4GKJC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkjC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkjC02
2BJOA 5LMNC 2OPLB 1FJGC 2DYJA 2ONFA 3R9XA 1N34C 3J7AD 4LF7C 4YHHC 2UXDC 1XMQC 4B3MC 1IBMC 2UXCC 3AF5A 4B3SC 3I07A 1L2FA 4LFBC 3EERA 4X65C 1ZB8A 4DR6C 1LQLA 1N33C 1N32C 4DR1C 2UUCC 3J80D 4JI8C 1ML8A 4DCTA 2ZM6C 1HNXC 1WH9A 1ZB9A 2E8EA 4DCSA 1HNZC 4DR5C 1VLAA 4DR2C 3OTOC 4GKJC 3IEVA 1EGAA 5BR8C 1HR0C 4DR7C 2UXBC 1USPB 4JI6C 1J5EC 1PA4A 4DCVA 4DV3C 3T1HC 4JYAC 5IT9D 3IEUA 1XNQC 4B3RC 4K0KC 4DUZC 1XNRC 4NXMC 4DV5C 1IBLC 4JI1C 4YY3C 2D7VA 4XX2A 4AQYC 4OX9C 4X64C 4JI0C 2UU9C 4JI5C 5A2QD 2UUAC 4LF8C 1KKGA 4JI3C 4DV2C 4X62C 3T1YC 2JMPA 3GKUA 4DUYC 4JI2C 2HHHC 2UUBC 1MKYA 2YCBA 2ASBA 4LFCC 4DCUA 4LF9C 2E8FA 4JI7C 3J81D 2F4VC 4DV4C 2VQFC 1UKKA 2CXCA 2E5LC 2E7GA 5FLXD 2EGTA 4BSZA 3CJEA 4JV5C 4MH4A 2VQEC 2CY1A 4LF6C 3JAMD 1N36C 2KZFA 1NYEA 1HNWC 2PT7G 4KHPC 4DV6C 4X66C 4DR4C 4NOZA 1K0RA 1QWIA 2OPLA 4LFAC 4GKKC 1JOSA 2PN2A 4LF4C 2HJGA 2ATWA 1I94C 2E8CA 4B3TC 3R9WA 1WF3A 4DV1C 1USPA 2XR1A 1HH2P 1IBKC 5LMUC 4MTNA 4JI4C 4DV0C 2QL8A 4NXNC 3AF6A 4DV7C 1N2FA 4LF5C 4DR3C 5IWAC 1XMOC 3LUSA
chains in the Genus database with same CATH superfamily
2BJOA 4FTFA 2OPLB 1FJGC 2ONFA 4GXQA 3J7AD 1AMUA 2PROA 2V7BA 3GR0A 3ETCA 4LFBC 3EERA 4L7IA 5BSTA 4X65C 1LQLA 1N32C 3EQ6A 4BCAA 1FUGA 4JI8C 1WH9A 1ZB9A 3GPCA 5AE2A 1MXCA 2E8EA 4DCSA 3L8CA 4ZJZA 2CU6A 3OTOC 4ZLPA 5BR8C 5IFIA 4DCVA 4D4GA 2NCLA 2VZEA 4PROC 2MCQA 2M5OA 2WD9A 2P2QA 3O2EA 4JI5C 4PUIA 1P7LA 1XRAA 4DV2C 4X62C 2JMPA 2E0GA 3NI2A 4GS5A 1MKYA 3E7WA 1M6XA 2OBVA 2E8FA 2F4VC 5BUSA 4DV4C 1XHJA 5H9UA 2E7GA 5K8FA 2MM9A 3DHVA 3VNRA 3H2TA 3CJEA 2Y4NA 4PHTA 4LE5A 4FUQA 2CY1A 1V26A 4FUTA 1YGTA 3JAMD 1N36C 1T5DX 1O92A 4WS9A 1K0RA 4LFAC 4BC7A 1IB8A 4B3TC 1IBKC 4JI4C 4DV0C 2QL8A 4LF5C 4DR3C 4D56A 4JI2C 3GR1A 4L2ZA 2DYJA 3R9XA 1N34C 5BSVA 4K0BA 1MD9A 4B3MC 3AF5A 5GTDA 3N2QA 1ZB8A 2P20A 4IZ6A 3DLPX 2D1TA 2ZM6C 1HNXC 3TQIA 1WCJA 1VLAA 2P2JA 2ZZMA 3LNVA 2VSQA 1T5HX 1MXAA 1O93A 3IEVA 1HR0C 1UWDA 2UXBC 3N54B 3T1HC 4ISBA 4D57A 5ADZA 1XNQC 1P4EC 4B3RC 4K0KC 5CZVA 1V25A 3I08A 4NXMC 4JI1C 4RVNA 3CW8X 3TUFA 2UU9C 1XRCA 3FCEA 5E7QA 3LAXA 1MDFA 4JI3C 4RLQA 3T1YC 5BSUA 2HHHC 4I9GA 4HPVA 3J81D 3TR3A 3A9UA 4R1LA 3UEBA 4BSZA 1XS3A 4JV5C 3G7SA 3C5EA 2KZFA 1NYEA 4KTTA 1HNWC 4DR4C 2OPLA 4GKKC 5BUQA 1JOSA 2HJGA 5A19A 3R9WA 3NYRA 1HH2P 4BBYA 3AF6A 2Y4OA 2M5HA 1XMOC 4PUHA 3LUSA 1BA3A 5LMNC 3A26A 4G36A 5LCIA 4LF7C 3UX3A 2KZ0A 2UXDC 1XMQC 1V60A 2Z51A 3DAYA 3RG2A 3E7XA 2UXCC 4B3SC 3I07A 1L2FA 1N33C 3A4IA 3ETOA 4DR1C 3J80D 1ML8A 4DCTA 4DR5C 2D1RA 2PG1E 2MMAB 4NDNA 4RM2A 4GKJC 4G1IA 1EGAA 4I9FA 4RLFA 4DR7C 4GXRA 4ODJA 1USPB 4JI6C 1J5EC 5IT9D 3IEUA 4BC9A 2KDNA 4DUZC 2D28C 1IBLC 4YY3C 2D7VA 4XX2A 1TH5A 3LGXA 3UZ0A 3CW9A 4AQYC 4OX9C 4KTVA 2DPLA 3CQ1A 5A2QD 4RMNA 4WV3A 1RG9A 1KKGA 3PROC 1MDBA 3PESA 2JNVA 1FLOA 4DUYC 2P2MA 4G37A 2UUBC 2DHMA 5KYTA 1PU1A 4L4QA 4DCUA 3VNQA 4JI7C 5T8SA 3RV2A 4PZPA 1UKKA 5FLXD 2D27A 1YJ7A 5CZXA 3TDEA 1O9TA 5JRHA 3S82A 1QM4A 2QVZX 2PT7G 4KHPC 2BH1X 4NOZA 5T8TA 1QWIA 3FM7A 2OO4A 4LF4C 2ATWA 1P4EA 2P2BA 1USPA 4OYCA 2XR1A 2P02A 5LMUC 4D4IA 2YX1A 5AE3A 5A1GA 5IWAC 3GKUA 3CQ3A 3LNOA 1GPMA 1ULTA 4IR7A 5DV9A 5AE1A 1RY2A 4U5YD 3R44A 3AY0A 4YHHC 1VEHA 5BSRA 4R0MA 2QVYX 1IBMC 1M6XC 2WP0C 4DR6C 2QW0X 4RVOA 2UUCC 5A1IA 3A9VA 3PBKA 2AYAA 2YWBA 3CQ2A 1HNZC 2ZTBA 4DG8A 3UOWA 4DR2C 2ZZNA 3NPDA 5K85A 1O90A 1PA4A 4DV3C 4JYAC 3IPLA 1LCIA 4EATA 2P2FA 3KXWA 1XNRC 5KEIA 4DV5C 4PUGA 4JM1A 3FCCA 4X64C 4JI0C 2UUAC 4LF8C 3K6RA 2D1QA 3UX2A 5BSWA 3B7WA 1XDXA 2YCBA 3IMLA 1PG3A 2ASBA 4LFCC 4LF9C 2VQFC 4TPSB 2CXCA 2E5LC 3NYQA 2EGTA 3L95X 4OXIA 5BURA 4MH4A 1NY8A 2VQEC 4LF6C 2Y27A 3VNSA 1XRBA 4DV6C 4X66C 3SO4A 4R1MA 1MXBA 2PN2A 5BSMA 2YWCA 1I94C 2E8CA 2QVXX 1WF3A 3A25A 4DV1C 4DG9A 4MTNA 4NXNC 1PG4A 4RM3A 4DV7C 1N2FA 2D1SA 5KYVA
chains in the Genus database with same CATH topology
2BJOA 4FTFA 2OPLB 1FJGC 2ONFA 4GXQA 3J7AD 1AMUA 2PROA 2V7BA 3GR0A 3ETCA 4LFBC 3EERA 4L7IA 5BSTA 4X65C 1LQLA 1N32C 3EQ6A 4BCAA 1FUGA 4JI8C 1WH9A 1ZB9A 3GPCA 5AE2A 1MXCA 2E8EA 4DCSA 3L8CA 4ZJZA 3OTOC 4ZLPA 5BR8C 5IFIA 4DCVA 4D4GA 2VZEA 4PROC 2WD9A 2P2QA 4JI5C 1P7LA 1XRAA 4DV2C 4X62C 2JMPA 2E0GA 3NI2A 4GS5A 1MKYA 3E7WA 2OBVA 2E8FA 2F4VC 5BUSA 4DV4C 5H9UA 2E7GA 5K8FA 3DHVA 3VNRA 3H2TA 3CJEA 2Y4NA 4PHTA 4LE5A 4FUQA 2CY1A 1V26A 4FUTA 3JAMD 1N36C 1T5DX 1O92A 4WS9A 1K0RA 4LFAC 4BC7A 4B3TC 1IBKC 4JI4C 4DV0C 2QL8A 4LF5C 4DR3C 4D56A 4JI2C 3GR1A 4L2ZA 2DYJA 3R9XA 1N34C 5BSVA 4K0BA 1MD9A 4B3MC 3AF5A 5GTDA 3N2QA 1ZB8A 2P20A 4IZ6A 3DLPX 2D1TA 2ZM6C 1HNXC 3TQIA 1VLAA 2P2JA 3LNVA 2VSQA 1T5HX 1MXAA 1O93A 3IEVA 1HR0C 2UXBC 3N54B 3T1HC 4ISBA 4D57A 5ADZA 1XNQC 4B3RC 4K0KC 5CZVA 1V25A 3I08A 4NXMC 4JI1C 4RVNA 3CW8X 3TUFA 2UU9C 1XRCA 3FCEA 5E7QA 3LAXA 1MDFA 4JI3C 4RLQA 3T1YC 5BSUA 2HHHC 4I9GA 4HPVA 3J81D 3A9UA 4R1LA 4BSZA 4JV5C 3G7SA 3C5EA 2KZFA 1NYEA 4KTTA 1HNWC 4DR4C 2OPLA 4GKKC 5BUQA 1JOSA 2HJGA 5A19A 3R9WA 3NYRA 1HH2P 4BBYA 3AF6A 2Y4OA 1XMOC 3LUSA 1BA3A 5LMNC 4G36A 4LF7C 2UXDC 1XMQC 3DAYA 3RG2A 3E7XA 2UXCC 4B3SC 3I07A 1L2FA 1N33C 3A4IA 3ETOA 4DR1C 3J80D 1ML8A 4DCTA 4DR5C 2D1RA 4NDNA 4RM2A 4GKJC 4G1IA 1EGAA 4I9FA 4RLFA 4DR7C 4GXRA 4ODJA 1USPB 4JI6C 1J5EC 5IT9D 3IEUA 4BC9A 4DUZC 2D28C 1IBLC 4YY3C 2D7VA 4XX2A 3LGXA 3UZ0A 3CW9A 4AQYC 4OX9C 4KTVA 2DPLA 5A2QD 4RMNA 4WV3A 1RG9A 1KKGA 3PROC 1MDBA 3PESA 4DUYC 2P2MA 4G37A 2UUBC 5KYTA 4L4QA 4DCUA 3VNQA 4JI7C 5T8SA 3RV2A 4PZPA 1UKKA 5FLXD 2D27A 1YJ7A 5CZXA 3TDEA 1O9TA 5JRHA 3S82A 1QM4A 2QVZX 2PT7G 4KHPC 2BH1X 4NOZA 5T8TA 1QWIA 2OO4A 4LF4C 2ATWA 2P2BA 1USPA 4OYCA 2XR1A 2P02A 5LMUC 4D4IA 5AE3A 5A1GA 5IWAC 3GKUA 1GPMA 1ULTA 4IR7A 5DV9A 5AE1A 1RY2A 4U5YD 3R44A 4YHHC 5BSRA 4R0MA 2QVYX 1IBMC 2WP0C 4DR6C 2QW0X 4RVOA 2UUCC 5A1IA 3A9VA 3PBKA 2AYAA 2YWBA 1HNZC 4DG8A 3UOWA 4DR2C 3NPDA 5K85A 1O90A 1PA4A 4DV3C 4JYAC 3IPLA 1LCIA 4EATA 2P2FA 3KXWA 1XNRC 5KEIA 4DV5C 4JM1A 3FCCA 4X64C 4JI0C 2UUAC 4LF8C 2D1QA 5BSWA 3B7WA 2YCBA 3IMLA 1PG3A 2ASBA 4LFCC 4LF9C 2VQFC 4TPSB 2CXCA 2E5LC 3NYQA 2EGTA 3L95X 4OXIA 5BURA 4MH4A 2VQEC 4LF6C 2Y27A 3VNSA 1XRBA 4DV6C 4X66C 3SO4A 4R1MA 1MXBA 2PN2A 5BSMA 2YWCA 1I94C 2E8CA 2QVXX 1WF3A 4DV1C 4DG9A 4MTNA 4NXNC 1PG4A 4RM3A 4DV7C 1N2FA 2D1SA 5KYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJO A;  5LMN C;  2OPL B;  1FJG C;  2DYJ A;  2ONF A;  3R9X A;  1N34 C;  3J7A D;  4LF7 C;  4YHH C;  2UXD C;  1XMQ C;  4B3M C;  1IBM C;  2UXC C;  3AF5 A;  4B3S C;  3I07 A;  1L2F A;  4LFB C;  3EER A;  4X65 C;  1ZB8 A;  4DR6 C;  1LQL A;  1N33 C;  1N32 C;  4DR1 C;  2UUC C;  3J80 D;  4JI8 C;  1ML8 A;  4DCT A;  2ZM6 C;  1HNX C;  1WH9 A;  1ZB9 A;  2E8E A;  4DCS A;  1HNZ C;  4DR5 C;  1VLA A;  4DR2 C;  3OTO C;  4GKJ C;  3IEV A;  1EGA A;  5BR8 C;  1HR0 C;  4DR7 C;  2UXB C;  1USP B;  4JI6 C;  1J5E C;  1PA4 A;  4DCV A;  4DV3 C;  3T1H C;  4JYA C;  5IT9 D;  3IEU A;  1XNQ C;  4B3R C;  4K0K C;  4DUZ C;  1XNR C;  4NXM C;  4DV5 C;  1IBL C;  4JI1 C;  4YY3 C;  2D7V A;  4XX2 A;  4AQY C;  4OX9 C;  4X64 C;  4JI0 C;  2UU9 C;  4JI5 C;  5A2Q D;  2UUA C;  4LF8 C;  1KKG A;  4JI3 C;  4DV2 C;  4X62 C;  3T1Y C;  2JMP A;  3GKU A;  4DUY C;  4JI2 C;  2HHH C;  2UUB C;  1MKY A;  2YCB A;  2ASB A;  4LFC C;  4DCU A;  4LF9 C;  2E8F A;  4JI7 C;  3J81 D;  2F4V C;  4DV4 C;  2VQF C;  1UKK A;  2CXC A;  2E5L C;  2E7G A;  5FLX D;  2EGT A;  4BSZ A;  3CJE A;  4JV5 C;  4MH4 A;  2VQE C;  2CY1 A;  4LF6 C;  3JAM D;  1N36 C;  2KZF A;  1NYE A;  1HNW C;  2PT7 G;  4KHP C;  4DV6 C;  4X66 C;  4DR4 C;  4NOZ A;  1K0R A;  1QWI A;  2OPL A;  4LFA C;  4GKK C;  1JOS A;  2PN2 A;  4LF4 C;  2HJG A;  2ATW A;  1I94 C;  2E8C A;  4B3T C;  3R9W A;  1WF3 A;  4DV1 C;  1USP A;  2XR1 A;  1HH2 P;  1IBK C;  5LMU C;  4MTN A;  4JI4 C;  4DV0 C;  2QL8 A;  4NXN C;  3AF6 A;  4DV7 C;  1N2F A;  4LF5 C;  4DR3 C;  5IWA C;  1XMO C;  3LUS A; 
#chains in the Genus database with same CATH topology
 2BJO A;  4FTF A;  2OPL B;  1FJG C;  2ONF A;  4GXQ A;  3J7A D;  1AMU A;  2PRO A;  2V7B A;  3GR0 A;  3ETC A;  4LFB C;  3EER A;  4L7I A;  5BST A;  4X65 C;  1LQL A;  1N32 C;  3EQ6 A;  4BCA A;  1FUG A;  4JI8 C;  1WH9 A;  1ZB9 A;  3GPC A;  5AE2 A;  1MXC A;  2E8E A;  4DCS A;  3L8C A;  4ZJZ A;  2CU6 A;  3OTO C;  4ZLP A;  5BR8 C;  5IFI A;  4DCV A;  4D4G A;  2NCL A;  2VZE A;  4PRO C;  2MCQ A;  2M5O A;  2WD9 A;  2P2Q A;  3O2E A;  4JI5 C;  4PUI A;  1P7L A;  1XRA A;  4DV2 C;  4X62 C;  2JMP A;  2E0G A;  3NI2 A;  4GS5 A;  1MKY A;  3E7W A;  1M6X A;  2OBV A;  2E8F A;  2F4V C;  5BUS A;  4DV4 C;  1XHJ A;  5H9U A;  2E7G A;  5K8F A;  2MM9 A;  3DHV A;  3VNR A;  3H2T A;  3CJE A;  2Y4N A;  4PHT A;  4LE5 A;  4FUQ A;  2CY1 A;  1V26 A;  4FUT A;  1YGT A;  3JAM D;  1N36 C;  1T5D X;  1O92 A;  4WS9 A;  1K0R A;  4LFA C;  4BC7 A;  1IB8 A;  4B3T C;  1IBK C;  4JI4 C;  4DV0 C;  2QL8 A;  4LF5 C;  4DR3 C;  4D56 A;  4JI2 C;  3GR1 A;  4L2Z A;  2DYJ A;  3R9X A;  1N34 C;  5BSV A;  4K0B A;  1MD9 A;  4B3M C;  3AF5 A;  5GTD A;  3N2Q A;  1ZB8 A;  2P20 A;  4IZ6 A;  3DLP X;  2D1T A;  2ZM6 C;  1HNX C;  3TQI A;  1WCJ A;  1VLA A;  2P2J A;  2ZZM A;  3LNV A;  2VSQ A;  1T5H X;  1MXA A;  1O93 A;  3IEV A;  1HR0 C;  1UWD A;  2UXB C;  3N54 B;  3T1H C;  4ISB A;  4D57 A;  5ADZ A;  1XNQ C;  1P4E C;  4B3R C;  4K0K C;  5CZV A;  1V25 A;  3I08 A;  4NXM C;  4JI1 C;  4RVN A;  3CW8 X;  3TUF A;  2UU9 C;  1XRC A;  3FCE A;  5E7Q A;  3LAX A;  1MDF A;  4JI3 C;  4RLQ A;  3T1Y C;  5BSU A;  2HHH C;  4I9G A;  4HPV A;  3J81 D;  3TR3 A;  3A9U A;  4R1L A;  3UEB A;  4BSZ A;  1XS3 A;  4JV5 C;  3G7S A;  3C5E A;  2KZF A;  1NYE A;  4KTT A;  1HNW C;  4DR4 C;  2OPL A;  4GKK C;  5BUQ A;  1JOS A;  2HJG A;  5A19 A;  3R9W A;  3NYR A;  1HH2 P;  4BBY A;  3AF6 A;  2Y4O A;  2M5H A;  1XMO C;  4PUH A;  3LUS A;  1BA3 A;  5LMN C;  3A26 A;  4G36 A;  5LCI A;  4LF7 C;  3UX3 A;  2KZ0 A;  2UXD C;  1XMQ C;  1V60 A;  2Z51 A;  3DAY A;  3RG2 A;  3E7X A;  2UXC C;  4B3S C;  3I07 A;  1L2F A;  1N33 C;  3A4I A;  3ETO A;  4DR1 C;  3J80 D;  1ML8 A;  4DCT A;  4DR5 C;  2D1R A;  2PG1 E;  2MMA B;  4NDN A;  4RM2 A;  4GKJ C;  4G1I A;  1EGA A;  4I9F A;  4RLF A;  4DR7 C;  4GXR A;  4ODJ A;  1USP B;  4JI6 C;  1J5E C;  5IT9 D;  3IEU A;  4BC9 A;  2KDN A;  4DUZ C;  2D28 C;  1IBL C;  4YY3 C;  2D7V A;  4XX2 A;  1TH5 A;  3LGX A;  3UZ0 A;  3CW9 A;  4AQY C;  4OX9 C;  4KTV A;  2DPL A;  3CQ1 A;  5A2Q D;  4RMN A;  4WV3 A;  1RG9 A;  1KKG A;  3PRO C;  1MDB A;  3PES A;  2JNV A;  1FLO A;  4DUY C;  2P2M A;  4G37 A;  2UUB C;  2DHM A;  5KYT A;  1PU1 A;  4L4Q A;  4DCU A;  3VNQ A;  4JI7 C;  5T8S A;  3RV2 A;  4PZP A;  1UKK A;  5FLX D;  2D27 A;  1YJ7 A;  5CZX A;  3TDE A;  1O9T A;  5JRH A;  3S82 A;  1QM4 A;  2QVZ X;  2PT7 G;  4KHP C;  2BH1 X;  4NOZ A;  5T8T A;  1QWI A;  3FM7 A;  2OO4 A;  4LF4 C;  2ATW A;  1P4E A;  2P2B A;  1USP A;  4OYC A;  2XR1 A;  2P02 A;  5LMU C;  4D4I A;  2YX1 A;  5AE3 A;  5A1G A;  5IWA C;  3GKU A;  3CQ3 A;  3LNO A;  1GPM A;  1ULT A;  4IR7 A;  5DV9 A;  5AE1 A;  1RY2 A;  4U5Y D;  3R44 A;  3AY0 A;  4YHH C;  1VEH A;  5BSR A;  4R0M A;  2QVY X;  1IBM C;  1M6X C;  2WP0 C;  4DR6 C;  2QW0 X;  4RVO A;  2UUC C;  5A1I A;  3A9V A;  3PBK A;  2AYA A;  2YWB A;  3CQ2 A;  1HNZ C;  2ZTB A;  4DG8 A;  3UOW A;  4DR2 C;  2ZZN A;  3NPD A;  5K85 A;  1O90 A;  1PA4 A;  4DV3 C;  4JYA C;  3IPL A;  1LCI A;  4EAT A;  2P2F A;  3KXW A;  1XNR C;  5KEI A;  4DV5 C;  4PUG A;  4JM1 A;  3FCC A;  4X64 C;  4JI0 C;  2UUA C;  4LF8 C;  3K6R A;  2D1Q A;  3UX2 A;  5BSW A;  3B7W A;  1XDX A;  2YCB A;  3IML A;  1PG3 A;  2ASB A;  4LFC C;  4LF9 C;  2VQF C;  4TPS B;  2CXC A;  2E5L C;  3NYQ A;  2EGT A;  3L95 X;  4OXI A;  5BUR A;  4MH4 A;  1NY8 A;  2VQE C;  4LF6 C;  2Y27 A;  3VNS A;  1XRB A;  4DV6 C;  4X66 C;  3SO4 A;  4R1M A;  1MXB A;  2PN2 A;  5BSM A;  2YWC A;  1I94 C;  2E8C A;  2QVX X;  1WF3 A;  3A25 A;  4DV1 C;  4DG9 A;  4MTN A;  4NXN C;  1PG4 A;  4RM3 A;  4DV7 C;  1N2F A;  2D1S A;  5KYV A; 
#chains in the Genus database with same CATH homology
 2BJO A;  4FTF A;  2OPL B;  1FJG C;  2ONF A;  4GXQ A;  3J7A D;  1AMU A;  2PRO A;  2V7B A;  3GR0 A;  3ETC A;  4LFB C;  3EER A;  4L7I A;  5BST A;  4X65 C;  1LQL A;  1N32 C;  3EQ6 A;  4BCA A;  1FUG A;  4JI8 C;  1WH9 A;  1ZB9 A;  3GPC A;  5AE2 A;  1MXC A;  2E8E A;  4DCS A;  3L8C A;  4ZJZ A;  3OTO C;  4ZLP A;  5BR8 C;  5IFI A;  4DCV A;  4D4G A;  2VZE A;  4PRO C;  2WD9 A;  2P2Q A;  4JI5 C;  1P7L A;  1XRA A;  4DV2 C;  4X62 C;  2JMP A;  2E0G A;  3NI2 A;  4GS5 A;  1MKY A;  3E7W A;  2OBV A;  2E8F A;  2F4V C;  5BUS A;  4DV4 C;  5H9U A;  2E7G A;  5K8F A;  3DHV A;  3VNR A;  3H2T A;  3CJE A;  2Y4N A;  4PHT A;  4LE5 A;  4FUQ A;  2CY1 A;  1V26 A;  4FUT A;  3JAM D;  1N36 C;  1T5D X;  1O92 A;  4WS9 A;  1K0R A;  4LFA C;  4BC7 A;  4B3T C;  1IBK C;  4JI4 C;  4DV0 C;  2QL8 A;  4LF5 C;  4DR3 C;  4D56 A;  4JI2 C;  3GR1 A;  4L2Z A;  2DYJ A;  3R9X A;  1N34 C;  5BSV A;  4K0B A;  1MD9 A;  4B3M C;  3AF5 A;  5GTD A;  3N2Q A;  1ZB8 A;  2P20 A;  4IZ6 A;  3DLP X;  2D1T A;  2ZM6 C;  1HNX C;  3TQI A;  1VLA A;  2P2J A;  3LNV A;  2VSQ A;  1T5H X;  1MXA A;  1O93 A;  3IEV A;  1HR0 C;  2UXB C;  3N54 B;  3T1H C;  4ISB A;  4D57 A;  5ADZ A;  1XNQ C;  4B3R C;  4K0K C;  5CZV A;  1V25 A;  3I08 A;  4NXM C;  4JI1 C;  4RVN A;  3CW8 X;  3TUF A;  2UU9 C;  1XRC A;  3FCE A;  5E7Q A;  3LAX A;  1MDF A;  4JI3 C;  4RLQ A;  3T1Y C;  5BSU A;  2HHH C;  4I9G A;  4HPV A;  3J81 D;  3A9U A;  4R1L A;  4BSZ A;  4JV5 C;  3G7S A;  3C5E A;  2KZF A;  1NYE A;  4KTT A;  1HNW C;  4DR4 C;  2OPL A;  4GKK C;  5BUQ A;  1JOS A;  2HJG A;  5A19 A;  3R9W A;  3NYR A;  1HH2 P;  4BBY A;  3AF6 A;  2Y4O A;  1XMO C;  3LUS A;  1BA3 A;  5LMN C;  4G36 A;  4LF7 C;  2UXD C;  1XMQ C;  3DAY A;  3RG2 A;  3E7X A;  2UXC C;  4B3S C;  3I07 A;  1L2F A;  1N33 C;  3A4I A;  3ETO A;  4DR1 C;  3J80 D;  1ML8 A;  4DCT A;  4DR5 C;  2D1R A;  4NDN A;  4RM2 A;  4GKJ C;  4G1I A;  1EGA A;  4I9F A;  4RLF A;  4DR7 C;  4GXR A;  4ODJ A;  1USP B;  4JI6 C;  1J5E C;  5IT9 D;  3IEU A;  4BC9 A;  4DUZ C;  2D28 C;  1IBL C;  4YY3 C;  2D7V A;  4XX2 A;  3LGX A;  3UZ0 A;  3CW9 A;  4AQY C;  4OX9 C;  4KTV A;  2DPL A;  5A2Q D;  4RMN A;  4WV3 A;  1RG9 A;  1KKG A;  3PRO C;  1MDB A;  3PES A;  4DUY C;  2P2M A;  4G37 A;  2UUB C;  5KYT A;  4L4Q A;  4DCU A;  3VNQ A;  4JI7 C;  5T8S A;  3RV2 A;  4PZP A;  1UKK A;  5FLX D;  2D27 A;  1YJ7 A;  5CZX A;  3TDE A;  1O9T A;  5JRH A;  3S82 A;  1QM4 A;  2QVZ X;  2PT7 G;  4KHP C;  2BH1 X;  4NOZ A;  5T8T A;  1QWI A;  2OO4 A;  4LF4 C;  2ATW A;  2P2B A;  1USP A;  4OYC A;  2XR1 A;  2P02 A;  5LMU C;  4D4I A;  5AE3 A;  5A1G A;  5IWA C;  3GKU A;  1GPM A;  1ULT A;  4IR7 A;  5DV9 A;  5AE1 A;  1RY2 A;  4U5Y D;  3R44 A;  4YHH C;  5BSR A;  4R0M A;  2QVY X;  1IBM C;  2WP0 C;  4DR6 C;  2QW0 X;  4RVO A;  2UUC C;  5A1I A;  3A9V A;  3PBK A;  2AYA A;  2YWB A;  1HNZ C;  4DG8 A;  3UOW A;  4DR2 C;  3NPD A;  5K85 A;  1O90 A;  1PA4 A;  4DV3 C;  4JYA C;  3IPL A;  1LCI A;  4EAT A;  2P2F A;  3KXW A;  1XNR C;  5KEI A;  4DV5 C;  4JM1 A;  3FCC A;  4X64 C;  4JI0 C;  2UUA C;  4LF8 C;  2D1Q A;  5BSW A;  3B7W A;  2YCB A;  3IML A;  1PG3 A;  2ASB A;  4LFC C;  4LF9 C;  2VQF C;  4TPS B;  2CXC A;  2E5L C;  3NYQ A;  2EGT A;  3L95 X;  4OXI A;  5BUR A;  4MH4 A;  2VQE C;  4LF6 C;  2Y27 A;  3VNS A;  1XRB A;  4DV6 C;  4X66 C;  3SO4 A;  4R1M A;  1MXB A;  2PN2 A;  5BSM A;  2YWC A;  1I94 C;  2E8C A;  2QVX X;  1WF3 A;  4DV1 C;  4DG9 A;  4MTN A;  4NXN C;  1PG4 A;  4RM3 A;  4DV7 C;  1N2F A;  2D1S A;  5KYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...