4DV6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv6C02
4GKKC 4DV1C 2QL8A 2PN2A 4DR2C 4K0KC 4LF9C 2CXCA 4DV4C 1HNWC 1KKGA 1K0RA 1XMOC 2KZFA 4JI4C 3J7AD 3J80D 4DR3C 4YY3C 4DCTA 4JYAC 4B3RC 4DUZC 3GKUA 2VQFC 1USPB 2E8CA 4JI7C 3LUSA 4LF5C 3AF5A 4LF8C 4LFAC 1ML8A 4OX9C 4MH4A 1HH2P 1WF3A 1HR0C 1N33C 1QWIA 2HJGA 1LQLA 1HNXC 1IBMC 2OPLB 4JI3C 3R9XA 4B3SC 2DYJA 1USPA 3T1HC 4DR7C 4DV0C 3R9WA 1ZB8A 1I94C 4NXNC 4LFBC 2ZM6C 2UXDC 2UXBC 4DCSA 3J81D 3EERA 3I07A 1N2FA 2VQEC 4KHPC 4DV2C 2BJOA 1J5EC 3JAMD 4JI8C 4JI2C 4LFCC 5LMUC 2XR1A 1N36C 4DR4C 4DV6C 1EGAA 4DUYC 2D7VA 4DR5C 2EGTA 1NYEA 1IBKC 2E5LC 4BSZA 2PT7G 2F4VC 2HHHC 2E8FA 4B3TC 4NXMC 4JI5C 4MTNA 4LF4C 5A2QD 1PA4A 1WH9A 4LF6C 2YCBA 2UU9C 2UXCC 1N32C 4X64C 3AF6A 2ASBA 4DV5C 1FJGC 2JMPA 4AQYC 1MKYA 4B3MC 3CJEA 4JV5C 4XX2A 1ZB9A 3OTOC 2ATWA 4DV3C 4JI6C 3T1YC 1XNQC 5IWAC 2UUCC 2ONFA 4JI0C 1L2FA 4DV7C 4NOZA 4DR1C 1N34C 3IEUA 1HNZC 2E8EA 4X62C 4YHHC 2CY1A 2E7GA 3IEVA 1JOSA 4X66C 5FLXD 4DCVA 1UKKA 5BR8C 1IBLC 5IT9D 4LF7C 4DR6C 4X65C 2OPLA 2UUBC 1XNRC 1VLAA 5LMNC 1XMQC 2UUAC 4JI1C 4DCUA 4GKJC
chains in the Genus database with same CATH superfamily
4GKKC 2CU6A 4DV1C 4TPSB 2PG1E 4DV4C 1HNWC 1K0RA 4JI4C 4BCAA 4DR3C 1AMUA 4JYAC 3NYQA 2WD9A 5T8SA 3ETOA 3GR1A 1USPB 2E8CA 3IMLA 3TR3A 2VQFC 2P2FA 3A4IA 4OX9C 1HH2P 3UX3A 3K6RA 1LQLA 1HNXC 1FUGA 2YX1A 4I9FA 3T1HC 4PROC 2VZEA 3LGXA 3R9WA 4LFBC 2ZM6C 2D1SA 3J81D 5BSMA 4BC7A 5BSTA 3TUFA 5AE2A 3LNVA 2BJOA 1O93A 3JAMD 2XR1A 5BSWA 1EGAA 3L95X 3FCCA 3GR0A 4OXIA 2EGTA 2M5HA 3FM7A 5BUQA 2E5LC 2E8FA 4NXMC 4MTNA 1P4EA 3NI2A 3A9VA 3E7XA 1UWDA 2UXCC 3IPLA 5E7QA 4X64C 2ASBA 1FJGC 2JMPA 3H2TA 1M6XC 2ATWA 2DPLA 4D4IA 1XNQC 4FUTA 2Y4NA 3LAXA 2KZ0A 2Y27A 1MDFA 4JI0C 3IEUA 2D1QA 2E7GA 3IEVA 2P2MA 1O9TA 1JOSA 4ODJA 3B7WA 4DCVA 4LF7C 4D56A 4DR6C 2OPLA 2UUBC 1XNRC 1MXBA 3UZ0A 1PG3A 2D28C 2PN2A 4NDNA 4K0KC 4LF9C 4G36A 1KKGA 3AY0A 3CW8X 4YY3C 4DCTA 4GXRA 4B3RC 3A9UA 4DUZC 3TQIA 1XHJA 4JI7C 4GXQA 4LF8C 3LUSA 4LF5C 5AE3A 4MH4A 3EQ6A 3UEBA 3VNSA 1N33C 1QWIA 2DHMA 3E7WA 5JRHA 2WP0C 2OPLB 3I08A 4B3SC 2DYJA 2MMAB 2ZZMA 2KDNA 3R44A 4RM3A 1ZB8A 3LNOA 4DCSA 3L8CA 4PHTA 3EERA 4RVOA 1T5HX 1N2FA 1NY8A 1WCJA 5BSUA 4DV2C 1J5EC 4JI2C 2QVXX 5LMUC 1N36C 4DV6C 2MCQA 4DUYC 4DG9A 4DR5C 1NYEA 1BA3A 1IBKC 4G1IA 3C5EA 2PT7G 2HHHC 4ZLPA 2BH1X 2ZZNA 3SO4A 4BC9A 5A2QD 1PA4A 3CQ2A 1WH9A 1LCIA 3N54B 2D1RA 2JNVA 3AF6A 3PROC 1MDBA 1IB8A 3ETCA 1T5DX 1MKYA 4B3MC 4JV5C 2VSQA 4JI6C 3T1YC 5IWAC 2UUCC 1O90A 4PUHA 5CZVA 4LE5A 4DV7C 5KYVA 1XRAA 4IZ6A 4L2ZA 4X62C 4KTTA 1YGTA 4R0MA 4I9GA 5FLXD 2P2QA 1UKKA 4WV3A 4X65C 2QW0X 4L4QA 1XS3A 2ZTBA 1VLAA 1XMQC 2UUAC 1GPMA 1RG9A 4DCUA 3DAYA 2QL8A 4R1MA 2NCLA 1MXAA 4DR2C 3VNRA 4IR7A 1YJ7A 1XMOC 1P7LA 5BSRA 3J7AD 2D27A 4GS5A 3J80D 4D4GA 5DV9A 3A25A 3GKUA 5H9UA 4PUIA 1VEHA 5IFIA 2D1TA 5A19A 3RG2A 5KEIA 1IBMC 3R9XA 3PESA 4DV0C 4NXNC 4FUQA 1XRCA 4RM2A 3I07A 4DR4C 2D7VA 4BSZA 5AE1A 2F4VC 4K0BA 5GTDA 4B3TC 2YWBA 2P20A 3UOWA 3PBKA 4LF6C 3CW9A 2YCBA 3NYRA 2UU9C 1MXCA 1MD9A 1PG4A 4AQYC 5K85A 3CJEA 1V25A 3OTOC 3VNQA 2P02A 1RY2A 1TH5A 1L2FA 4EATA 1O92A 4NOZA 1N34C 4R1LA 2E8EA 4YHHC 4KTVA 1P4EC 4ZJZA 1M6XA 5A1IA 4X66C 2Z51A 4PUGA 5BR8C 1IBLC 2P2BA 4BBYA 4OYCA 1FLOA 3N2QA 1ULTA 4DG8A 4JI1C 5T8TA 2AYAA 4GKJC 5LCIA 4U5YD 5K8FA 2CXCA 4RLQA 4RMNA 1V26A 2KZFA 2PROA 3DHVA 5CZXA 3DLPX 3AF5A 4LFAC 1ML8A 1WF3A 5KYTA 1HR0C 5ADZA 2HJGA 2YWCA 2Y4OA 4JI3C 3O2EA 1USPA 4DR7C 1QM4A 1I94C 2UXDC 2UXBC 5BUSA 2QVYX 3TDEA 4RVNA 5A1GA 3CQ3A 2VQEC 4KHPC 4LFCC 4JI8C 4D57A 2QVZX 4HPVA 3FCEA 2OO4A 1XDXA 3GPCA 4JI5C 4LF4C 4JM1A 4G37A 4WS9A 3KXWA 4RLFA 2M5OA 3A26A 1XRBA 3G7SA 1N32C 4DV5C 5BURA 3S82A 2OBVA 5BSVA 4XX2A 1ZB9A 2P2JA 4DV3C 3NPDA 2ONFA 2V7BA 4DR1C 3RV2A 4FTFA 1HNZC 2CY1A 1PU1A 2MM9A 5IT9D 4L7IA 3UX2A 4ISBA 3CQ1A 5LMNC 4PZPA 1V60A 2E0GA
chains in the Genus database with same CATH topology
4GKKC 4DV1C 4TPSB 4DV4C 1HNWC 1K0RA 4JI4C 4BCAA 4DR3C 1AMUA 4JYAC 3NYQA 2WD9A 5T8SA 3ETOA 3GR1A 1USPB 2E8CA 3IMLA 2VQFC 2P2FA 3A4IA 4OX9C 1HH2P 1LQLA 1HNXC 1FUGA 4I9FA 3T1HC 4PROC 2VZEA 3LGXA 3R9WA 4LFBC 2ZM6C 2D1SA 3J81D 5BSMA 4BC7A 5BSTA 3TUFA 5AE2A 3LNVA 2BJOA 1O93A 3JAMD 2XR1A 5BSWA 1EGAA 3L95X 3FCCA 3GR0A 4OXIA 2EGTA 5BUQA 2E5LC 2E8FA 4NXMC 4MTNA 3NI2A 3A9VA 3E7XA 2UXCC 3IPLA 5E7QA 4X64C 2ASBA 1FJGC 2JMPA 3H2TA 2ATWA 2DPLA 4D4IA 1XNQC 4FUTA 2Y4NA 3LAXA 2Y27A 1MDFA 4JI0C 3IEUA 2D1QA 2E7GA 3IEVA 2P2MA 1O9TA 1JOSA 4ODJA 3B7WA 4DCVA 4LF7C 4D56A 4DR6C 2OPLA 2UUBC 1XNRC 1MXBA 3UZ0A 1PG3A 2D28C 2PN2A 4NDNA 4K0KC 4LF9C 4G36A 1KKGA 3CW8X 4YY3C 4DCTA 4GXRA 4B3RC 3A9UA 4DUZC 3TQIA 4JI7C 4GXQA 4LF8C 3LUSA 4LF5C 5AE3A 4MH4A 3EQ6A 3VNSA 1N33C 1QWIA 3E7WA 5JRHA 2WP0C 2OPLB 3I08A 4B3SC 2DYJA 3R44A 4RM3A 1ZB8A 4DCSA 3L8CA 4PHTA 3EERA 4RVOA 1T5HX 1N2FA 5BSUA 4DV2C 1J5EC 4JI2C 2QVXX 5LMUC 1N36C 4DV6C 4DUYC 4DG9A 4DR5C 1NYEA 1BA3A 1IBKC 4G1IA 3C5EA 2PT7G 2HHHC 4ZLPA 2BH1X 3SO4A 4BC9A 5A2QD 1PA4A 1WH9A 1LCIA 3N54B 2D1RA 3AF6A 3PROC 1MDBA 3ETCA 1T5DX 1MKYA 4B3MC 4JV5C 2VSQA 4JI6C 3T1YC 5IWAC 2UUCC 1O90A 5CZVA 4LE5A 4DV7C 5KYVA 1XRAA 4IZ6A 4L2ZA 4X62C 4KTTA 4R0MA 4I9GA 5FLXD 2P2QA 1UKKA 4WV3A 4X65C 2QW0X 4L4QA 1VLAA 1XMQC 2UUAC 1GPMA 1RG9A 4DCUA 3DAYA 2QL8A 4R1MA 1MXAA 4DR2C 3VNRA 4IR7A 1YJ7A 1XMOC 1P7LA 5BSRA 3J7AD 2D27A 4GS5A 3J80D 4D4GA 5DV9A 3GKUA 5H9UA 5IFIA 2D1TA 5A19A 3RG2A 5KEIA 1IBMC 3R9XA 3PESA 4DV0C 4NXNC 4FUQA 1XRCA 4RM2A 3I07A 4DR4C 2D7VA 4BSZA 5AE1A 2F4VC 4K0BA 5GTDA 4B3TC 2YWBA 2P20A 3UOWA 3PBKA 4LF6C 3CW9A 2YCBA 3NYRA 2UU9C 1MXCA 1MD9A 1PG4A 4AQYC 5K85A 3CJEA 1V25A 3OTOC 3VNQA 2P02A 1RY2A 1L2FA 4EATA 1O92A 4NOZA 1N34C 4R1LA 2E8EA 4YHHC 4KTVA 4ZJZA 5A1IA 4X66C 5BR8C 1IBLC 2P2BA 4BBYA 4OYCA 3N2QA 1ULTA 4DG8A 4JI1C 5T8TA 2AYAA 4GKJC 4U5YD 5K8FA 2CXCA 4RLQA 4RMNA 1V26A 2KZFA 2PROA 3DHVA 5CZXA 3DLPX 3AF5A 4LFAC 1ML8A 1WF3A 5KYTA 1HR0C 5ADZA 2HJGA 2YWCA 2Y4OA 4JI3C 1USPA 4DR7C 1QM4A 1I94C 2UXDC 2UXBC 5BUSA 2QVYX 3TDEA 4RVNA 5A1GA 2VQEC 4KHPC 4LFCC 4JI8C 4D57A 2QVZX 4HPVA 3FCEA 2OO4A 3GPCA 4JI5C 4LF4C 4JM1A 4G37A 4WS9A 3KXWA 4RLFA 1XRBA 3G7SA 1N32C 4DV5C 5BURA 3S82A 2OBVA 5BSVA 4XX2A 1ZB9A 2P2JA 4DV3C 3NPDA 2ONFA 2V7BA 4DR1C 3RV2A 4FTFA 1HNZC 2CY1A 5IT9D 4L7IA 4ISBA 5LMNC 4PZPA 2E0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK C;  4DV1 C;  2QL8 A;  2PN2 A;  4DR2 C;  4K0K C;  4LF9 C;  2CXC A;  4DV4 C;  1HNW C;  1KKG A;  1K0R A;  1XMO C;  2KZF A;  4JI4 C;  3J7A D;  3J80 D;  4DR3 C;  4YY3 C;  4DCT A;  4JYA C;  4B3R C;  4DUZ C;  3GKU A;  2VQF C;  1USP B;  2E8C A;  4JI7 C;  3LUS A;  4LF5 C;  3AF5 A;  4LF8 C;  4LFA C;  1ML8 A;  4OX9 C;  4MH4 A;  1HH2 P;  1WF3 A;  1HR0 C;  1N33 C;  1QWI A;  2HJG A;  1LQL A;  1HNX C;  1IBM C;  2OPL B;  4JI3 C;  3R9X A;  4B3S C;  2DYJ A;  1USP A;  3T1H C;  4DR7 C;  4DV0 C;  3R9W A;  1ZB8 A;  1I94 C;  4NXN C;  4LFB C;  2ZM6 C;  2UXD C;  2UXB C;  4DCS A;  3J81 D;  3EER A;  3I07 A;  1N2F A;  2VQE C;  4KHP C;  4DV2 C;  2BJO A;  1J5E C;  3JAM D;  4JI8 C;  4JI2 C;  4LFC C;  5LMU C;  2XR1 A;  1N36 C;  4DR4 C;  4DV6 C;  1EGA A;  4DUY C;  2D7V A;  4DR5 C;  2EGT A;  1NYE A;  1IBK C;  2E5L C;  4BSZ A;  2PT7 G;  2F4V C;  2HHH C;  2E8F A;  4B3T C;  4NXM C;  4JI5 C;  4MTN A;  4LF4 C;  5A2Q D;  1PA4 A;  1WH9 A;  4LF6 C;  2YCB A;  2UU9 C;  2UXC C;  1N32 C;  4X64 C;  3AF6 A;  2ASB A;  4DV5 C;  1FJG C;  2JMP A;  4AQY C;  1MKY A;  4B3M C;  3CJE A;  4JV5 C;  4XX2 A;  1ZB9 A;  3OTO C;  2ATW A;  4DV3 C;  4JI6 C;  3T1Y C;  1XNQ C;  5IWA C;  2UUC C;  2ONF A;  4JI0 C;  1L2F A;  4DV7 C;  4NOZ A;  4DR1 C;  1N34 C;  3IEU A;  1HNZ C;  2E8E A;  4X62 C;  4YHH C;  2CY1 A;  2E7G A;  3IEV A;  1JOS A;  4X66 C;  5FLX D;  4DCV A;  1UKK A;  5BR8 C;  1IBL C;  5IT9 D;  4LF7 C;  4DR6 C;  4X65 C;  2OPL A;  2UUB C;  1XNR C;  1VLA A;  5LMN C;  1XMQ C;  2UUA C;  4JI1 C;  4DCU A;  4GKJ C; 
#chains in the Genus database with same CATH topology
 4GKK C;  2CU6 A;  4DV1 C;  4TPS B;  2PG1 E;  4DV4 C;  1HNW C;  1K0R A;  4JI4 C;  4BCA A;  4DR3 C;  1AMU A;  4JYA C;  3NYQ A;  2WD9 A;  5T8S A;  3ETO A;  3GR1 A;  1USP B;  2E8C A;  3IML A;  3TR3 A;  2VQF C;  2P2F A;  3A4I A;  4OX9 C;  1HH2 P;  3UX3 A;  3K6R A;  1LQL A;  1HNX C;  1FUG A;  2YX1 A;  4I9F A;  3T1H C;  4PRO C;  2VZE A;  3LGX A;  3R9W A;  4LFB C;  2ZM6 C;  2D1S A;  3J81 D;  5BSM A;  4BC7 A;  5BST A;  3TUF A;  5AE2 A;  3LNV A;  2BJO A;  1O93 A;  3JAM D;  2XR1 A;  5BSW A;  1EGA A;  3L95 X;  3FCC A;  3GR0 A;  4OXI A;  2EGT A;  2M5H A;  3FM7 A;  5BUQ A;  2E5L C;  2E8F A;  4NXM C;  4MTN A;  1P4E A;  3NI2 A;  3A9V A;  3E7X A;  1UWD A;  2UXC C;  3IPL A;  5E7Q A;  4X64 C;  2ASB A;  1FJG C;  2JMP A;  3H2T A;  1M6X C;  2ATW A;  2DPL A;  4D4I A;  1XNQ C;  4FUT A;  2Y4N A;  3LAX A;  2KZ0 A;  2Y27 A;  1MDF A;  4JI0 C;  3IEU A;  2D1Q A;  2E7G A;  3IEV A;  2P2M A;  1O9T A;  1JOS A;  4ODJ A;  3B7W A;  4DCV A;  4LF7 C;  4D56 A;  4DR6 C;  2OPL A;  2UUB C;  1XNR C;  1MXB A;  3UZ0 A;  1PG3 A;  2D28 C;  2PN2 A;  4NDN A;  4K0K C;  4LF9 C;  4G36 A;  1KKG A;  3AY0 A;  3CW8 X;  4YY3 C;  4DCT A;  4GXR A;  4B3R C;  3A9U A;  4DUZ C;  3TQI A;  1XHJ A;  4JI7 C;  4GXQ A;  4LF8 C;  3LUS A;  4LF5 C;  5AE3 A;  4MH4 A;  3EQ6 A;  3UEB A;  3VNS A;  1N33 C;  1QWI A;  2DHM A;  3E7W A;  5JRH A;  2WP0 C;  2OPL B;  3I08 A;  4B3S C;  2DYJ A;  2MMA B;  2ZZM A;  2KDN A;  3R44 A;  4RM3 A;  1ZB8 A;  3LNO A;  4DCS A;  3L8C A;  4PHT A;  3EER A;  4RVO A;  1T5H X;  1N2F A;  1NY8 A;  1WCJ A;  5BSU A;  4DV2 C;  1J5E C;  4JI2 C;  2QVX X;  5LMU C;  1N36 C;  4DV6 C;  2MCQ A;  4DUY C;  4DG9 A;  4DR5 C;  1NYE A;  1BA3 A;  1IBK C;  4G1I A;  3C5E A;  2PT7 G;  2HHH C;  4ZLP A;  2BH1 X;  2ZZN A;  3SO4 A;  4BC9 A;  5A2Q D;  1PA4 A;  3CQ2 A;  1WH9 A;  1LCI A;  3N54 B;  2D1R A;  2JNV A;  3AF6 A;  3PRO C;  1MDB A;  1IB8 A;  3ETC A;  1T5D X;  1MKY A;  4B3M C;  4JV5 C;  2VSQ A;  4JI6 C;  3T1Y C;  5IWA C;  2UUC C;  1O90 A;  4PUH A;  5CZV A;  4LE5 A;  4DV7 C;  5KYV A;  1XRA A;  4IZ6 A;  4L2Z A;  4X62 C;  4KTT A;  1YGT A;  4R0M A;  4I9G A;  5FLX D;  2P2Q A;  1UKK A;  4WV3 A;  4X65 C;  2QW0 X;  4L4Q A;  1XS3 A;  2ZTB A;  1VLA A;  1XMQ C;  2UUA C;  1GPM A;  1RG9 A;  4DCU A;  3DAY A;  2QL8 A;  4R1M A;  2NCL A;  1MXA A;  4DR2 C;  3VNR A;  4IR7 A;  1YJ7 A;  1XMO C;  1P7L A;  5BSR A;  3J7A D;  2D27 A;  4GS5 A;  3J80 D;  4D4G A;  5DV9 A;  3A25 A;  3GKU A;  5H9U A;  4PUI A;  1VEH A;  5IFI A;  2D1T A;  5A19 A;  3RG2 A;  5KEI A;  1IBM C;  3R9X A;  3PES A;  4DV0 C;  4NXN C;  4FUQ A;  1XRC A;  4RM2 A;  3I07 A;  4DR4 C;  2D7V A;  4BSZ A;  5AE1 A;  2F4V C;  4K0B A;  5GTD A;  4B3T C;  2YWB A;  2P20 A;  3UOW A;  3PBK A;  4LF6 C;  3CW9 A;  2YCB A;  3NYR A;  2UU9 C;  1MXC A;  1MD9 A;  1PG4 A;  4AQY C;  5K85 A;  3CJE A;  1V25 A;  3OTO C;  3VNQ A;  2P02 A;  1RY2 A;  1TH5 A;  1L2F A;  4EAT A;  1O92 A;  4NOZ A;  1N34 C;  4R1L A;  2E8E A;  4YHH C;  4KTV A;  1P4E C;  4ZJZ A;  1M6X A;  5A1I A;  4X66 C;  2Z51 A;  4PUG A;  5BR8 C;  1IBL C;  2P2B A;  4BBY A;  4OYC A;  1FLO A;  3N2Q A;  1ULT A;  4DG8 A;  4JI1 C;  5T8T A;  2AYA A;  4GKJ C;  5LCI A;  4U5Y D;  5K8F A;  2CXC A;  4RLQ A;  4RMN A;  1V26 A;  2KZF A;  2PRO A;  3DHV A;  5CZX A;  3DLP X;  3AF5 A;  4LFA C;  1ML8 A;  1WF3 A;  5KYT A;  1HR0 C;  5ADZ A;  2HJG A;  2YWC A;  2Y4O A;  4JI3 C;  3O2E A;  1USP A;  4DR7 C;  1QM4 A;  1I94 C;  2UXD C;  2UXB C;  5BUS A;  2QVY X;  3TDE A;  4RVN A;  5A1G A;  3CQ3 A;  2VQE C;  4KHP C;  4LFC C;  4JI8 C;  4D57 A;  2QVZ X;  4HPV A;  3FCE A;  2OO4 A;  1XDX A;  3GPC A;  4JI5 C;  4LF4 C;  4JM1 A;  4G37 A;  4WS9 A;  3KXW A;  4RLF A;  2M5O A;  3A26 A;  1XRB A;  3G7S A;  1N32 C;  4DV5 C;  5BUR A;  3S82 A;  2OBV A;  5BSV A;  4XX2 A;  1ZB9 A;  2P2J A;  4DV3 C;  3NPD A;  2ONF A;  2V7B A;  4DR1 C;  3RV2 A;  4FTF A;  1HNZ C;  2CY1 A;  1PU1 A;  2MM9 A;  5IT9 D;  4L7I A;  3UX2 A;  4ISB A;  3CQ1 A;  5LMN C;  4PZP A;  1V60 A;  2E0G A; 
#chains in the Genus database with same CATH homology
 4GKK C;  4DV1 C;  4TPS B;  4DV4 C;  1HNW C;  1K0R A;  4JI4 C;  4BCA A;  4DR3 C;  1AMU A;  4JYA C;  3NYQ A;  2WD9 A;  5T8S A;  3ETO A;  3GR1 A;  1USP B;  2E8C A;  3IML A;  2VQF C;  2P2F A;  3A4I A;  4OX9 C;  1HH2 P;  1LQL A;  1HNX C;  1FUG A;  4I9F A;  3T1H C;  4PRO C;  2VZE A;  3LGX A;  3R9W A;  4LFB C;  2ZM6 C;  2D1S A;  3J81 D;  5BSM A;  4BC7 A;  5BST A;  3TUF A;  5AE2 A;  3LNV A;  2BJO A;  1O93 A;  3JAM D;  2XR1 A;  5BSW A;  1EGA A;  3L95 X;  3FCC A;  3GR0 A;  4OXI A;  2EGT A;  5BUQ A;  2E5L C;  2E8F A;  4NXM C;  4MTN A;  3NI2 A;  3A9V A;  3E7X A;  2UXC C;  3IPL A;  5E7Q A;  4X64 C;  2ASB A;  1FJG C;  2JMP A;  3H2T A;  2ATW A;  2DPL A;  4D4I A;  1XNQ C;  4FUT A;  2Y4N A;  3LAX A;  2Y27 A;  1MDF A;  4JI0 C;  3IEU A;  2D1Q A;  2E7G A;  3IEV A;  2P2M A;  1O9T A;  1JOS A;  4ODJ A;  3B7W A;  4DCV A;  4LF7 C;  4D56 A;  4DR6 C;  2OPL A;  2UUB C;  1XNR C;  1MXB A;  3UZ0 A;  1PG3 A;  2D28 C;  2PN2 A;  4NDN A;  4K0K C;  4LF9 C;  4G36 A;  1KKG A;  3CW8 X;  4YY3 C;  4DCT A;  4GXR A;  4B3R C;  3A9U A;  4DUZ C;  3TQI A;  4JI7 C;  4GXQ A;  4LF8 C;  3LUS A;  4LF5 C;  5AE3 A;  4MH4 A;  3EQ6 A;  3VNS A;  1N33 C;  1QWI A;  3E7W A;  5JRH A;  2WP0 C;  2OPL B;  3I08 A;  4B3S C;  2DYJ A;  3R44 A;  4RM3 A;  1ZB8 A;  4DCS A;  3L8C A;  4PHT A;  3EER A;  4RVO A;  1T5H X;  1N2F A;  5BSU A;  4DV2 C;  1J5E C;  4JI2 C;  2QVX X;  5LMU C;  1N36 C;  4DV6 C;  4DUY C;  4DG9 A;  4DR5 C;  1NYE A;  1BA3 A;  1IBK C;  4G1I A;  3C5E A;  2PT7 G;  2HHH C;  4ZLP A;  2BH1 X;  3SO4 A;  4BC9 A;  5A2Q D;  1PA4 A;  1WH9 A;  1LCI A;  3N54 B;  2D1R A;  3AF6 A;  3PRO C;  1MDB A;  3ETC A;  1T5D X;  1MKY A;  4B3M C;  4JV5 C;  2VSQ A;  4JI6 C;  3T1Y C;  5IWA C;  2UUC C;  1O90 A;  5CZV A;  4LE5 A;  4DV7 C;  5KYV A;  1XRA A;  4IZ6 A;  4L2Z A;  4X62 C;  4KTT A;  4R0M A;  4I9G A;  5FLX D;  2P2Q A;  1UKK A;  4WV3 A;  4X65 C;  2QW0 X;  4L4Q A;  1VLA A;  1XMQ C;  2UUA C;  1GPM A;  1RG9 A;  4DCU A;  3DAY A;  2QL8 A;  4R1M A;  1MXA A;  4DR2 C;  3VNR A;  4IR7 A;  1YJ7 A;  1XMO C;  1P7L A;  5BSR A;  3J7A D;  2D27 A;  4GS5 A;  3J80 D;  4D4G A;  5DV9 A;  3GKU A;  5H9U A;  5IFI A;  2D1T A;  5A19 A;  3RG2 A;  5KEI A;  1IBM C;  3R9X A;  3PES A;  4DV0 C;  4NXN C;  4FUQ A;  1XRC A;  4RM2 A;  3I07 A;  4DR4 C;  2D7V A;  4BSZ A;  5AE1 A;  2F4V C;  4K0B A;  5GTD A;  4B3T C;  2YWB A;  2P20 A;  3UOW A;  3PBK A;  4LF6 C;  3CW9 A;  2YCB A;  3NYR A;  2UU9 C;  1MXC A;  1MD9 A;  1PG4 A;  4AQY C;  5K85 A;  3CJE A;  1V25 A;  3OTO C;  3VNQ A;  2P02 A;  1RY2 A;  1L2F A;  4EAT A;  1O92 A;  4NOZ A;  1N34 C;  4R1L A;  2E8E A;  4YHH C;  4KTV A;  4ZJZ A;  5A1I A;  4X66 C;  5BR8 C;  1IBL C;  2P2B A;  4BBY A;  4OYC A;  3N2Q A;  1ULT A;  4DG8 A;  4JI1 C;  5T8T A;  2AYA A;  4GKJ C;  4U5Y D;  5K8F A;  2CXC A;  4RLQ A;  4RMN A;  1V26 A;  2KZF A;  2PRO A;  3DHV A;  5CZX A;  3DLP X;  3AF5 A;  4LFA C;  1ML8 A;  1WF3 A;  5KYT A;  1HR0 C;  5ADZ A;  2HJG A;  2YWC A;  2Y4O A;  4JI3 C;  1USP A;  4DR7 C;  1QM4 A;  1I94 C;  2UXD C;  2UXB C;  5BUS A;  2QVY X;  3TDE A;  4RVN A;  5A1G A;  2VQE C;  4KHP C;  4LFC C;  4JI8 C;  4D57 A;  2QVZ X;  4HPV A;  3FCE A;  2OO4 A;  3GPC A;  4JI5 C;  4LF4 C;  4JM1 A;  4G37 A;  4WS9 A;  3KXW A;  4RLF A;  1XRB A;  3G7S A;  1N32 C;  4DV5 C;  5BUR A;  3S82 A;  2OBV A;  5BSV A;  4XX2 A;  1ZB9 A;  2P2J A;  4DV3 C;  3NPD A;  2ONF A;  2V7B A;  4DR1 C;  3RV2 A;  4FTF A;  1HNZ C;  2CY1 A;  5IT9 D;  4L7I A;  4ISB A;  5LMN C;  4PZP A;  2E0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...