4DV6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv6C02
5BR8C 1WF3A 4DV1C 1ZB9A 3OTOC 1ZB8A 2ASBA 2E5LC 4X65C 1XNRC 4LF5C 2ZM6C 2XR1A 4DCTA 1HR0C 4DR6C 3J81D 1IBLC 3AF6A 4DR5C 2EGTA 4YY3C 3IEUA 3J7AD 1USPA 2UU9C 4JI8C 1ML8A 2OPLA 1FJGC 4GKKC 1WH9A 2E8CA 1L2FA 2CXCA 4X62C 4DUZC 2VQFC 4AQYC 1XNQC 1USPB 5A2QD 3GKUA 4DV6C 2UXBC 4LFAC 4B3TC 4DV7C 3EERA 4DCVA 3I07A 4NXNC 1EGAA 1UKKA 4JI5C 3CJEA 2D7VA 4B3RC 2KZFA 3R9WA 4JV5C 4K0KC 2UXDC 2PN2A 3R9XA 4LF9C 4GKJC 5FLXD 1NYEA 2DYJA 4MH4A 4MTNA 2BJOA 4DR1C 4DV3C 1VLAA 4B3MC 1IBKC 3T1HC 4JI4C 1J5EC 4DR4C 4JYAC 2E7GA 4NOZA 5LMUC 2HJGA 1N32C 3T1YC 4DUYC 4YHHC 4JI7C 2QL8A 4NXMC 1MKYA 1HNWC 1JOSA 4DCSA 2UUAC 4JI2C 5IWAC 4LF6C 2CY1A 4LF7C 4KHPC 3J80D 1KKGA 4X66C 1N33C 3LUSA 2UUCC 2PT7G 1I94C 4JI1C 1XMOC 2HHHC 5LMNC 4JI3C 4LFCC 4DR7C 1QWIA 2ONFA 2YCBA 4JI0C 2JMPA 4LF8C 4BSZA 4DV2C 4JI6C 1N2FA 4XX2A 1LQLA 2ATWA 1HNZC 1PA4A 2F4VC 4DV5C 3AF5A 2VQEC 4OX9C 4X64C 1HH2P 3IEVA 1N34C 1XMQC 4LFBC 3JAMD 1N36C 1IBMC 2E8EA 4DR2C 4DV0C 4B3SC 2UUBC 1K0RA 4DV4C 2E8FA 5IT9D 4DR3C 4LF4C 1HNXC 4DCUA 2UXCC 2OPLB
chains in the Genus database with same CATH superfamily
5A1IA 4BC9A 3IMLA 4L2ZA 3RV2A 3TQIA 3NI2A 4X65C 3S82A 2QVXX 4DR6C 3J81D 2EGTA 3IEUA 4IR7A 4RMNA 5K8FA 2Y27A 4ISBA 1WH9A 2DPLA 2D27A 4AQYC 2D1TA 5A2QD 5GTDA 2P2FA 4B3TC 2M5HA 4R0MA 3EERA 5T8TA 3SO4A 1EGAA 5BSMA 2CU6A 3I08A 2UXDC 2PN2A 4GKJC 4RVOA 5FLXD 1NYEA 3LNOA 2JNVA 4DR1C 2QW0X 3O2EA 5AE2A 3GR0A 3T1HC 1J5EC 5BSWA 2P2QA 5CZXA 2E7GA 4NOZA 3AY0A 3FCEA 1LCIA 4YHHC 3UZ0A 4KTTA 1HNWC 4DCSA 4JI2C 3J80D 2WD9A 3A9VA 2PT7G 3N2QA 3E7XA 2BH1X 1MXAA 1GPMA 2QVYX 4ZJZA 5E7QA 2ONFA 2YCBA 2PROA 3E7WA 4K0BA 4XX2A 1LQLA 5K85A 4PUIA 2P2MA 1IBMC 2UUBC 4DV4C 2E8FA 1HNXC 4DCUA 2OPLB 5BR8C 4DG8A 4GXQA 1WF3A 3EQ6A 4DV1C 3A4IA 5ADZA 4PUHA 4D56A 4RM2A 4WV3A 2ASBA 4FTFA 1FLOA 3G7SA 2ZM6C 3IPLA 1HR0C 4KTVA 4DR5C 4YY3C 4OYCA 2UU9C 2OPLA 3DLPX 3B7WA 2E8CA 2V7BA 1O90A 3VNQA 4L4QA 3H2TA 1XNQC 5H9UA 3K6RA 4DV6C 5IFIA 4RLFA 4D4GA 3I07A 4NXNC 1UKKA 2D7VA 2KDNA 4D57A 3R9WA 4JV5C 1BA3A 1XRCA 2DYJA 2P2BA 1NY8A 1VEHA 4RVNA 5LCIA 1PG3A 1IBKC 2M5OA 5BSRA 4JYAC 1N32C 3T1YC 2VSQA 3UX2A 2QL8A 5A1GA 1JOSA 4DG9A 5IWAC 2YWCA 5KYVA 3NYQA 1PU1A 1T5HX 4JI1C 1XMOC 1M6XC 4LFCC 4TPSB 4WS9A 1T5DX 4LF8C 3UX3A 1V26A 4G1IA 4JI6C 5AE3A 3GR1A 3NYRA 2ZZNA 3LGXA 4ODJA 2P02A 1RG9A 1M6XA 2VQEC 2D1SA 4X64C 1V25A 1P7LA 3IEVA 4OXIA 3DAYA 4ZLPA 2PG1E 2E8EA 2WP0C 4PUGA 1IB8A 1MDFA 5IT9D 4LF4C 2Y4OA 4DR3C 4RM3A 5KYTA 4PROC 4GS5A 1ZB9A 3OTOC 1ZB8A 1XS3A 2E5LC 3FCCA 1IBLC 4NDNA 3CW8X 4RLQA 3L8CA 5CZVA 1USPA 1FJGC 2MMAB 4GKKC 3LAXA 4L7IA 3ETOA 4X62C 4DUZC 3A25A 1UWDA 4G37A 4LFAC 4LE5A 4DCVA 4I9GA 5BSUA 5BUSA 3PBKA 1MD9A 3FM7A 2D1QA 4JI5C 3A26A 3CJEA 1ULTA 4BC7A 3VNRA 4FUTA 3N54B 3R9XA 4LF9C 2QVZX 4MH4A 2BJOA 2OBVA 5BURA 4B3MC 4IZ6A 2MM9A 3CW9A 4DR4C 4U5YD 5LMUC 2HJGA 2YWBA 4PHTA 2E0GA 3NPDA 1TH5A 3L95X 1YGTA 1QM4A 1V60A 3KXWA 3LNVA 2CY1A 4LF7C 4KHPC 4X66C 1N33C 4D4IA 5LMNC 4JI3C 4DR7C 2AYAA 4JI0C 4DV2C 1XDXA 3TUFA 1XRBA 1FUGA 1N2FA 3PROC 1O9TA 1PA4A 5T8SA 3UEBA 3AF5A 4OX9C 1HH2P 1N34C 1XMQC 1RY2A 3UOWA 4DV0C 2VZEA 4B3SC 1K0RA 4FUQA 3GPCA 2KZ0A 1WCJA 5BUQA 1AMUA 4G36A 1PG4A 4BCAA 1XNRC 4LF5C 3PESA 2XR1A 4DCTA 3AF6A 3J7AD 4JI8C 1ML8A 1L2FA 1O93A 2CXCA 2VQFC 3C5EA 1USPB 3GKUA 1MXCA 2P20A 3VNSA 2UXBC 2DHMA 4DV7C 1YJ7A 2P2JA 2D28C 2NCLA 2D1RA 4B3RC 2KZFA 4K0KC 2Y4NA 4GXRA 2YX1A 3DHVA 4PZPA 4MTNA 1MXBA 4DV3C 1VLAA 1O92A 1MDBA 5A19A 4JI4C 4HPVA 4DUYC 3RG2A 4R1MA 3TR3A 3ETCA 4NXMC 1MKYA 3A9UA 4BBYA 2UUAC 2MCQA 2OO4A 4LF6C 1KKGA 3LUSA 2UUCC 1I94C 2HHHC 3TDEA 5DV9A 3R44A 4JM1A 1QWIA 2JMPA 4BSZA 5BSTA 2Z51A 3CQ3A 4R1LA 5JRHA 1P4EC 4I9FA 2ATWA 1HNZC 2F4VC 4DV5C 3CQ2A 1XHJA 4LFBC 3CQ1A 3JAMD 1N36C 2ZZMA 1XRAA 4EATA 5BSVA 4DR2C 1P4EA 2UXCC 5KEIA 2ZTBA 4JI7C 5AE1A
chains in the Genus database with same CATH topology
5A1IA 4BC9A 3IMLA 4L2ZA 3RV2A 3TQIA 3NI2A 4X65C 3S82A 2QVXX 4DR6C 3J81D 2EGTA 3IEUA 4IR7A 4RMNA 5K8FA 2Y27A 4ISBA 1WH9A 2DPLA 2D27A 4AQYC 2D1TA 5A2QD 5GTDA 2P2FA 4B3TC 4R0MA 3EERA 5T8TA 3SO4A 1EGAA 5BSMA 3I08A 2UXDC 2PN2A 4GKJC 4RVOA 5FLXD 1NYEA 4DR1C 2QW0X 5AE2A 3GR0A 3T1HC 1J5EC 5BSWA 2P2QA 5CZXA 2E7GA 4NOZA 3FCEA 1LCIA 4YHHC 3UZ0A 4KTTA 1HNWC 4DCSA 4JI2C 3J80D 2WD9A 3A9VA 2PT7G 3N2QA 3E7XA 2BH1X 1MXAA 1GPMA 2QVYX 4ZJZA 5E7QA 2ONFA 2YCBA 2PROA 3E7WA 4K0BA 4XX2A 1LQLA 5K85A 2P2MA 1IBMC 2UUBC 4DV4C 2E8FA 1HNXC 4DCUA 2OPLB 5BR8C 4DG8A 4GXQA 1WF3A 3EQ6A 4DV1C 3A4IA 5ADZA 4D56A 4RM2A 4WV3A 2ASBA 4FTFA 3G7SA 2ZM6C 3IPLA 1HR0C 4KTVA 4DR5C 4YY3C 4OYCA 2UU9C 2OPLA 3DLPX 3B7WA 2E8CA 2V7BA 1O90A 3VNQA 4L4QA 3H2TA 1XNQC 5H9UA 4DV6C 5IFIA 4RLFA 4D4GA 3I07A 4NXNC 1UKKA 2D7VA 4D57A 3R9WA 4JV5C 1BA3A 1XRCA 2DYJA 2P2BA 4RVNA 1PG3A 1IBKC 5BSRA 4JYAC 1N32C 3T1YC 2VSQA 2QL8A 5A1GA 1JOSA 4DG9A 5IWAC 2YWCA 5KYVA 3NYQA 1T5HX 4JI1C 1XMOC 4LFCC 4TPSB 4WS9A 1T5DX 4LF8C 1V26A 4G1IA 4JI6C 5AE3A 3GR1A 3NYRA 3LGXA 4ODJA 2P02A 1RG9A 2VQEC 2D1SA 4X64C 1V25A 1P7LA 3IEVA 4OXIA 3DAYA 4ZLPA 2E8EA 2WP0C 1MDFA 5IT9D 4LF4C 2Y4OA 4DR3C 4RM3A 5KYTA 4PROC 4GS5A 1ZB9A 3OTOC 1ZB8A 2E5LC 3FCCA 1IBLC 4NDNA 3CW8X 4RLQA 3L8CA 5CZVA 1USPA 1FJGC 4GKKC 3LAXA 4L7IA 3ETOA 4X62C 4DUZC 4G37A 4LFAC 4LE5A 4DCVA 4I9GA 5BSUA 5BUSA 3PBKA 1MD9A 2D1QA 4JI5C 3CJEA 1ULTA 4BC7A 3VNRA 4FUTA 3N54B 3R9XA 4LF9C 2QVZX 4MH4A 2BJOA 2OBVA 5BURA 4B3MC 4IZ6A 3CW9A 4DR4C 4U5YD 5LMUC 2HJGA 2YWBA 4PHTA 2E0GA 3NPDA 3L95X 1QM4A 3KXWA 3LNVA 2CY1A 4LF7C 4KHPC 4X66C 1N33C 4D4IA 5LMNC 4JI3C 4DR7C 2AYAA 4JI0C 4DV2C 3TUFA 1XRBA 1FUGA 1N2FA 3PROC 1O9TA 1PA4A 5T8SA 3AF5A 4OX9C 1HH2P 1N34C 1XMQC 1RY2A 3UOWA 4DV0C 2VZEA 4B3SC 1K0RA 4FUQA 3GPCA 5BUQA 1AMUA 4G36A 1PG4A 4BCAA 1XNRC 4LF5C 3PESA 2XR1A 4DCTA 3AF6A 3J7AD 4JI8C 1ML8A 1L2FA 1O93A 2CXCA 2VQFC 3C5EA 1USPB 3GKUA 1MXCA 2P20A 3VNSA 2UXBC 4DV7C 1YJ7A 2P2JA 2D28C 2D1RA 4B3RC 2KZFA 4K0KC 2Y4NA 4GXRA 3DHVA 4PZPA 4MTNA 1MXBA 4DV3C 1VLAA 1O92A 1MDBA 5A19A 4JI4C 4HPVA 4DUYC 3RG2A 4R1MA 3ETCA 4NXMC 1MKYA 3A9UA 4BBYA 2UUAC 4LF6C 2OO4A 1KKGA 3LUSA 2UUCC 1I94C 2HHHC 3TDEA 5DV9A 3R44A 4JM1A 1QWIA 2JMPA 4BSZA 5BSTA 4R1LA 5JRHA 4I9FA 2ATWA 1HNZC 2F4VC 4DV5C 4LFBC 3JAMD 1N36C 1XRAA 4EATA 5BSVA 4DR2C 2UXCC 5KEIA 4JI7C 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 C;  1WF3 A;  4DV1 C;  1ZB9 A;  3OTO C;  1ZB8 A;  2ASB A;  2E5L C;  4X65 C;  1XNR C;  4LF5 C;  2ZM6 C;  2XR1 A;  4DCT A;  1HR0 C;  4DR6 C;  3J81 D;  1IBL C;  3AF6 A;  4DR5 C;  2EGT A;  4YY3 C;  3IEU A;  3J7A D;  1USP A;  2UU9 C;  4JI8 C;  1ML8 A;  2OPL A;  1FJG C;  4GKK C;  1WH9 A;  2E8C A;  1L2F A;  2CXC A;  4X62 C;  4DUZ C;  2VQF C;  4AQY C;  1XNQ C;  1USP B;  5A2Q D;  3GKU A;  4DV6 C;  2UXB C;  4LFA C;  4B3T C;  4DV7 C;  3EER A;  4DCV A;  3I07 A;  4NXN C;  1EGA A;  1UKK A;  4JI5 C;  3CJE A;  2D7V A;  4B3R C;  2KZF A;  3R9W A;  4JV5 C;  4K0K C;  2UXD C;  2PN2 A;  3R9X A;  4LF9 C;  4GKJ C;  5FLX D;  1NYE A;  2DYJ A;  4MH4 A;  4MTN A;  2BJO A;  4DR1 C;  4DV3 C;  1VLA A;  4B3M C;  1IBK C;  3T1H C;  4JI4 C;  1J5E C;  4DR4 C;  4JYA C;  2E7G A;  4NOZ A;  5LMU C;  2HJG A;  1N32 C;  3T1Y C;  4DUY C;  4YHH C;  4JI7 C;  2QL8 A;  4NXM C;  1MKY A;  1HNW C;  1JOS A;  4DCS A;  2UUA C;  4JI2 C;  5IWA C;  4LF6 C;  2CY1 A;  4LF7 C;  4KHP C;  3J80 D;  1KKG A;  4X66 C;  1N33 C;  3LUS A;  2UUC C;  2PT7 G;  1I94 C;  4JI1 C;  1XMO C;  2HHH C;  5LMN C;  4JI3 C;  4LFC C;  4DR7 C;  1QWI A;  2ONF A;  2YCB A;  4JI0 C;  2JMP A;  4LF8 C;  4BSZ A;  4DV2 C;  4JI6 C;  1N2F A;  4XX2 A;  1LQL A;  2ATW A;  1HNZ C;  1PA4 A;  2F4V C;  4DV5 C;  3AF5 A;  2VQE C;  4OX9 C;  4X64 C;  1HH2 P;  3IEV A;  1N34 C;  1XMQ C;  4LFB C;  3JAM D;  1N36 C;  1IBM C;  2E8E A;  4DR2 C;  4DV0 C;  4B3S C;  2UUB C;  1K0R A;  4DV4 C;  2E8F A;  5IT9 D;  4DR3 C;  4LF4 C;  1HNX C;  4DCU A;  2UXC C;  2OPL B; 
#chains in the Genus database with same CATH topology
 5A1I A;  4BC9 A;  3IML A;  4L2Z A;  3RV2 A;  3TQI A;  3NI2 A;  4X65 C;  3S82 A;  2QVX X;  4DR6 C;  3J81 D;  2EGT A;  3IEU A;  4IR7 A;  4RMN A;  5K8F A;  2Y27 A;  4ISB A;  1WH9 A;  2DPL A;  2D27 A;  4AQY C;  2D1T A;  5A2Q D;  5GTD A;  2P2F A;  4B3T C;  2M5H A;  4R0M A;  3EER A;  5T8T A;  3SO4 A;  1EGA A;  5BSM A;  2CU6 A;  3I08 A;  2UXD C;  2PN2 A;  4GKJ C;  4RVO A;  5FLX D;  1NYE A;  3LNO A;  2JNV A;  4DR1 C;  2QW0 X;  3O2E A;  5AE2 A;  3GR0 A;  3T1H C;  1J5E C;  5BSW A;  2P2Q A;  5CZX A;  2E7G A;  4NOZ A;  3AY0 A;  3FCE A;  1LCI A;  4YHH C;  3UZ0 A;  4KTT A;  1HNW C;  4DCS A;  4JI2 C;  3J80 D;  2WD9 A;  3A9V A;  2PT7 G;  3N2Q A;  3E7X A;  2BH1 X;  1MXA A;  1GPM A;  2QVY X;  4ZJZ A;  5E7Q A;  2ONF A;  2YCB A;  2PRO A;  3E7W A;  4K0B A;  4XX2 A;  1LQL A;  5K85 A;  4PUI A;  2P2M A;  1IBM C;  2UUB C;  4DV4 C;  2E8F A;  1HNX C;  4DCU A;  2OPL B;  5BR8 C;  4DG8 A;  4GXQ A;  1WF3 A;  3EQ6 A;  4DV1 C;  3A4I A;  5ADZ A;  4PUH A;  4D56 A;  4RM2 A;  4WV3 A;  2ASB A;  4FTF A;  1FLO A;  3G7S A;  2ZM6 C;  3IPL A;  1HR0 C;  4KTV A;  4DR5 C;  4YY3 C;  4OYC A;  2UU9 C;  2OPL A;  3DLP X;  3B7W A;  2E8C A;  2V7B A;  1O90 A;  3VNQ A;  4L4Q A;  3H2T A;  1XNQ C;  5H9U A;  3K6R A;  4DV6 C;  5IFI A;  4RLF A;  4D4G A;  3I07 A;  4NXN C;  1UKK A;  2D7V A;  2KDN A;  4D57 A;  3R9W A;  4JV5 C;  1BA3 A;  1XRC A;  2DYJ A;  2P2B A;  1NY8 A;  1VEH A;  4RVN A;  5LCI A;  1PG3 A;  1IBK C;  2M5O A;  5BSR A;  4JYA C;  1N32 C;  3T1Y C;  2VSQ A;  3UX2 A;  2QL8 A;  5A1G A;  1JOS A;  4DG9 A;  5IWA C;  2YWC A;  5KYV A;  3NYQ A;  1PU1 A;  1T5H X;  4JI1 C;  1XMO C;  1M6X C;  4LFC C;  4TPS B;  4WS9 A;  1T5D X;  4LF8 C;  3UX3 A;  1V26 A;  4G1I A;  4JI6 C;  5AE3 A;  3GR1 A;  3NYR A;  2ZZN A;  3LGX A;  4ODJ A;  2P02 A;  1RG9 A;  1M6X A;  2VQE C;  2D1S A;  4X64 C;  1V25 A;  1P7L A;  3IEV A;  4OXI A;  3DAY A;  4ZLP A;  2PG1 E;  2E8E A;  2WP0 C;  4PUG A;  1IB8 A;  1MDF A;  5IT9 D;  4LF4 C;  2Y4O A;  4DR3 C;  4RM3 A;  5KYT A;  4PRO C;  4GS5 A;  1ZB9 A;  3OTO C;  1ZB8 A;  1XS3 A;  2E5L C;  3FCC A;  1IBL C;  4NDN A;  3CW8 X;  4RLQ A;  3L8C A;  5CZV A;  1USP A;  1FJG C;  2MMA B;  4GKK C;  3LAX A;  4L7I A;  3ETO A;  4X62 C;  4DUZ C;  3A25 A;  1UWD A;  4G37 A;  4LFA C;  4LE5 A;  4DCV A;  4I9G A;  5BSU A;  5BUS A;  3PBK A;  1MD9 A;  3FM7 A;  2D1Q A;  4JI5 C;  3A26 A;  3CJE A;  1ULT A;  4BC7 A;  3VNR A;  4FUT A;  3N54 B;  3R9X A;  4LF9 C;  2QVZ X;  4MH4 A;  2BJO A;  2OBV A;  5BUR A;  4B3M C;  4IZ6 A;  2MM9 A;  3CW9 A;  4DR4 C;  4U5Y D;  5LMU C;  2HJG A;  2YWB A;  4PHT A;  2E0G A;  3NPD A;  1TH5 A;  3L95 X;  1YGT A;  1QM4 A;  1V60 A;  3KXW A;  3LNV A;  2CY1 A;  4LF7 C;  4KHP C;  4X66 C;  1N33 C;  4D4I A;  5LMN C;  4JI3 C;  4DR7 C;  2AYA A;  4JI0 C;  4DV2 C;  1XDX A;  3TUF A;  1XRB A;  1FUG A;  1N2F A;  3PRO C;  1O9T A;  1PA4 A;  5T8S A;  3UEB A;  3AF5 A;  4OX9 C;  1HH2 P;  1N34 C;  1XMQ C;  1RY2 A;  3UOW A;  4DV0 C;  2VZE A;  4B3S C;  1K0R A;  4FUQ A;  3GPC A;  2KZ0 A;  1WCJ A;  5BUQ A;  1AMU A;  4G36 A;  1PG4 A;  4BCA A;  1XNR C;  4LF5 C;  3PES A;  2XR1 A;  4DCT A;  3AF6 A;  3J7A D;  4JI8 C;  1ML8 A;  1L2F A;  1O93 A;  2CXC A;  2VQF C;  3C5E A;  1USP B;  3GKU A;  1MXC A;  2P20 A;  3VNS A;  2UXB C;  2DHM A;  4DV7 C;  1YJ7 A;  2P2J A;  2D28 C;  2NCL A;  2D1R A;  4B3R C;  2KZF A;  4K0K C;  2Y4N A;  4GXR A;  2YX1 A;  3DHV A;  4PZP A;  4MTN A;  1MXB A;  4DV3 C;  1VLA A;  1O92 A;  1MDB A;  5A19 A;  4JI4 C;  4HPV A;  4DUY C;  3RG2 A;  4R1M A;  3TR3 A;  3ETC A;  4NXM C;  1MKY A;  3A9U A;  4BBY A;  2UUA C;  2MCQ A;  2OO4 A;  4LF6 C;  1KKG A;  3LUS A;  2UUC C;  1I94 C;  2HHH C;  3TDE A;  5DV9 A;  3R44 A;  4JM1 A;  1QWI A;  2JMP A;  4BSZ A;  5BST A;  2Z51 A;  3CQ3 A;  4R1L A;  5JRH A;  1P4E C;  4I9F A;  2ATW A;  1HNZ C;  2F4V C;  4DV5 C;  3CQ2 A;  1XHJ A;  4LFB C;  3CQ1 A;  3JAM D;  1N36 C;  2ZZM A;  1XRA A;  4EAT A;  5BSV A;  4DR2 C;  1P4E A;  2UXC C;  5KEI A;  2ZTB A;  4JI7 C;  5AE1 A; 
#chains in the Genus database with same CATH homology
 5A1I A;  4BC9 A;  3IML A;  4L2Z A;  3RV2 A;  3TQI A;  3NI2 A;  4X65 C;  3S82 A;  2QVX X;  4DR6 C;  3J81 D;  2EGT A;  3IEU A;  4IR7 A;  4RMN A;  5K8F A;  2Y27 A;  4ISB A;  1WH9 A;  2DPL A;  2D27 A;  4AQY C;  2D1T A;  5A2Q D;  5GTD A;  2P2F A;  4B3T C;  4R0M A;  3EER A;  5T8T A;  3SO4 A;  1EGA A;  5BSM A;  3I08 A;  2UXD C;  2PN2 A;  4GKJ C;  4RVO A;  5FLX D;  1NYE A;  4DR1 C;  2QW0 X;  5AE2 A;  3GR0 A;  3T1H C;  1J5E C;  5BSW A;  2P2Q A;  5CZX A;  2E7G A;  4NOZ A;  3FCE A;  1LCI A;  4YHH C;  3UZ0 A;  4KTT A;  1HNW C;  4DCS A;  4JI2 C;  3J80 D;  2WD9 A;  3A9V A;  2PT7 G;  3N2Q A;  3E7X A;  2BH1 X;  1MXA A;  1GPM A;  2QVY X;  4ZJZ A;  5E7Q A;  2ONF A;  2YCB A;  2PRO A;  3E7W A;  4K0B A;  4XX2 A;  1LQL A;  5K85 A;  2P2M A;  1IBM C;  2UUB C;  4DV4 C;  2E8F A;  1HNX C;  4DCU A;  2OPL B;  5BR8 C;  4DG8 A;  4GXQ A;  1WF3 A;  3EQ6 A;  4DV1 C;  3A4I A;  5ADZ A;  4D56 A;  4RM2 A;  4WV3 A;  2ASB A;  4FTF A;  3G7S A;  2ZM6 C;  3IPL A;  1HR0 C;  4KTV A;  4DR5 C;  4YY3 C;  4OYC A;  2UU9 C;  2OPL A;  3DLP X;  3B7W A;  2E8C A;  2V7B A;  1O90 A;  3VNQ A;  4L4Q A;  3H2T A;  1XNQ C;  5H9U A;  4DV6 C;  5IFI A;  4RLF A;  4D4G A;  3I07 A;  4NXN C;  1UKK A;  2D7V A;  4D57 A;  3R9W A;  4JV5 C;  1BA3 A;  1XRC A;  2DYJ A;  2P2B A;  4RVN A;  1PG3 A;  1IBK C;  5BSR A;  4JYA C;  1N32 C;  3T1Y C;  2VSQ A;  2QL8 A;  5A1G A;  1JOS A;  4DG9 A;  5IWA C;  2YWC A;  5KYV A;  3NYQ A;  1T5H X;  4JI1 C;  1XMO C;  4LFC C;  4TPS B;  4WS9 A;  1T5D X;  4LF8 C;  1V26 A;  4G1I A;  4JI6 C;  5AE3 A;  3GR1 A;  3NYR A;  3LGX A;  4ODJ A;  2P02 A;  1RG9 A;  2VQE C;  2D1S A;  4X64 C;  1V25 A;  1P7L A;  3IEV A;  4OXI A;  3DAY A;  4ZLP A;  2E8E A;  2WP0 C;  1MDF A;  5IT9 D;  4LF4 C;  2Y4O A;  4DR3 C;  4RM3 A;  5KYT A;  4PRO C;  4GS5 A;  1ZB9 A;  3OTO C;  1ZB8 A;  2E5L C;  3FCC A;  1IBL C;  4NDN A;  3CW8 X;  4RLQ A;  3L8C A;  5CZV A;  1USP A;  1FJG C;  4GKK C;  3LAX A;  4L7I A;  3ETO A;  4X62 C;  4DUZ C;  4G37 A;  4LFA C;  4LE5 A;  4DCV A;  4I9G A;  5BSU A;  5BUS A;  3PBK A;  1MD9 A;  2D1Q A;  4JI5 C;  3CJE A;  1ULT A;  4BC7 A;  3VNR A;  4FUT A;  3N54 B;  3R9X A;  4LF9 C;  2QVZ X;  4MH4 A;  2BJO A;  2OBV A;  5BUR A;  4B3M C;  4IZ6 A;  3CW9 A;  4DR4 C;  4U5Y D;  5LMU C;  2HJG A;  2YWB A;  4PHT A;  2E0G A;  3NPD A;  3L95 X;  1QM4 A;  3KXW A;  3LNV A;  2CY1 A;  4LF7 C;  4KHP C;  4X66 C;  1N33 C;  4D4I A;  5LMN C;  4JI3 C;  4DR7 C;  2AYA A;  4JI0 C;  4DV2 C;  3TUF A;  1XRB A;  1FUG A;  1N2F A;  3PRO C;  1O9T A;  1PA4 A;  5T8S A;  3AF5 A;  4OX9 C;  1HH2 P;  1N34 C;  1XMQ C;  1RY2 A;  3UOW A;  4DV0 C;  2VZE A;  4B3S C;  1K0R A;  4FUQ A;  3GPC A;  5BUQ A;  1AMU A;  4G36 A;  1PG4 A;  4BCA A;  1XNR C;  4LF5 C;  3PES A;  2XR1 A;  4DCT A;  3AF6 A;  3J7A D;  4JI8 C;  1ML8 A;  1L2F A;  1O93 A;  2CXC A;  2VQF C;  3C5E A;  1USP B;  3GKU A;  1MXC A;  2P20 A;  3VNS A;  2UXB C;  4DV7 C;  1YJ7 A;  2P2J A;  2D28 C;  2D1R A;  4B3R C;  2KZF A;  4K0K C;  2Y4N A;  4GXR A;  3DHV A;  4PZP A;  4MTN A;  1MXB A;  4DV3 C;  1VLA A;  1O92 A;  1MDB A;  5A19 A;  4JI4 C;  4HPV A;  4DUY C;  3RG2 A;  4R1M A;  3ETC A;  4NXM C;  1MKY A;  3A9U A;  4BBY A;  2UUA C;  4LF6 C;  2OO4 A;  1KKG A;  3LUS A;  2UUC C;  1I94 C;  2HHH C;  3TDE A;  5DV9 A;  3R44 A;  4JM1 A;  1QWI A;  2JMP A;  4BSZ A;  5BST A;  4R1L A;  5JRH A;  4I9F A;  2ATW A;  1HNZ C;  2F4V C;  4DV5 C;  4LFB C;  3JAM D;  1N36 C;  1XRA A;  4EAT A;  5BSV A;  4DR2 C;  2UXC C;  5KEI A;  4JI7 C;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...