4GKJC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gkjC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4gkjC02
2E8EA 1IBMC 4JI8C 4X66C 4JI2C 1XNRC 1HR0C 4YY3C 4NXNC 4LFCC 1EGAA 1IBKC 4JI5C 4DCTA 1USPB 4X62C 4DV1C 4JI6C 2UUBC 3AF6A 3JAMD 4B3RC 2ATWA 4OX9C 1HH2P 4DV5C 1WH9A 4DR4C 3I07A 4YHHC 2VQFC 4DCUA 4MH4A 4GKJC 4K0KC 3T1YC 1XMQC 4DR7C 4DR3C 4KHPC 4JI0C 3LUSA 2D7VA 4DV6C 2OPLB 2UXCC 1ZB8A 4JI7C 4DR1C 4XX2A 2VQEC 1XMOC 2CY1A 3EERA 3J81D 3OTOC 4JV5C 2PT7G 3R9XA 4GKKC 5A2QD 3IEVA 4DV0C 4JI1C 2UXDC 5LMUC 2EGTA 4LF7C 4LF5C 4LF9C 5BR8C 1ZB9A 4JYAC 2JMPA 1XNQC 1QWIA 4LF4C 2E7GA 4B3SC 2PN2A 2UXBC 1L2FA 2E8CA 1N36C 2UU9C 1N33C 2OPLA 2ZM6C 4DR5C 4DR2C 3CJEA 4NXMC 1ML8A 2E8FA 4B3MC 1WF3A 1J5EC 1NYEA 4LFBC 4LF6C 2HJGA 2HHHC 1MKYA 4DUZC 1FJGC 3J80D 1I94C 4DV7C 3T1HC 4B3TC 2ASBA 3R9WA 2CXCA 2ONFA 4LFAC 4DCVA 2DYJA 3IEUA 5IT9D 1HNWC 1N34C 3AF5A 2BJOA 5IWAC 4DUYC 4MTNA 2UUAC 1JOSA 1K0RA 5LMNC 5FLXD 4DV3C 1LQLA 4AQYC 4X64C 4JI4C 1N32C 1KKGA 1USPA 1IBLC 2KZFA 2YCBA 2F4VC 3GKUA 2XR1A 1HNXC 4X65C 1UKKA 4BSZA 2QL8A 4JI3C 2E5LC 4DCSA 2UUCC 4NOZA 4DR6C 1PA4A 1HNZC 4LF8C 4DV2C 4DV4C 3J7AD 1VLAA 1N2FA
chains in the Genus database with same CATH superfamily
4JI8C 4X66C 4PUHA 5K8FA 1XNRC 1GPMA 3AY0A 4NXNC 4LFCC 4JI5C 4DV1C 5A1IA 4B3RC 4PHTA 2YWBA 4DV5C 3FCCA 3B7WA 4DCUA 4DR7C 3S82A 1O92A 2WD9A 4KHPC 4JI0C 4G37A 2D7VA 4R0MA 2UXCC 2P2BA 3CW9A 2D28C 2ZZMA 1PG4A 2ZTBA 4I9GA 1XMOC 5LCIA 2CY1A 3EERA 1AMUA 4EATA 3R9XA 1YGTA 4R1MA 3IEVA 2OO4A 2EGTA 4LF7C 4LF9C 5BR8C 4JYAC 1O93A 3CQ1A 1YJ7A 4L4QA 1IB8A 4FTFA 4U5YD 1RG9A 4ISBA 1NYEA 1MXBA 3ETOA 1MKYA 1FJGC 2PG1E 3T1HC 4B3TC 1NY8A 1V26A 3R9WA 2V7BA 5KEIA 2VZEA 4PUIA 4KTTA 4DCVA 3IEUA 4ODJA 5IT9D 3LAXA 4RLQA 4RVOA 5FLXD 4AQYC 5BURA 3TR3A 1IBLC 4RVNA 2F4VC 2MMAB 3GKUA 2XR1A 2Y4OA 1PG3A 5BSUA 4D57A 2M5HA 2JNVA 4BC7A 4DCSA 2OBVA 4NOZA 1XS3A 4DR6C 4IR7A 1MDBA 4ZLPA 4IZ6A 3J7AD 4HPVA 4L7IA 3LNOA 3A9VA 4YY3C 5BSWA 3N54B 4DCTA 4X62C 3DHVA 4GXRA 2UUBC 2AYAA 1VEHA 5A19A 1HH2P 3UX3A 3I07A 2BH1X 4YHHC 4GKJC 4K0KC 3A9UA 3PROC 3UZ0A 2P2QA 4DV6C 2OPLB 3A26A 3IMLA 1TH5A 1WCJA 3J81D 5IFIA 3OTOC 2P20A 2UXDC 4JM1A 3LGXA 3TUFA 2P02A 1QWIA 2E7GA 4B3SC 2PN2A 2UXBC 2E8CA 4R1LA 2UU9C 1N33C 2DHMA 2OPLA 3CW8X 4BBYA 4DR2C 2Y27A 3CJEA 3R44A 2D1SA 1FUGA 1XRAA 2HJGA 5BSMA 3VNRA 1I94C 4K0BA 5AE1A 2CXCA 5BSVA 4LFAC 3N2QA 2ZZNA 4D4IA 3E7WA 3PBKA 4PZPA 3NPDA 2KDNA 5IWAC 4OYCA 5E7QA 4DV3C 3NYRA 1N32C 2D1TA 1USPA 4WV3A 1M6XC 5KYVA 2QVXX 4I9FA 3A25A 1P7LA 4X65C 2E5LC 3L8CA 4DV2C 3TQIA 3UX2A 2E8EA 5AE2A 3SO4A 4GS5A 1MD9A 1HR0C 1EGAA 4DG8A 3A4IA 1IBKC 5T8SA 4JI6C 5A1GA 2P2MA 3AF6A 3JAMD 2ATWA 1WH9A 1T5DX 1O9TA 1XRCA 3UOWA 4DR4C 3DLPX 3GR1A 2VQFC 1XMQC 4DR3C 3RG2A 1FLOA 2WP0C 5GTDA 1LCIA 1ZB8A 3VNSA 3I08A 5DV9A 3IPLA 4JV5C 2PT7G 1XRBA 4GKKC 4GXQA 4DV0C 3E7XA 4LF5C 1V60A 4NDNA 4RLFA 4LF4C 1ULTA 1L2FA 5BSRA 2D1RA 4PUGA 4FUQA 4OXIA 4LE5A 3C5EA 4DR5C 2VSQA 1ML8A 2E8FA 4B3MC 1WF3A 1J5EC 4LFBC 2P2JA 2HHHC 4DUZC 3J80D 5AE3A 2ASBA 2ONFA 3FCEA 2DYJA 5BUSA 2Z51A 2PROA 1N34C 2DPLA 3AF5A 4G36A 3H2TA 4MTNA 1JOSA 1UWDA 4BC9A 1K0RA 1RY2A 3VNQA 5ADZA 5LMNC 4JI4C 4ZJZA 1KKGA 2KZFA 1MDFA 2QL8A 4JI3C 3G7SA 2M5OA 2UUCC 1MXAA 4DG9A 1N2FA 1P4EC 1IBMC 4JI2C 2NCLA 4KTVA 2MM9A 1USPB 3DAYA 3NI2A 4TPSB 2QVZX 1T5HX 4OX9C 3GPCA 3L95X 2D27A 3LNVA 4MH4A 5T8TA 2MCQA 4PROC 3PESA 4G1IA 3T1YC 2D1QA 2YWCA 3LUSA 5H9UA 2E0GA 1XDXA 1M6XA 4BCAA 2Y4NA 4JI7C 4DR1C 4XX2A 2VQEC 2CU6A 1V25A 3NYQA 5A2QD 3FM7A 4JI1C 2KZ0A 5LMUC 1ZB9A 4RM3A 2JMPA 3GR0A 2YX1A 1XNQC 1N36C 5K85A 2ZM6C 1QM4A 5BSTA 4NXMC 5CZXA 5CZVA 1MXCA 1XHJA 4LF6C 3EQ6A 3RV2A 3UEBA 4DV7C 1O90A 5BUQA 3KXWA 1HNWC 2BJOA 1P4EA 4D56A 4RM2A 4DUYC 4WS9A 3ETCA 3K6RA 2UUAC 2P2FA 5JRHA 1LQLA 4X64C 4L2ZA 3CQ2A 1BA3A 2YCBA 4RMNA 1PU1A 2QVYX 1HNXC 1UKKA 4D4GA 4BSZA 3TDEA 3CQ3A 1PA4A 2QW0X 1HNZC 4LF8C 4DV4C 4FUTA 3O2EA 5KYTA 1VLAA
chains in the Genus database with same CATH topology
4JI8C 4X66C 5K8FA 1XNRC 1GPMA 4NXNC 4LFCC 4JI5C 4DV1C 5A1IA 4B3RC 4PHTA 2YWBA 4DV5C 3FCCA 3B7WA 4DCUA 4DR7C 3S82A 1O92A 2WD9A 4KHPC 4JI0C 4G37A 2D7VA 4R0MA 2UXCC 2P2BA 3CW9A 2D28C 1PG4A 4I9GA 1XMOC 2CY1A 3EERA 1AMUA 4EATA 3R9XA 4R1MA 3IEVA 2OO4A 2EGTA 4LF7C 4LF9C 5BR8C 4JYAC 1O93A 1YJ7A 4L4QA 4FTFA 4U5YD 1RG9A 4ISBA 1NYEA 1MXBA 3ETOA 1MKYA 1FJGC 3T1HC 4B3TC 1V26A 3R9WA 2V7BA 5KEIA 2VZEA 4KTTA 4DCVA 3IEUA 4ODJA 5IT9D 3LAXA 4RLQA 4RVOA 5FLXD 4AQYC 5BURA 1IBLC 4RVNA 2F4VC 3GKUA 2XR1A 2Y4OA 1PG3A 5BSUA 4D57A 4BC7A 4DCSA 2OBVA 4NOZA 4DR6C 4IR7A 1MDBA 4ZLPA 4IZ6A 3J7AD 4HPVA 4L7IA 3A9VA 4YY3C 5BSWA 3N54B 4DCTA 4X62C 3DHVA 4GXRA 2UUBC 2AYAA 5A19A 1HH2P 3I07A 2BH1X 4YHHC 4GKJC 4K0KC 3A9UA 3PROC 3UZ0A 2P2QA 4DV6C 2OPLB 3IMLA 3J81D 5IFIA 3OTOC 2P20A 2UXDC 4JM1A 3LGXA 3TUFA 2P02A 1QWIA 2E7GA 4B3SC 2PN2A 2UXBC 2E8CA 4R1LA 2UU9C 1N33C 2OPLA 3CW8X 4BBYA 4DR2C 2Y27A 3CJEA 3R44A 2D1SA 1FUGA 1XRAA 2HJGA 5BSMA 3VNRA 1I94C 4K0BA 5AE1A 2CXCA 5BSVA 4LFAC 3N2QA 4D4IA 3E7WA 3PBKA 4PZPA 3NPDA 5IWAC 4OYCA 5E7QA 4DV3C 3NYRA 1N32C 2D1TA 1USPA 4WV3A 5KYVA 2QVXX 4I9FA 1P7LA 4X65C 2E5LC 3L8CA 4DV2C 3TQIA 2E8EA 5AE2A 3SO4A 4GS5A 1MD9A 1HR0C 1EGAA 4DG8A 3A4IA 1IBKC 5T8SA 4JI6C 5A1GA 2P2MA 3AF6A 3JAMD 2ATWA 1WH9A 1T5DX 1O9TA 1XRCA 3UOWA 4DR4C 3DLPX 3GR1A 2VQFC 1XMQC 4DR3C 3RG2A 2WP0C 5GTDA 1LCIA 1ZB8A 3VNSA 3I08A 5DV9A 3IPLA 4JV5C 2PT7G 1XRBA 4GKKC 4GXQA 4DV0C 3E7XA 4LF5C 4NDNA 4RLFA 4LF4C 1ULTA 1L2FA 5BSRA 2D1RA 4FUQA 4OXIA 4LE5A 3C5EA 4DR5C 2VSQA 1ML8A 2E8FA 4B3MC 1WF3A 1J5EC 4LFBC 2P2JA 2HHHC 4DUZC 3J80D 5AE3A 2ASBA 2ONFA 3FCEA 2DYJA 5BUSA 2PROA 1N34C 2DPLA 3AF5A 4G36A 3H2TA 4MTNA 1JOSA 4BC9A 1K0RA 1RY2A 3VNQA 5ADZA 5LMNC 4JI4C 4ZJZA 1KKGA 2KZFA 1MDFA 2QL8A 4JI3C 3G7SA 2UUCC 1MXAA 4DG9A 1N2FA 1IBMC 4JI2C 4KTVA 1USPB 3DAYA 3NI2A 4TPSB 2QVZX 1T5HX 4OX9C 3GPCA 3L95X 2D27A 3LNVA 4MH4A 5T8TA 4PROC 3PESA 4G1IA 3T1YC 2D1QA 2YWCA 3LUSA 5H9UA 2E0GA 4BCAA 4JI7C 2Y4NA 4DR1C 4XX2A 2VQEC 1V25A 3NYQA 5A2QD 4JI1C 5LMUC 1ZB9A 4RM3A 2JMPA 3GR0A 1XNQC 1N36C 5K85A 2ZM6C 1QM4A 5BSTA 4NXMC 5CZXA 5CZVA 1MXCA 4LF6C 3EQ6A 3RV2A 4DV7C 1O90A 5BUQA 3KXWA 1HNWC 2BJOA 4D56A 4RM2A 4DUYC 4WS9A 3ETCA 2UUAC 2P2FA 5JRHA 1LQLA 4X64C 4L2ZA 1BA3A 2YCBA 4RMNA 1HNXC 2QVYX 1UKKA 4D4GA 4BSZA 3TDEA 1PA4A 2QW0X 1HNZC 4LF8C 4DV4C 4FUTA 5KYTA 1VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8E A;  1IBM C;  4JI8 C;  4X66 C;  4JI2 C;  1XNR C;  1HR0 C;  4YY3 C;  4NXN C;  4LFC C;  1EGA A;  1IBK C;  4JI5 C;  4DCT A;  1USP B;  4X62 C;  4DV1 C;  4JI6 C;  2UUB C;  3AF6 A;  3JAM D;  4B3R C;  2ATW A;  4OX9 C;  1HH2 P;  4DV5 C;  1WH9 A;  4DR4 C;  3I07 A;  4YHH C;  2VQF C;  4DCU A;  4MH4 A;  4GKJ C;  4K0K C;  3T1Y C;  1XMQ C;  4DR7 C;  4DR3 C;  4KHP C;  4JI0 C;  3LUS A;  2D7V A;  4DV6 C;  2OPL B;  2UXC C;  1ZB8 A;  4JI7 C;  4DR1 C;  4XX2 A;  2VQE C;  1XMO C;  2CY1 A;  3EER A;  3J81 D;  3OTO C;  4JV5 C;  2PT7 G;  3R9X A;  4GKK C;  5A2Q D;  3IEV A;  4DV0 C;  4JI1 C;  2UXD C;  5LMU C;  2EGT A;  4LF7 C;  4LF5 C;  4LF9 C;  5BR8 C;  1ZB9 A;  4JYA C;  2JMP A;  1XNQ C;  1QWI A;  4LF4 C;  2E7G A;  4B3S C;  2PN2 A;  2UXB C;  1L2F A;  2E8C A;  1N36 C;  2UU9 C;  1N33 C;  2OPL A;  2ZM6 C;  4DR5 C;  4DR2 C;  3CJE A;  4NXM C;  1ML8 A;  2E8F A;  4B3M C;  1WF3 A;  1J5E C;  1NYE A;  4LFB C;  4LF6 C;  2HJG A;  2HHH C;  1MKY A;  4DUZ C;  1FJG C;  3J80 D;  1I94 C;  4DV7 C;  3T1H C;  4B3T C;  2ASB A;  3R9W A;  2CXC A;  2ONF A;  4LFA C;  4DCV A;  2DYJ A;  3IEU A;  5IT9 D;  1HNW C;  1N34 C;  3AF5 A;  2BJO A;  5IWA C;  4DUY C;  4MTN A;  2UUA C;  1JOS A;  1K0R A;  5LMN C;  5FLX D;  4DV3 C;  1LQL A;  4AQY C;  4X64 C;  4JI4 C;  1N32 C;  1KKG A;  1USP A;  1IBL C;  2KZF A;  2YCB A;  2F4V C;  3GKU A;  2XR1 A;  1HNX C;  4X65 C;  1UKK A;  4BSZ A;  2QL8 A;  4JI3 C;  2E5L C;  4DCS A;  2UUC C;  4NOZ A;  4DR6 C;  1PA4 A;  1HNZ C;  4LF8 C;  4DV2 C;  4DV4 C;  3J7A D;  1VLA A;  1N2F A; 
#chains in the Genus database with same CATH topology
 4JI8 C;  4X66 C;  4PUH A;  5K8F A;  1XNR C;  1GPM A;  3AY0 A;  4NXN C;  4LFC C;  4JI5 C;  4DV1 C;  5A1I A;  4B3R C;  4PHT A;  2YWB A;  4DV5 C;  3FCC A;  3B7W A;  4DCU A;  4DR7 C;  3S82 A;  1O92 A;  2WD9 A;  4KHP C;  4JI0 C;  4G37 A;  2D7V A;  4R0M A;  2UXC C;  2P2B A;  3CW9 A;  2D28 C;  2ZZM A;  1PG4 A;  2ZTB A;  4I9G A;  1XMO C;  5LCI A;  2CY1 A;  3EER A;  1AMU A;  4EAT A;  3R9X A;  1YGT A;  4R1M A;  3IEV A;  2OO4 A;  2EGT A;  4LF7 C;  4LF9 C;  5BR8 C;  4JYA C;  1O93 A;  3CQ1 A;  1YJ7 A;  4L4Q A;  1IB8 A;  4FTF A;  4U5Y D;  1RG9 A;  4ISB A;  1NYE A;  1MXB A;  3ETO A;  1MKY A;  1FJG C;  2PG1 E;  3T1H C;  4B3T C;  1NY8 A;  1V26 A;  3R9W A;  2V7B A;  5KEI A;  2VZE A;  4PUI A;  4KTT A;  4DCV A;  3IEU A;  4ODJ A;  5IT9 D;  3LAX A;  4RLQ A;  4RVO A;  5FLX D;  4AQY C;  5BUR A;  3TR3 A;  1IBL C;  4RVN A;  2F4V C;  2MMA B;  3GKU A;  2XR1 A;  2Y4O A;  1PG3 A;  5BSU A;  4D57 A;  2M5H A;  2JNV A;  4BC7 A;  4DCS A;  2OBV A;  4NOZ A;  1XS3 A;  4DR6 C;  4IR7 A;  1MDB A;  4ZLP A;  4IZ6 A;  3J7A D;  4HPV A;  4L7I A;  3LNO A;  3A9V A;  4YY3 C;  5BSW A;  3N54 B;  4DCT A;  4X62 C;  3DHV A;  4GXR A;  2UUB C;  2AYA A;  1VEH A;  5A19 A;  1HH2 P;  3UX3 A;  3I07 A;  2BH1 X;  4YHH C;  4GKJ C;  4K0K C;  3A9U A;  3PRO C;  3UZ0 A;  2P2Q A;  4DV6 C;  2OPL B;  3A26 A;  3IML A;  1TH5 A;  1WCJ A;  3J81 D;  5IFI A;  3OTO C;  2P20 A;  2UXD C;  4JM1 A;  3LGX A;  3TUF A;  2P02 A;  1QWI A;  2E7G A;  4B3S C;  2PN2 A;  2UXB C;  2E8C A;  4R1L A;  2UU9 C;  1N33 C;  2DHM A;  2OPL A;  3CW8 X;  4BBY A;  4DR2 C;  2Y27 A;  3CJE A;  3R44 A;  2D1S A;  1FUG A;  1XRA A;  2HJG A;  5BSM A;  3VNR A;  1I94 C;  4K0B A;  5AE1 A;  2CXC A;  5BSV A;  4LFA C;  3N2Q A;  2ZZN A;  4D4I A;  3E7W A;  3PBK A;  4PZP A;  3NPD A;  2KDN A;  5IWA C;  4OYC A;  5E7Q A;  4DV3 C;  3NYR A;  1N32 C;  2D1T A;  1USP A;  4WV3 A;  1M6X C;  5KYV A;  2QVX X;  4I9F A;  3A25 A;  1P7L A;  4X65 C;  2E5L C;  3L8C A;  4DV2 C;  3TQI A;  3UX2 A;  2E8E A;  5AE2 A;  3SO4 A;  4GS5 A;  1MD9 A;  1HR0 C;  1EGA A;  4DG8 A;  3A4I A;  1IBK C;  5T8S A;  4JI6 C;  5A1G A;  2P2M A;  3AF6 A;  3JAM D;  2ATW A;  1WH9 A;  1T5D X;  1O9T A;  1XRC A;  3UOW A;  4DR4 C;  3DLP X;  3GR1 A;  2VQF C;  1XMQ C;  4DR3 C;  3RG2 A;  1FLO A;  2WP0 C;  5GTD A;  1LCI A;  1ZB8 A;  3VNS A;  3I08 A;  5DV9 A;  3IPL A;  4JV5 C;  2PT7 G;  1XRB A;  4GKK C;  4GXQ A;  4DV0 C;  3E7X A;  4LF5 C;  1V60 A;  4NDN A;  4RLF A;  4LF4 C;  1ULT A;  1L2F A;  5BSR A;  2D1R A;  4PUG A;  4FUQ A;  4OXI A;  4LE5 A;  3C5E A;  4DR5 C;  2VSQ A;  1ML8 A;  2E8F A;  4B3M C;  1WF3 A;  1J5E C;  4LFB C;  2P2J A;  2HHH C;  4DUZ C;  3J80 D;  5AE3 A;  2ASB A;  2ONF A;  3FCE A;  2DYJ A;  5BUS A;  2Z51 A;  2PRO A;  1N34 C;  2DPL A;  3AF5 A;  4G36 A;  3H2T A;  4MTN A;  1JOS A;  1UWD A;  4BC9 A;  1K0R A;  1RY2 A;  3VNQ A;  5ADZ A;  5LMN C;  4JI4 C;  4ZJZ A;  1KKG A;  2KZF A;  1MDF A;  2QL8 A;  4JI3 C;  3G7S A;  2M5O A;  2UUC C;  1MXA A;  4DG9 A;  1N2F A;  1P4E C;  1IBM C;  4JI2 C;  2NCL A;  4KTV A;  2MM9 A;  1USP B;  3DAY A;  3NI2 A;  4TPS B;  2QVZ X;  1T5H X;  4OX9 C;  3GPC A;  3L95 X;  2D27 A;  3LNV A;  4MH4 A;  5T8T A;  2MCQ A;  4PRO C;  3PES A;  4G1I A;  3T1Y C;  2D1Q A;  2YWC A;  3LUS A;  5H9U A;  2E0G A;  1XDX A;  1M6X A;  4BCA A;  2Y4N A;  4JI7 C;  4DR1 C;  4XX2 A;  2VQE C;  2CU6 A;  1V25 A;  3NYQ A;  5A2Q D;  3FM7 A;  4JI1 C;  2KZ0 A;  5LMU C;  1ZB9 A;  4RM3 A;  2JMP A;  3GR0 A;  2YX1 A;  1XNQ C;  1N36 C;  5K85 A;  2ZM6 C;  1QM4 A;  5BST A;  4NXM C;  5CZX A;  5CZV A;  1MXC A;  1XHJ A;  4LF6 C;  3EQ6 A;  3RV2 A;  3UEB A;  4DV7 C;  1O90 A;  5BUQ A;  3KXW A;  1HNW C;  2BJO A;  1P4E A;  4D56 A;  4RM2 A;  4DUY C;  4WS9 A;  3ETC A;  3K6R A;  2UUA C;  2P2F A;  5JRH A;  1LQL A;  4X64 C;  4L2Z A;  3CQ2 A;  1BA3 A;  2YCB A;  4RMN A;  1PU1 A;  2QVY X;  1HNX C;  1UKK A;  4D4G A;  4BSZ A;  3TDE A;  3CQ3 A;  1PA4 A;  2QW0 X;  1HNZ C;  4LF8 C;  4DV4 C;  4FUT A;  3O2E A;  5KYT A;  1VLA A; 
#chains in the Genus database with same CATH homology
 4JI8 C;  4X66 C;  5K8F A;  1XNR C;  1GPM A;  4NXN C;  4LFC C;  4JI5 C;  4DV1 C;  5A1I A;  4B3R C;  4PHT A;  2YWB A;  4DV5 C;  3FCC A;  3B7W A;  4DCU A;  4DR7 C;  3S82 A;  1O92 A;  2WD9 A;  4KHP C;  4JI0 C;  4G37 A;  2D7V A;  4R0M A;  2UXC C;  2P2B A;  3CW9 A;  2D28 C;  1PG4 A;  4I9G A;  1XMO C;  2CY1 A;  3EER A;  1AMU A;  4EAT A;  3R9X A;  4R1M A;  3IEV A;  2OO4 A;  2EGT A;  4LF7 C;  4LF9 C;  5BR8 C;  4JYA C;  1O93 A;  1YJ7 A;  4L4Q A;  4FTF A;  4U5Y D;  1RG9 A;  4ISB A;  1NYE A;  1MXB A;  3ETO A;  1MKY A;  1FJG C;  3T1H C;  4B3T C;  1V26 A;  3R9W A;  2V7B A;  5KEI A;  2VZE A;  4KTT A;  4DCV A;  3IEU A;  4ODJ A;  5IT9 D;  3LAX A;  4RLQ A;  4RVO A;  5FLX D;  4AQY C;  5BUR A;  1IBL C;  4RVN A;  2F4V C;  3GKU A;  2XR1 A;  2Y4O A;  1PG3 A;  5BSU A;  4D57 A;  4BC7 A;  4DCS A;  2OBV A;  4NOZ A;  4DR6 C;  4IR7 A;  1MDB A;  4ZLP A;  4IZ6 A;  3J7A D;  4HPV A;  4L7I A;  3A9V A;  4YY3 C;  5BSW A;  3N54 B;  4DCT A;  4X62 C;  3DHV A;  4GXR A;  2UUB C;  2AYA A;  5A19 A;  1HH2 P;  3I07 A;  2BH1 X;  4YHH C;  4GKJ C;  4K0K C;  3A9U A;  3PRO C;  3UZ0 A;  2P2Q A;  4DV6 C;  2OPL B;  3IML A;  3J81 D;  5IFI A;  3OTO C;  2P20 A;  2UXD C;  4JM1 A;  3LGX A;  3TUF A;  2P02 A;  1QWI A;  2E7G A;  4B3S C;  2PN2 A;  2UXB C;  2E8C A;  4R1L A;  2UU9 C;  1N33 C;  2OPL A;  3CW8 X;  4BBY A;  4DR2 C;  2Y27 A;  3CJE A;  3R44 A;  2D1S A;  1FUG A;  1XRA A;  2HJG A;  5BSM A;  3VNR A;  1I94 C;  4K0B A;  5AE1 A;  2CXC A;  5BSV A;  4LFA C;  3N2Q A;  4D4I A;  3E7W A;  3PBK A;  4PZP A;  3NPD A;  5IWA C;  4OYC A;  5E7Q A;  4DV3 C;  3NYR A;  1N32 C;  2D1T A;  1USP A;  4WV3 A;  5KYV A;  2QVX X;  4I9F A;  1P7L A;  4X65 C;  2E5L C;  3L8C A;  4DV2 C;  3TQI A;  2E8E A;  5AE2 A;  3SO4 A;  4GS5 A;  1MD9 A;  1HR0 C;  1EGA A;  4DG8 A;  3A4I A;  1IBK C;  5T8S A;  4JI6 C;  5A1G A;  2P2M A;  3AF6 A;  3JAM D;  2ATW A;  1WH9 A;  1T5D X;  1O9T A;  1XRC A;  3UOW A;  4DR4 C;  3DLP X;  3GR1 A;  2VQF C;  1XMQ C;  4DR3 C;  3RG2 A;  2WP0 C;  5GTD A;  1LCI A;  1ZB8 A;  3VNS A;  3I08 A;  5DV9 A;  3IPL A;  4JV5 C;  2PT7 G;  1XRB A;  4GKK C;  4GXQ A;  4DV0 C;  3E7X A;  4LF5 C;  4NDN A;  4RLF A;  4LF4 C;  1ULT A;  1L2F A;  5BSR A;  2D1R A;  4FUQ A;  4OXI A;  4LE5 A;  3C5E A;  4DR5 C;  2VSQ A;  1ML8 A;  2E8F A;  4B3M C;  1WF3 A;  1J5E C;  4LFB C;  2P2J A;  2HHH C;  4DUZ C;  3J80 D;  5AE3 A;  2ASB A;  2ONF A;  3FCE A;  2DYJ A;  5BUS A;  2PRO A;  1N34 C;  2DPL A;  3AF5 A;  4G36 A;  3H2T A;  4MTN A;  1JOS A;  4BC9 A;  1K0R A;  1RY2 A;  3VNQ A;  5ADZ A;  5LMN C;  4JI4 C;  4ZJZ A;  1KKG A;  2KZF A;  1MDF A;  2QL8 A;  4JI3 C;  3G7S A;  2UUC C;  1MXA A;  4DG9 A;  1N2F A;  1IBM C;  4JI2 C;  4KTV A;  1USP B;  3DAY A;  3NI2 A;  4TPS B;  2QVZ X;  1T5H X;  4OX9 C;  3GPC A;  3L95 X;  2D27 A;  3LNV A;  4MH4 A;  5T8T A;  4PRO C;  3PES A;  4G1I A;  3T1Y C;  2D1Q A;  2YWC A;  3LUS A;  5H9U A;  2E0G A;  4BCA A;  4JI7 C;  2Y4N A;  4DR1 C;  4XX2 A;  2VQE C;  1V25 A;  3NYQ A;  5A2Q D;  4JI1 C;  5LMU C;  1ZB9 A;  4RM3 A;  2JMP A;  3GR0 A;  1XNQ C;  1N36 C;  5K85 A;  2ZM6 C;  1QM4 A;  5BST A;  4NXM C;  5CZX A;  5CZV A;  1MXC A;  4LF6 C;  3EQ6 A;  3RV2 A;  4DV7 C;  1O90 A;  5BUQ A;  3KXW A;  1HNW C;  2BJO A;  4D56 A;  4RM2 A;  4DUY C;  4WS9 A;  3ETC A;  2UUA C;  2P2F A;  5JRH A;  1LQL A;  4X64 C;  4L2Z A;  1BA3 A;  2YCB A;  4RMN A;  1HNX C;  2QVY X;  1UKK A;  4D4G A;  4BSZ A;  3TDE A;  1PA4 A;  2QW0 X;  1HNZ C;  4LF8 C;  4DV4 C;  4FUT A;  5KYT A;  1VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...