  4OYC A;  4FUQ A;  1FUG A;  2XR1 A;  1QWI A;  3DAY A;  3L95 X;  4IR7 A;  2E7G A;  4D4G A;  3LGX A;  4ODJ A;  3FCE A;  4PUI A;  1GPM A;  3LNO A;  1HR0 C;  2PN2 A;  3B7W A;  4EAT A;  4BCA A;  1KKG A;  4MH4 A;  5LCI A;  3AF5 A;  3VNQ A;  3UOW A;  3IEU A;  3GKU A;  4DV4 C;  3E7W A;  5FLX D;  4X65 C;  3LUS A;  1ZB8 A;  1N36 C;  1N33 C;  4LF5 C;  5KEI A;  5A1I A;  2D1R A;  1HNZ C;  4LF8 C;  1MDB A;  5JRH A;  3GR1 A;  2E8E A;  4NXN C;  4OXI A;  3UZ0 A;  4GXQ A;  4I9F A; 
#chains in the Genus database with same CATH homology
 2P2B A;  2HJG A;  3RG2 A;  4PZP A;  2P2J A;  5ADZ A;  1P7L A;  4DR3 C;  4AQY C;  3E7X A;  1XMQ C;  1O9T A;  2PRO A;  3AF6 A;  1T5D X;  4DR1 C;  4KHP C;  3NPD A;  4DCS A;  4RVN A;  2VZE A;  2QVX X;  1XNR C;  4BBY A;  2AYA A;  3CW8 X;  2UUA C;  4B3S C;  3L8C A;  3TDE A;  4XX2 A;  4JI7 C;  4DV0 C;  5BSV A;  2VSQ A;  4PRO C;  3C5E A;  4FTF A;  4G37 A;  5CZX A;  1K0R A;  2UUB C;  3VNS A;  1MXA A;  3IML A;  1USP A;  2QL8 A;  1RG9 A;  2E8F A;  3R9W A;  2BJO A;  1T5H X;  3EER A;  2P20 A;  4DCT A;  2D27 A;  1XRB A;  5K8F A;  2ZM6 C;  4BSZ A;  2Y4N A;  5BSM A;  2WP0 C;  3PRO C;  2Y4O A;  4DR5 C;  5BUS A;  4JI6 C;  2E5L C;  2D1T A;  2QVZ X;  2QW0 X;  4X66 C;  3R44 A;  3NI2 A;  5T8T A;  1ULT A;  1YJ7 A;  2KZF A;  2BH1 X;  4JYA C;  4ISB A;  1MKY A;  1USP B;  2UXD C;  1N32 C;  1V25 A;  3CW9 A;  4I9G A;  4JI0 C;  4DR4 C;  2V7B A;  2E0G A;  1XNQ C;  3GR0 A;  4RLQ A;  4WS9 A;  2WD9 A;  2YCB A;  4DCV A;  4DG9 A;  1J5E C;  3IEV A;  5BSR A;  4GKJ C;  5LMN C;  4R1M A;  4JI3 C;  1MXB A;  3J7A D;  3SO4 A;  3DLP X;  5A19 A;  2QVY X;  1PG4 A;  5A2Q D;  3LAX A;  5KYV A;  3G7S A;  5GTD A;  1PG3 A;  2ONF A;  3CJE A;  4DV6 C;  4GKK C;  5T8S A;  1IBM C;  4DG8 A;  1MD9 A;  4MTN A;  5AE2 A;  2UU9 C;  4X64 C;  4DR7 C;  1EGA A;  3OTO C;  2CY1 A;  5IWA C;  5AE1 A;  4LFB C;  4KTV A;  2OO4 A;  2DYJ A;  4FUT A;  5LMU C;  2D7V A;  1BA3 A;  4U5Y D;  2EGT A;  1WF3 A;  5KYT A;  1AMU A;  3N2Q A;  3PES A;  4JV5 C;  2JMP A;  4G36 A;  4GS5 A;  2Y27 A;  3A4I A;  4ZJZ A;  4LF9 C;  4TPS B;  4BC9 A;  1N2F A;  4JM1 A;  4WV3 A;  4LF7 C;  2ASB A;  3DHV A;  5K85 A;  4D56 A;  2OBV A;  4DR6 C;  3PBK A;  1MDF A;  3TQI A;  2DPL A;  4RLF A;  1XRC A;  5BUR A;  3I07 A;  1XRA A;  1HNX C;  4PHT A;  3GPC A;  2D1Q A;  3J81 D;  1N34 C;  1O92 A;  3RV2 A;  1NYE A;  1LQL A;  1XMO C;  4LF6 C;  4DR2 C;  4YHH C;  4K0K C;  4NOZ A;  4RM2 A;  1PA4 A;  4LF4 C;  1UKK A;  3IPL A;  1L2F A;  2P2F A;  3A9V A;  4R0M A;  3ETC A;  4RVO A;  2PT7 G;  4B3R C;  3FCC A;  3VNR A;  4LE5 A;  1RY2 A;  2OPL A;  2P2M A;  3N54 B;  3T1Y C;  2UUC C;  3ETO A;  4ZLP A;  4L7I A;  1IBK C;  2HHH C;  2YWC A;  4RM3 A;  5E7Q A;  4JI5 C;  1LCI A;  1JOS A;  1I94 C;  2D28 C;  3J80 D;  3KXW A;  4IZ6 A;  3A9U A;  5AE3 A;  3R9X A;  4JI1 C;  3T1H C;  1MXC A;  4D4I A;  3LNV A;  4OX9 C;  4DUZ C;  1IBL C;  4LFC C;  2VQF C;  5BR8 C;  4KTT A;  4K0B A;  3S82 A;  2YWB A;  4DV2 C;  4NXM C;  1HNW C;  4BC7 A;  2OPL B;  2F4V C;  5BSU A;  1ZB9 A;  5BUQ A;  2P02 A;  4L2Z A;  4DV3 C;  5DV9 A;  2VQE C;  4DV5 C;  2ATW A;  4DV1 C;  3NYQ A;  3EQ6 A;  3TUF A;  4LFA C;  2CXC A;  1ML8 A;  2UXC C;  1O90 A;  5A1G A;  1V26 A;  1WH9 A;  4B3M C;  4R1L A;  3JAM D;  1HH2 P;  4G1I A;  4JI8 C;  4JI2 C;  5IT9 D;  1QM4 A;  4GXR A;  4X62 C;  3H2T A;  1O93 A;  4DCU A;  5H9U A;  4DUY C;  3NYR A;  4HPV A;  5BST A;  4JI4 C;  4NDN A;  2D1S A;  5IFI A;  3I08 A;  2P2Q A;  1VLA A;  2E8C A;  2UXB C;  5BSW A;  1FJG C;  4YY3 C;  4DV7 C;  4RMN A;  4D57 A;  4L4Q A;  5CZV A;  4B3T C;  4OYC A;  4FUQ A;  1FUG A;  2XR1 A;  1QWI A;  3DAY A;  3L95 X;  4IR7 A;  2E7G A;  4D4G A;  3LGX A;  4ODJ A;  3FCE A;  1GPM A;  1HR0 C;  2PN2 A;  3B7W A;  4EAT A;  4BCA A;  1KKG A;  4MH4 A;  3AF5 A;  3VNQ A;  3UOW A;  3IEU A;  3GKU A;  4DV4 C;  3E7W A;  5FLX D;  4X65 C;  3LUS A;  1ZB8 A;  1N36 C;  1N33 C;  4LF5 C;  5KEI A;  5A1I A;  2D1R A;  1HNZ C;  4LF8 C;  1MDB A;  5JRH A;  3GR1 A;  2E8E A;  4NXN C;  4OXI A;  3UZ0 A;  4GXQ A;  4I9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...