4GKJC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkjC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkjC02
4JI3C 4LF9C 4LF5C 1USPA 3R9XA 2CY1A 3JAMD 3J7AD 1FJGC 1HNZC 2ASBA 4DCTA 3CJEA 3OTOC 1N2FA 1PA4A 4X64C 4MTNA 2UU9C 4NXNC 1K0RA 5FLXD 2UUAC 5LMUC 4DV6C 2OPLB 1N36C 4XX2A 4JI4C 2E8EA 2ONFA 2UXBC 4DR6C 1N33C 2PT7G 1VLAA 4DCUA 1WF3A 4DV5C 4B3SC 4DCSA 1XNQC 4B3TC 3T1YC 4JI2C 3AF5A 2UUBC 2E8CA 4B3MC 4X62C 1J5EC 4LF8C 1LQLA 4JI5C 1ML8A 4GKKC 2D7VA 4NXMC 4YY3C 4JI8C 4OX9C 4K0KC 4DCVA 4DUZC 1XNRC 4JYAC 4JI6C 1JOSA 3T1HC 4GKJC 3LUSA 3AF6A 2HHHC 1USPB 4NOZA 4LF7C 1QWIA 4LFCC 1ZB9A 4AQYC 5IWAC 4DR1C 4MH4A 2UXDC 1XMOC 4LF6C 1IBMC 4JI1C 3R9WA 5IT9D 4KHPC 2E5LC 4LFBC 1HNWC 1N32C 5LMNC 4B3RC 4X66C 2CXCA 4DV2C 5A2QD 1IBKC 1UKKA 4DV7C 3IEUA 1I94C 2EGTA 4DV4C 2QL8A 1IBLC 1ZB8A 2OPLA 4DR5C 1HH2P 1MKYA 1WH9A 1HNXC 4DR4C 2BJOA 3EERA 4JI7C 3J81D 2YCBA 4DR3C 4JI0C 4YHHC 3I07A 2E7GA 2DYJA 2JMPA 1L2FA 4LF4C 2UXCC 4DV1C 2ATWA 3GKUA 4DUYC 2KZFA 4DR7C 1HR0C 4DV3C 1XMQC 2ZM6C 2XR1A 4DV0C 2UUCC 4BSZA 3J80D 2PN2A 1KKGA 4LFAC 2F4VC 4JV5C 1N34C 4DR2C 3IEVA 1NYEA 2VQFC 1EGAA 4X65C 2VQEC 2HJGA 5BR8C 2E8FA
chains in the Genus database with same CATH superfamily
1BA3A 4OYCA 4PUHA 4LF5C 3R9XA 4RM3A 3TQIA 3PROC 4BCAA 4DV6C 2P2QA 2WD9A 4R1MA 1MD9A 5A1IA 4RM2A 4DV5C 4B3SC 1XNQC 4B3TC 3AF5A 4R1LA 2PROA 1RY2A 1NY8A 1XRCA 1ML8A 2ZZNA 3R44A 1P4EC 4GKKC 3DAYA 4DCVA 4G36A 4EATA 3L95X 3E7XA 4LE5A 4JI6C 4DG9A 2MMAB 3NI2A 1QWIA 4LF7C 1ZB9A 3N2QA 4DR1C 4MH4A 4LF6C 4FUQA 5IT9D 1HNWC 2CXCA 5AE2A 5T8SA 1P7LA 3LGXA 3IEUA 5BURA 2KDNA 1T5HX 2QW0X 2D1TA 3LNOA 3TUFA 2OPLA 3CQ2A 4DR4C 3EERA 3G7SA 3J81D 3A9VA 3FM7A 3I07A 2E7GA 5AE1A 2UXCC 1MXAA 2ATWA 4PUIA 5K85A 2QVZX 1HR0C 2XR1A 4L2ZA 2ZZMA 3IEVA 3CW8X 3FCEA 4DG8A 3A25A 2HJGA 3IMLA 3UOWA 4JI3C 1YGTA 1M6XA 2VSQA 1FLOA 5AE3A 4R0MA 3JAMD 3J7AD 4TPSB 3NPDA 4RLQA 4RVNA 3OTOC 1PA4A 1V60A 4MTNA 5H9UA 2MM9A 1PU1A 5A19A 3CQ1A 1PG4A 2ONFA 3EQ6A 3UZ0A 3E7WA 4PZPA 3L8CA 4BC7A 1MDFA 5ADZA 3GR1A 3ETCA 1O92A 1XRAA 2UUBC 4B3MC 1J5EC 4FUTA 1LQLA 4JI5C 2P2MA 2P2JA 2D7VA 1XNRC 4BC9A 1JOSA 4GKJC 3AF6A 4LFCC 1XMOC 4WS9A 1IBMC 3R9WA 4KHPC 1MDBA 2D1SA 1N32C 5LMNC 1UKKA 5GTDA 5BUQA 4DV4C 3CQ3A 1O9TA 3NYQA 4DR5C 1IB8A 1HH2P 1WH9A 2YWCA 1PG3A 5DV9A 2P2FA 2ZTBA 2M5OA 2P20A 3TR3A 2OO4A 2Y4OA 4DV1C 3GKUA 2KZFA 4DR7C 4DV3C 4PUGA 2ZM6C 4KTTA 3NYRA 4I9GA 5KYVA 4JV5C 1N34C 4DR2C 1P4EA 3DLPX 4U5YD 1N33C 2D1RA 1USPA 1RG9A 2BH1X 1AMUA 1HNZC 5BSVA 4GXQA 1N2FA 5BSUA 4X64C 1WCJA 4G37A 2UU9C 1XDXA 3KXWA 4NXNC 4ODJA 2OPLB 1N36C 2Z51A 4XX2A 3VNRA 4JI4C 3UX2A 4GS5A 1T5DX 2UXBC 2JNVA 1VLAA 1GPMA 1WF3A 4DCSA 4G1IA 1MXCA 4NDNA 2E8CA 4D4IA 3AY0A 5E7QA 2D27A 2P02A 4DUZC 5T8TA 4JYAC 2NCLA 5KYTA 2WP0C 2YWBA 3DHVA 2UXDC 4BBYA 1XHJA 1QM4A 4JI1C 4LFBC 4FTFA 4B3RC 4X66C 1LCIA 4DV7C 2PG1E 1MXBA 4IZ6A 1I94C 2EGTA 3UEBA 3A26A 3VNSA 2VQEC 3C5EA 4ZJZA 4ZLPA 1MKYA 2BJOA 5JRHA 4JI7C 5CZVA 3GPCA 3CW9A 2JMPA 1L2FA 3LNVA 3PBKA 4WV3A 2VZEA 3RG2A 4JM1A 3RV2A 3LAXA 3SO4A 4OXIA 3VNQA 1O93A 3J80D 2PN2A 4LFAC 2F4VC 4D56A 4RVOA 1UWDA 2VQFC 1EGAA 2P2BA 4DV0C 1V26A 5BR8C 2E8FA 4LF9C 2CY1A 2E0GA 1FJGC 2ASBA 5K8FA 4DCTA 4RLFA 3CJEA 2MCQA 3A4IA 1ULTA 4RMNA 2YX1A 2KZ0A 4I9FA 1K0RA 5FLXD 2UUAC 5LMUC 3FCCA 2E8EA 1VEHA 4DR6C 3B7WA 3K6RA 2PT7G 5BUSA 4KTVA 4DCUA 5IFIA 3T1YC 4JI2C 2AYAA 1V25A 4X62C 3H2TA 4ISBA 2V7BA 4LF8C 3UX3A 3A9UA 5LCIA 4NXMC 4YY3C 4JI8C 4OX9C 4K0KC 2DHMA 1M6XC 3T1HC 3LUSA 2HHHC 3S82A 2CU6A 1USPB 3IPLA 4IR7A 4NOZA 4AQYC 1TH5A 4GXRA 5IWAC 1YJ7A 2Y4NA 1XRBA 2E5LC 2QVXX 5BSRA 4DV2C 5A2QD 1XS3A 1IBKC 4PROC 3O2EA 4L4QA 4D4GA 2OBVA 2D1QA 5A1GA 2QL8A 1IBLC 1ZB8A 4D57A 1FUGA 1HNXC 3N54B 3GR0A 4L7IA 2D28C 2YCBA 4K0BA 4DR3C 4JI0C 4YHHC 2DYJA 3PESA 5BSMA 3TDEA 4LF4C 1O90A 5BSTA 5BSWA 5CZXA 4HPVA 4DUYC 1XMQC 2Y27A 2DPLA 2UUCC 4BSZA 3I08A 1KKGA 3ETOA 5KEIA 4PHTA 2M5HA 1NYEA 4X65C 2QVYX
chains in the Genus database with same CATH topology
1BA3A 4OYCA 4LF5C 3R9XA 4RM3A 3TQIA 3PROC 4BCAA 4DV6C 2P2QA 2WD9A 4R1MA 1MD9A 5A1IA 4RM2A 4DV5C 4B3SC 1XNQC 4B3TC 3AF5A 4R1LA 2PROA 1RY2A 1XRCA 1ML8A 3R44A 4GKKC 3DAYA 4DCVA 4G36A 4EATA 3L95X 3E7XA 4LE5A 4JI6C 4DG9A 3NI2A 1QWIA 4LF7C 1ZB9A 3N2QA 4DR1C 4MH4A 4LF6C 4FUQA 5IT9D 1HNWC 2CXCA 5AE2A 5T8SA 1P7LA 3LGXA 3IEUA 5BURA 1T5HX 2QW0X 2D1TA 3TUFA 2OPLA 4DR4C 3EERA 3G7SA 3J81D 3A9VA 3I07A 2E7GA 5AE1A 2QVYX 2UXCC 1MXAA 2ATWA 5K85A 2QVZX 1HR0C 2XR1A 4L2ZA 3IEVA 3CW8X 3FCEA 4DG8A 2HJGA 3IMLA 3UOWA 4JI3C 2VSQA 5AE3A 4R0MA 3JAMD 3J7AD 4TPSB 3NPDA 4RLQA 4RVNA 3OTOC 1PA4A 4MTNA 5H9UA 5A19A 1PG4A 2ONFA 3EQ6A 3UZ0A 3E7WA 4PZPA 3L8CA 4BC7A 1MDFA 5ADZA 3GR1A 3ETCA 1O92A 1XRAA 2UUBC 4B3MC 1J5EC 4FUTA 1LQLA 4JI5C 2P2MA 2P2JA 2D7VA 1XNRC 4BC9A 1JOSA 4GKJC 3AF6A 4LFCC 1XMOC 4WS9A 1IBMC 3R9WA 4KHPC 1MDBA 2D1SA 1N32C 5LMNC 1UKKA 5GTDA 5BUQA 4DV4C 1O9TA 3NYQA 4DR5C 1HH2P 1WH9A 2YWCA 1PG3A 5DV9A 2P2FA 2P20A 2OO4A 2Y4OA 4DV1C 3GKUA 2KZFA 4DR7C 4DV3C 2ZM6C 4KTTA 3NYRA 4I9GA 5KYVA 4JV5C 1N34C 4DR2C 3DLPX 4U5YD 1N33C 2D1RA 1USPA 1RG9A 2BH1X 1AMUA 1HNZC 5BSVA 4GXQA 1N2FA 5BSUA 4X64C 4G37A 2UU9C 3KXWA 4NXNC 4ODJA 2OPLB 1N36C 4XX2A 3VNRA 4JI4C 4GS5A 1T5DX 2UXBC 1VLAA 1GPMA 1WF3A 4DCSA 4G1IA 1MXCA 4NDNA 2E8CA 4D4IA 5E7QA 2D27A 2P02A 4DUZC 5T8TA 4JYAC 5KYTA 2WP0C 2YWBA 3DHVA 2UXDC 4BBYA 1QM4A 4JI1C 4LFBC 4FTFA 4B3RC 4X66C 1LCIA 4DV7C 1MXBA 4IZ6A 1I94C 2EGTA 3VNSA 3C5EA 4ZJZA 4ZLPA 1MKYA 2BJOA 5JRHA 4JI7C 5CZVA 3GPCA 3CW9A 2JMPA 1L2FA 3LNVA 3PBKA 4WV3A 2VZEA 3RG2A 4JM1A 3RV2A 3LAXA 3SO4A 4OXIA 3VNQA 1O93A 3J80D 2PN2A 4LFAC 2F4VC 4D56A 4RVOA 2VQFC 1EGAA 4DV0C 2P2BA 1V26A 5BR8C 2E8FA 4LF9C 2CY1A 2E0GA 1FJGC 2ASBA 5K8FA 4DCTA 4RLFA 3CJEA 3A4IA 1ULTA 4RMNA 4I9FA 1K0RA 5FLXD 2UUAC 5LMUC 3FCCA 2E8EA 4DR6C 3B7WA 2PT7G 5BUSA 4KTVA 4DCUA 5IFIA 3T1YC 4JI2C 2AYAA 1V25A 4X62C 3H2TA 4ISBA 2V7BA 4LF8C 3A9UA 4NXMC 4YY3C 4JI8C 4OX9C 4K0KC 3T1HC 3LUSA 2HHHC 3S82A 1USPB 3IPLA 4IR7A 4NOZA 4AQYC 4GXRA 5IWAC 1YJ7A 2Y4NA 1XRBA 2E5LC 2QVXX 5BSRA 4DV2C 5A2QD 1IBKC 4PROC 4L4QA 4D4GA 2OBVA 2D1QA 2QL8A 5A1GA 1IBLC 1ZB8A 4D57A 1FUGA 1HNXC 3N54B 3GR0A 4L7IA 2D28C 2YCBA 4K0BA 4DR3C 4JI0C 4YHHC 2DYJA 3PESA 5BSMA 3TDEA 4LF4C 1O90A 5BSTA 5BSWA 5CZXA 4HPVA 4DUYC 1XMQC 2Y27A 2DPLA 2UUCC 4BSZA 3I08A 1KKGA 3ETOA 5KEIA 4PHTA 1NYEA 4X65C 2VQEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 C;  4LF9 C;  4LF5 C;  1USP A;  3R9X A;  2CY1 A;  3JAM D;  3J7A D;  1FJG C;  1HNZ C;  2ASB A;  4DCT A;  3CJE A;  3OTO C;  1N2F A;  1PA4 A;  4X64 C;  4MTN A;  2UU9 C;  4NXN C;  1K0R A;  5FLX D;  2UUA C;  5LMU C;  4DV6 C;  2OPL B;  1N36 C;  4XX2 A;  4JI4 C;  2E8E A;  2ONF A;  2UXB C;  4DR6 C;  1N33 C;  2PT7 G;  1VLA A;  4DCU A;  1WF3 A;  4DV5 C;  4B3S C;  4DCS A;  1XNQ C;  4B3T C;  3T1Y C;  4JI2 C;  3AF5 A;  2UUB C;  2E8C A;  4B3M C;  4X62 C;  1J5E C;  4LF8 C;  1LQL A;  4JI5 C;  1ML8 A;  4GKK C;  2D7V A;  4NXM C;  4YY3 C;  4JI8 C;  4OX9 C;  4K0K C;  4DCV A;  4DUZ C;  1XNR C;  4JYA C;  4JI6 C;  1JOS A;  3T1H C;  4GKJ C;  3LUS A;  3AF6 A;  2HHH C;  1USP B;  4NOZ A;  4LF7 C;  1QWI A;  4LFC C;  1ZB9 A;  4AQY C;  5IWA C;  4DR1 C;  4MH4 A;  2UXD C;  1XMO C;  4LF6 C;  1IBM C;  4JI1 C;  3R9W A;  5IT9 D;  4KHP C;  2E5L C;  4LFB C;  1HNW C;  1N32 C;  5LMN C;  4B3R C;  4X66 C;  2CXC A;  4DV2 C;  5A2Q D;  1IBK C;  1UKK A;  4DV7 C;  3IEU A;  1I94 C;  2EGT A;  4DV4 C;  2QL8 A;  1IBL C;  1ZB8 A;  2OPL A;  4DR5 C;  1HH2 P;  1MKY A;  1WH9 A;  1HNX C;  4DR4 C;  2BJO A;  3EER A;  4JI7 C;  3J81 D;  2YCB A;  4DR3 C;  4JI0 C;  4YHH C;  3I07 A;  2E7G A;  2DYJ A;  2JMP A;  1L2F A;  4LF4 C;  2UXC C;  4DV1 C;  2ATW A;  3GKU A;  4DUY C;  2KZF A;  4DR7 C;  1HR0 C;  4DV3 C;  1XMQ C;  2ZM6 C;  2XR1 A;  4DV0 C;  2UUC C;  4BSZ A;  3J80 D;  2PN2 A;  1KKG A;  4LFA C;  2F4V C;  4JV5 C;  1N34 C;  4DR2 C;  3IEV A;  1NYE A;  2VQF C;  1EGA A;  4X65 C;  2VQE C;  2HJG A;  5BR8 C;  2E8F A; 
#chains in the Genus database with same CATH topology
 1BA3 A;  4OYC A;  4PUH A;  4LF5 C;  3R9X A;  4RM3 A;  3TQI A;  3PRO C;  4BCA A;  4DV6 C;  2P2Q A;  2WD9 A;  4R1M A;  1MD9 A;  5A1I A;  4RM2 A;  4DV5 C;  4B3S C;  1XNQ C;  4B3T C;  3AF5 A;  4R1L A;  2PRO A;  1RY2 A;  1NY8 A;  1XRC A;  1ML8 A;  2ZZN A;  3R44 A;  1P4E C;  4GKK C;  3DAY A;  4DCV A;  4G36 A;  4EAT A;  3L95 X;  3E7X A;  4LE5 A;  4JI6 C;  4DG9 A;  2MMA B;  3NI2 A;  1QWI A;  4LF7 C;  1ZB9 A;  3N2Q A;  4DR1 C;  4MH4 A;  4LF6 C;  4FUQ A;  5IT9 D;  1HNW C;  2CXC A;  5AE2 A;  5T8S A;  1P7L A;  3LGX A;  3IEU A;  5BUR A;  2KDN A;  1T5H X;  2QW0 X;  2D1T A;  3LNO A;  3TUF A;  2OPL A;  3CQ2 A;  4DR4 C;  3EER A;  3G7S A;  3J81 D;  3A9V A;  3FM7 A;  3I07 A;  2E7G A;  5AE1 A;  2UXC C;  1MXA A;  2ATW A;  4PUI A;  5K85 A;  2QVZ X;  1HR0 C;  2XR1 A;  4L2Z A;  2ZZM A;  3IEV A;  3CW8 X;  3FCE A;  4DG8 A;  3A25 A;  2HJG A;  3IML A;  3UOW A;  4JI3 C;  1YGT A;  1M6X A;  2VSQ A;  1FLO A;  5AE3 A;  4R0M A;  3JAM D;  3J7A D;  4TPS B;  3NPD A;  4RLQ A;  4RVN A;  3OTO C;  1PA4 A;  1V60 A;  4MTN A;  5H9U A;  2MM9 A;  1PU1 A;  5A19 A;  3CQ1 A;  1PG4 A;  2ONF A;  3EQ6 A;  3UZ0 A;  3E7W A;  4PZP A;  3L8C A;  4BC7 A;  1MDF A;  5ADZ A;  3GR1 A;  3ETC A;  1O92 A;  1XRA A;  2UUB C;  4B3M C;  1J5E C;  4FUT A;  1LQL A;  4JI5 C;  2P2M A;  2P2J A;  2D7V A;  1XNR C;  4BC9 A;  1JOS A;  4GKJ C;  3AF6 A;  4LFC C;  1XMO C;  4WS9 A;  1IBM C;  3R9W A;  4KHP C;  1MDB A;  2D1S A;  1N32 C;  5LMN C;  1UKK A;  5GTD A;  5BUQ A;  4DV4 C;  3CQ3 A;  1O9T A;  3NYQ A;  4DR5 C;  1IB8 A;  1HH2 P;  1WH9 A;  2YWC A;  1PG3 A;  5DV9 A;  2P2F A;  2ZTB A;  2M5O A;  2P20 A;  3TR3 A;  2OO4 A;  2Y4O A;  4DV1 C;  3GKU A;  2KZF A;  4DR7 C;  4DV3 C;  4PUG A;  2ZM6 C;  4KTT A;  3NYR A;  4I9G A;  5KYV A;  4JV5 C;  1N34 C;  4DR2 C;  1P4E A;  3DLP X;  4U5Y D;  1N33 C;  2D1R A;  1USP A;  1RG9 A;  2BH1 X;  1AMU A;  1HNZ C;  5BSV A;  4GXQ A;  1N2F A;  5BSU A;  4X64 C;  1WCJ A;  4G37 A;  2UU9 C;  1XDX A;  3KXW A;  4NXN C;  4ODJ A;  2OPL B;  1N36 C;  2Z51 A;  4XX2 A;  3VNR A;  4JI4 C;  3UX2 A;  4GS5 A;  1T5D X;  2UXB C;  2JNV A;  1VLA A;  1GPM A;  1WF3 A;  4DCS A;  4G1I A;  1MXC A;  4NDN A;  2E8C A;  4D4I A;  3AY0 A;  5E7Q A;  2D27 A;  2P02 A;  4DUZ C;  5T8T A;  4JYA C;  2NCL A;  5KYT A;  2WP0 C;  2YWB A;  3DHV A;  2UXD C;  4BBY A;  1XHJ A;  1QM4 A;  4JI1 C;  4LFB C;  4FTF A;  4B3R C;  4X66 C;  1LCI A;  4DV7 C;  2PG1 E;  1MXB A;  4IZ6 A;  1I94 C;  2EGT A;  3UEB A;  3A26 A;  3VNS A;  2VQE C;  3C5E A;  4ZJZ A;  4ZLP A;  1MKY A;  2BJO A;  5JRH A;  4JI7 C;  5CZV A;  3GPC A;  3CW9 A;  2JMP A;  1L2F A;  3LNV A;  3PBK A;  4WV3 A;  2VZE A;  3RG2 A;  4JM1 A;  3RV2 A;  3LAX A;  3SO4 A;  4OXI A;  3VNQ A;  1O93 A;  3J80 D;  2PN2 A;  4LFA C;  2F4V C;  4D56 A;  4RVO A;  1UWD A;  2VQF C;  1EGA A;  2P2B A;  4DV0 C;  1V26 A;  5BR8 C;  2E8F A;  4LF9 C;  2CY1 A;  2E0G A;  1FJG C;  2ASB A;  5K8F A;  4DCT A;  4RLF A;  3CJE A;  2MCQ A;  3A4I A;  1ULT A;  4RMN A;  2YX1 A;  2KZ0 A;  4I9F A;  1K0R A;  5FLX D;  2UUA C;  5LMU C;  3FCC A;  2E8E A;  1VEH A;  4DR6 C;  3B7W A;  3K6R A;  2PT7 G;  5BUS A;  4KTV A;  4DCU A;  5IFI A;  3T1Y C;  4JI2 C;  2AYA A;  1V25 A;  4X62 C;  3H2T A;  4ISB A;  2V7B A;  4LF8 C;  3UX3 A;  3A9U A;  5LCI A;  4NXM C;  4YY3 C;  4JI8 C;  4OX9 C;  4K0K C;  2DHM A;  1M6X C;  3T1H C;  3LUS A;  2HHH C;  3S82 A;  2CU6 A;  1USP B;  3IPL A;  4IR7 A;  4NOZ A;  4AQY C;  1TH5 A;  4GXR A;  5IWA C;  1YJ7 A;  2Y4N A;  1XRB A;  2E5L C;  2QVX X;  5BSR A;  4DV2 C;  5A2Q D;  1XS3 A;  1IBK C;  4PRO C;  3O2E A;  4L4Q A;  4D4G A;  2OBV A;  2D1Q A;  5A1G A;  2QL8 A;  1IBL C;  1ZB8 A;  4D57 A;  1FUG A;  1HNX C;  3N54 B;  3GR0 A;  4L7I A;  2D28 C;  2YCB A;  4K0B A;  4DR3 C;  4JI0 C;  4YHH C;  2DYJ A;  3PES A;  5BSM A;  3TDE A;  4LF4 C;  1O90 A;  5BST A;  5BSW A;  5CZX A;  4HPV A;  4DUY C;  1XMQ C;  2Y27 A;  2DPL A;  2UUC C;  4BSZ A;  3I08 A;  1KKG A;  3ETO A;  5KEI A;  4PHT A;  2M5H A;  1NYE A;  4X65 C;  2QVY X; 
#chains in the Genus database with same CATH homology
 1BA3 A;  4OYC A;  4LF5 C;  3R9X A;  4RM3 A;  3TQI A;  3PRO C;  4BCA A;  4DV6 C;  2P2Q A;  2WD9 A;  4R1M A;  1MD9 A;  5A1I A;  4RM2 A;  4DV5 C;  4B3S C;  1XNQ C;  4B3T C;  3AF5 A;  4R1L A;  2PRO A;  1RY2 A;  1XRC A;  1ML8 A;  3R44 A;  4GKK C;  3DAY A;  4DCV A;  4G36 A;  4EAT A;  3L95 X;  3E7X A;  4LE5 A;  4JI6 C;  4DG9 A;  3NI2 A;  1QWI A;  4LF7 C;  1ZB9 A;  3N2Q A;  4DR1 C;  4MH4 A;  4LF6 C;  4FUQ A;  5IT9 D;  1HNW C;  2CXC A;  5AE2 A;  5T8S A;  1P7L A;  3LGX A;  3IEU A;  5BUR A;  1T5H X;  2QW0 X;  2D1T A;  3TUF A;  2OPL A;  4DR4 C;  3EER A;  3G7S A;  3J81 D;  3A9V A;  3I07 A;  2E7G A;  5AE1 A;  2QVY X;  2UXC C;  1MXA A;  2ATW A;  5K85 A;  2QVZ X;  1HR0 C;  2XR1 A;  4L2Z A;  3IEV A;  3CW8 X;  3FCE A;  4DG8 A;  2HJG A;  3IML A;  3UOW A;  4JI3 C;  2VSQ A;  5AE3 A;  4R0M A;  3JAM D;  3J7A D;  4TPS B;  3NPD A;  4RLQ A;  4RVN A;  3OTO C;  1PA4 A;  4MTN A;  5H9U A;  5A19 A;  1PG4 A;  2ONF A;  3EQ6 A;  3UZ0 A;  3E7W A;  4PZP A;  3L8C A;  4BC7 A;  1MDF A;  5ADZ A;  3GR1 A;  3ETC A;  1O92 A;  1XRA A;  2UUB C;  4B3M C;  1J5E C;  4FUT A;  1LQL A;  4JI5 C;  2P2M A;  2P2J A;  2D7V A;  1XNR C;  4BC9 A;  1JOS A;  4GKJ C;  3AF6 A;  4LFC C;  1XMO C;  4WS9 A;  1IBM C;  3R9W A;  4KHP C;  1MDB A;  2D1S A;  1N32 C;  5LMN C;  1UKK A;  5GTD A;  5BUQ A;  4DV4 C;  1O9T A;  3NYQ A;  4DR5 C;  1HH2 P;  1WH9 A;  2YWC A;  1PG3 A;  5DV9 A;  2P2F A;  2P20 A;  2OO4 A;  2Y4O A;  4DV1 C;  3GKU A;  2KZF A;  4DR7 C;  4DV3 C;  2ZM6 C;  4KTT A;  3NYR A;  4I9G A;  5KYV A;  4JV5 C;  1N34 C;  4DR2 C;  3DLP X;  4U5Y D;  1N33 C;  2D1R A;  1USP A;  1RG9 A;  2BH1 X;  1AMU A;  1HNZ C;  5BSV A;  4GXQ A;  1N2F A;  5BSU A;  4X64 C;  4G37 A;  2UU9 C;  3KXW A;  4NXN C;  4ODJ A;  2OPL B;  1N36 C;  4XX2 A;  3VNR A;  4JI4 C;  4GS5 A;  1T5D X;  2UXB C;  1VLA A;  1GPM A;  1WF3 A;  4DCS A;  4G1I A;  1MXC A;  4NDN A;  2E8C A;  4D4I A;  5E7Q A;  2D27 A;  2P02 A;  4DUZ C;  5T8T A;  4JYA C;  5KYT A;  2WP0 C;  2YWB A;  3DHV A;  2UXD C;  4BBY A;  1QM4 A;  4JI1 C;  4LFB C;  4FTF A;  4B3R C;  4X66 C;  1LCI A;  4DV7 C;  1MXB A;  4IZ6 A;  1I94 C;  2EGT A;  3VNS A;  3C5E A;  4ZJZ A;  4ZLP A;  1MKY A;  2BJO A;  5JRH A;  4JI7 C;  5CZV A;  3GPC A;  3CW9 A;  2JMP A;  1L2F A;  3LNV A;  3PBK A;  4WV3 A;  2VZE A;  3RG2 A;  4JM1 A;  3RV2 A;  3LAX A;  3SO4 A;  4OXI A;  3VNQ A;  1O93 A;  3J80 D;  2PN2 A;  4LFA C;  2F4V C;  4D56 A;  4RVO A;  2VQF C;  1EGA A;  4DV0 C;  2P2B A;  1V26 A;  5BR8 C;  2E8F A;  4LF9 C;  2CY1 A;  2E0G A;  1FJG C;  2ASB A;  5K8F A;  4DCT A;  4RLF A;  3CJE A;  3A4I A;  1ULT A;  4RMN A;  4I9F A;  1K0R A;  5FLX D;  2UUA C;  5LMU C;  3FCC A;  2E8E A;  4DR6 C;  3B7W A;  2PT7 G;  5BUS A;  4KTV A;  4DCU A;  5IFI A;  3T1Y C;  4JI2 C;  2AYA A;  1V25 A;  4X62 C;  3H2T A;  4ISB A;  2V7B A;  4LF8 C;  3A9U A;  4NXM C;  4YY3 C;  4JI8 C;  4OX9 C;  4K0K C;  3T1H C;  3LUS A;  2HHH C;  3S82 A;  1USP B;  3IPL A;  4IR7 A;  4NOZ A;  4AQY C;  4GXR A;  5IWA C;  1YJ7 A;  2Y4N A;  1XRB A;  2E5L C;  2QVX X;  5BSR A;  4DV2 C;  5A2Q D;  1IBK C;  4PRO C;  4L4Q A;  4D4G A;  2OBV A;  2D1Q A;  2QL8 A;  5A1G A;  1IBL C;  1ZB8 A;  4D57 A;  1FUG A;  1HNX C;  3N54 B;  3GR0 A;  4L7I A;  2D28 C;  2YCB A;  4K0B A;  4DR3 C;  4JI0 C;  4YHH C;  2DYJ A;  3PES A;  5BSM A;  3TDE A;  4LF4 C;  1O90 A;  5BST A;  5BSW A;  5CZX A;  4HPV A;  4DUY C;  1XMQ C;  2Y27 A;  2DPL A;  2UUC C;  4BSZ A;  3I08 A;  1KKG A;  3ETO A;  5KEI A;  4PHT A;  1NYE A;  4X65 C;  2VQE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...