4DV6C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv6C02
3GKUA 1LQLA 1N34C 2PN2A 1K0RA 4B3SC 2JMPA 4LFAC 4DV7C 1IBMC 1FJGC 1UKKA 1IBLC 1L2FA 5BR8C 4DV5C 2ASBA 2VQFC 4DV1C 2CY1A 1XMQC 4LF4C 1USPA 4KHPC 1ML8A 4YHHC 3R9WA 3I07A 2HHHC 2HJGA 5IT9D 4JI6C 1QWIA 1XNQC 4JYAC 2KZFA 1ZB8A 1N33C 2UUCC 3IEUA 4MH4A 2E8EA 1N32C 2E7GA 4LF8C 2UXBC 1I94C 4MTNA 4JI7C 2F4VC 2ATWA 3JAMD 4B3TC 5LMNC 4LF5C 1NYEA 4DCTA 1XNRC 4DV6C 4JI2C 3J80D 4XX2A 4NOZA 3EERA 1JOSA 5IWAC 4LF9C 2XR1A 4DR2C 4JI1C 1XMOC 2EGTA 4LFBC 3AF6A 2E8FA 1HR0C 4NXNC 5LMUC 4NXMC 2ONFA 1HH2P 4DCUA 4LF7C 4B3RC 1IBKC 4JI8C 3J7AD 2D7VA 2E5LC 3CJEA 2E8CA 3J81D 3LUSA 4DR5C 4GKJC 5A2QD 4JI0C 4DR1C 1J5EC 4K0KC 1WH9A 3AF5A 1HNXC 2OPLA 2QL8A 4DV2C 1KKGA 4DUZC 2ZM6C 4B3MC 4X65C 2OPLB 4LFCC 1N36C 1VLAA 5FLXD 4DCVA 1N2FA 4JI4C 4DV3C 4AQYC 4X62C 3R9XA 3IEVA 1ZB9A 3T1HC 2BJOA 4JI3C 4JV5C 2CXCA 4OX9C 4LF6C 4GKKC 2UU9C 4DR4C 4DV4C 2YCBA 1HNZC 2UXCC 1USPB 4X64C 3OTOC 2UUBC 1MKYA 2PT7G 4BSZA 2DYJA 4DR6C 2UXDC 1WF3A 4DUYC 2VQEC 4YY3C 2UUAC 4DV0C 4DCSA 1EGAA 4DR3C 3T1YC 4JI5C 1PA4A 4X66C 4DR7C 1HNWC
chains in the Genus database with same CATH superfamily
5JRHA 1N34C 1FUGA 4BC7A 1UKKA 4R1LA 4RMNA 2PROA 2YWCA 3S82A 5BR8C 4L7IA 3PROC 3UOWA 5AE1A 5K85A 1XMQC 4PZPA 4KHPC 3I07A 1PG4A 2HJGA 5IT9D 2QVZX 4JYAC 1ZB8A 3CW8X 5ADZA 4DR7C 3IEUA 5BSUA 4HPVA 1YGTA 3CW9A 1I94C 1O93A 4MTNA 3VNSA 2F4VC 1XRBA 3RV2A 4LE5A 4K0BA 3ETOA 1HR0C 2D28C 3FCCA 4BC9A 3CQ1A 1IBKC 3J7AD 2D7VA 4OXIA 4GKJC 4DG9A 5A2QD 4DR1C 1J5EC 1WH9A 5LCIA 4DV2C 2ZTBA 3RG2A 5AE3A 2VZEA 3A26A 1IB8A 4DUZC 4ODJA 4U5YD 2OPLB 2Y4OA 4LFCC 5FLXD 4DV3C 5A19A 3ETCA 3N54B 5GTDA 1RG9A 3E7WA 5CZXA 1GPMA 4GKKC 1XRAA 3G7SA 1HNZC 1WCJA 2UXCC 2M5HA 4X64C 4ZJZA 3FM7A 4FUQA 2UXDC 1V26A 4I9GA 1QM4A 4DCSA 1XDXA 1LQLA 2P2QA 3DHVA 2ZZMA 4B3SC 3VNQA 4LFAC 4G36A 1FJGC 1O90A 3LNVA 2ASBA 3A4IA 3CQ3A 3LNOA 3AY0A 4DV1C 2P02A 4YHHC 2HHHC 5BSVA 3L95X 1QWIA 5BSTA 4DG8A 3TR3A 2UUCC 5KYVA 4ZLPA 2Y27A 2UXBC 2ATWA 4TPSB 1MXCA 1AMUA 5LMNC 4LF5C 1XNRC 3VNRA 4BBYA 4DV6C 4JI2C 2DHMA 3J80D 3E7XA 2Z51A 3KXWA 1JOSA 4PROC 4G37A 5IWAC 3CQ2A 4LF9C 2OBVA 1XMOC 4GXQA 4RLFA 2E8FA 3UX3A 4NXNC 1V25A 1HH2P 1XHJA 1P4EC 4L4QA 2E5LC 1MDFA 5KYTA 1PG3A 3L8CA 2JNVA 2QL8A 1FLOA 2OO4A 2D1TA 4FUTA 4RVOA 1MXAA 2MMAB 3LGXA 1VLAA 1MXBA 4DCVA 1N2FA 4X62C 3FCEA 1M6XA 3IMLA 3T1HC 2BJOA 2Y4NA 3GPCA 3UEBA 2D27A 4JI3C 5AE2A 2NCLA 2CXCA 5BURA 1USPB 5H9UA 4D4IA 3OTOC 1TH5A 1UWDA 4RM2A 2VSQA 1WF3A 4DUYC 3N2QA 4YY3C 2UUAC 4I9FA 3NYQA 4D4GA 4X66C 3GKUA 2WD9A 2KDNA 1K0RA 4D56A 2JMPA 4FTFA 1PU1A 4DV7C 1IBMC 3TDEA 1IBLC 1L2FA 2D1QA 5K8FA 2M5OA 1ML8A 3R9WA 4L2ZA 3R44A 3LAXA 2QVXX 2KZFA 1N33C 1M6XC 1T5DX 3NI2A 2E7GA 4ISBA 5A1GA 3JAMD 5CZVA 4B3TC 4RLQA 4EATA 1NYEA 5E7QA 5KEIA 4PUHA 3EERA 4GS5A 5IFIA 4JM1A 2P2JA 2MCQA 2XR1A 4PUIA 4JI1C 4WS9A 4WV3A 2EGTA 4LFBC 5BUSA 1P7LA 2WP0C 4NXMC 1XRCA 1T5HX 4DCUA 4LF7C 4B3RC 3GR1A 4IZ6A 3K6RA 3CJEA 1XS3A 3NYRA 2AYAA 3LUSA 4R0MA 2KZ0A 1MDBA 2QW0X 3AF5A 1KKGA 2ZM6C 4X65C 1P4EA 4G1IA 1N36C 3GR0A 3UX2A 3UZ0A 2P2FA 4R1MA 1VEHA 4LF6C 5BSMA 2UU9C 3C5EA 4DR4C 2YCBA 1LCIA 2P20A 3EQ6A 3A9VA 1MKYA 2PT7G 2DYJA 4DR6C 2YWBA 4DV0C 4KTTA 2CU6A 4DR3C 4JI5C 1HNWC 1YJ7A 2PN2A 3TQIA 4IR7A 2PG1E 3DLPX 3DAYA 4BCAA 4DV5C 2VQFC 2CY1A 4LF4C 2P2BA 3PBKA 1USPA 3NPDA 4JI6C 1BA3A 1NY8A 3B7WA 1XNQC 5T8TA 2E8EA 4MH4A 3TUFA 2QVYX 1N32C 4KTVA 4LF8C 1MD9A 4JI7C 1O92A 3IPLA 4DCTA 1O9TA 5DV9A 2MM9A 4XX2A 4NOZA 3PESA 2YX1A 4PUGA 2P2MA 4DR2C 3I08A 3AF6A 5LMUC 2ONFA 4GXRA 4JI8C 3A9UA 5BSWA 4RVNA 3SO4A 2E8CA 3J81D 4DR5C 4OYCA 4JI0C 4D57A 4K0KC 1RY2A 1V60A 1HNXC 2E0GA 2OPLA 2D1SA 2DPLA 4B3MC 2ZZNA 5BUQA 4JI4C 3A25A 4AQYC 3R9XA 3IEVA 3O2EA 5BSRA 1ZB9A 3H2TA 2BH1X 4RM3A 4JV5C 4OX9C 4NDNA 4DV4C 2UUBC 4BSZA 1ULTA 4PHTA 5T8SA 2V7BA 2VQEC 2D1RA 1EGAA 3T1YC 1PA4A 5A1IA
chains in the Genus database with same CATH topology
5JRHA 1N34C 1FUGA 4BC7A 1UKKA 4R1LA 4RMNA 2PROA 2YWCA 3S82A 5BR8C 4L7IA 3PROC 3UOWA 5AE1A 5K85A 1XMQC 4PZPA 4KHPC 3I07A 1PG4A 2HJGA 5IT9D 2QVZX 4JYAC 1ZB8A 3CW8X 5ADZA 4DR7C 3IEUA 5BSUA 4HPVA 3CW9A 1I94C 1O93A 4MTNA 3VNSA 2F4VC 1XRBA 3RV2A 4LE5A 4K0BA 3ETOA 1HR0C 2D28C 3FCCA 4BC9A 1IBKC 3J7AD 2D7VA 4OXIA 4GKJC 4DG9A 5A2QD 4DR1C 1J5EC 1WH9A 4DV2C 3RG2A 5AE3A 2VZEA 4DUZC 4ODJA 4U5YD 2OPLB 2Y4OA 4LFCC 5FLXD 4DV3C 5A19A 3ETCA 3N54B 5GTDA 1RG9A 3E7WA 5CZXA 1GPMA 4GKKC 1XRAA 3G7SA 1HNZC 2UXCC 4X64C 4ZJZA 4FUQA 2UXDC 1V26A 4I9GA 1QM4A 4DCSA 1LQLA 2P2QA 3DHVA 4B3SC 3VNQA 4LFAC 4G36A 1FJGC 1O90A 3LNVA 2ASBA 3A4IA 4DV1C 2P02A 4YHHC 2HHHC 5BSVA 3L95X 1QWIA 5BSTA 4DG8A 2UUCC 5KYVA 4ZLPA 2Y27A 2UXBC 2ATWA 4TPSB 1MXCA 1AMUA 5LMNC 4LF5C 1XNRC 3VNRA 4BBYA 4DV6C 4JI2C 3J80D 3E7XA 3KXWA 1JOSA 4PROC 4G37A 5IWAC 4LF9C 2OBVA 1XMOC 4GXQA 4RLFA 2E8FA 4NXNC 1V25A 1HH2P 4L4QA 2E5LC 1MDFA 5KYTA 1PG3A 3L8CA 2QL8A 2OO4A 2D1TA 4FUTA 4RVOA 1MXAA 3LGXA 1VLAA 1MXBA 4DCVA 1N2FA 4X62C 3FCEA 3IMLA 3T1HC 2BJOA 2Y4NA 3GPCA 2D27A 4JI3C 5AE2A 2CXCA 5BURA 1USPB 5H9UA 4D4IA 3OTOC 4RM2A 2VSQA 1WF3A 4DUYC 3N2QA 4YY3C 2UUAC 4I9FA 3NYQA 4D4GA 4X66C 3GKUA 2WD9A 1K0RA 4D56A 2JMPA 4FTFA 4DV7C 1IBMC 3TDEA 1IBLC 1L2FA 2D1QA 5K8FA 1ML8A 3R9WA 4L2ZA 3R44A 3LAXA 2QVXX 2KZFA 1N33C 1T5DX 3NI2A 2E7GA 4ISBA 5A1GA 3JAMD 5CZVA 4B3TC 4RLQA 4EATA 1NYEA 5E7QA 5KEIA 3EERA 4GS5A 5IFIA 4JM1A 2P2JA 2XR1A 4JI1C 4WS9A 4WV3A 2EGTA 4LFBC 5BUSA 1P7LA 2WP0C 4NXMC 1XRCA 1T5HX 4DCUA 4LF7C 4B3RC 3GR1A 4IZ6A 3CJEA 3NYRA 2AYAA 3LUSA 4R0MA 1MDBA 2QW0X 3AF5A 1KKGA 2ZM6C 4X65C 4G1IA 1N36C 3GR0A 3UZ0A 2P2FA 4R1MA 4LF6C 5BSMA 2UU9C 3C5EA 4DR4C 2YCBA 1LCIA 2P20A 3EQ6A 3A9VA 1MKYA 2PT7G 2DYJA 4DR6C 2YWBA 4DV0C 4KTTA 4DR3C 4JI5C 1HNWC 1YJ7A 2PN2A 3TQIA 4IR7A 3DLPX 3DAYA 4BCAA 4DV5C 2VQFC 2CY1A 4LF4C 2P2BA 3PBKA 1USPA 3NPDA 4JI6C 1BA3A 3B7WA 1XNQC 5T8TA 2E8EA 4MH4A 3TUFA 2QVYX 1N32C 4KTVA 4LF8C 1MD9A 4JI7C 1O92A 3IPLA 4DCTA 1O9TA 5DV9A 4XX2A 4NOZA 3PESA 2P2MA 4DR2C 3I08A 3AF6A 5LMUC 2ONFA 4GXRA 4JI8C 3A9UA 5BSWA 4RVNA 3SO4A 2E8CA 3J81D 4DR5C 4OYCA 4JI0C 4D57A 4K0KC 1RY2A 1HNXC 2E0GA 2OPLA 2D1SA 2DPLA 4B3MC 5BUQA 4JI4C 4AQYC 3R9XA 3IEVA 5BSRA 1ZB9A 3H2TA 2BH1X 4RM3A 4JV5C 4OX9C 4NDNA 4DV4C 2UUBC 4BSZA 1ULTA 4PHTA 5T8SA 2V7BA 2VQEC 2D1RA 1EGAA 3T1YC 1PA4A 5A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKU A;  1LQL A;  1N34 C;  2PN2 A;  1K0R A;  4B3S C;  2JMP A;  4LFA C;  4DV7 C;  1IBM C;  1FJG C;  1UKK A;  1IBL C;  1L2F A;  5BR8 C;  4DV5 C;  2ASB A;  2VQF C;  4DV1 C;  2CY1 A;  1XMQ C;  4LF4 C;  1USP A;  4KHP C;  1ML8 A;  4YHH C;  3R9W A;  3I07 A;  2HHH C;  2HJG A;  5IT9 D;  4JI6 C;  1QWI A;  1XNQ C;  4JYA C;  2KZF A;  1ZB8 A;  1N33 C;  2UUC C;  3IEU A;  4MH4 A;  2E8E A;  1N32 C;  2E7G A;  4LF8 C;  2UXB C;  1I94 C;  4MTN A;  4JI7 C;  2F4V C;  2ATW A;  3JAM D;  4B3T C;  5LMN C;  4LF5 C;  1NYE A;  4DCT A;  1XNR C;  4DV6 C;  4JI2 C;  3J80 D;  4XX2 A;  4NOZ A;  3EER A;  1JOS A;  5IWA C;  4LF9 C;  2XR1 A;  4DR2 C;  4JI1 C;  1XMO C;  2EGT A;  4LFB C;  3AF6 A;  2E8F A;  1HR0 C;  4NXN C;  5LMU C;  4NXM C;  2ONF A;  1HH2 P;  4DCU A;  4LF7 C;  4B3R C;  1IBK C;  4JI8 C;  3J7A D;  2D7V A;  2E5L C;  3CJE A;  2E8C A;  3J81 D;  3LUS A;  4DR5 C;  4GKJ C;  5A2Q D;  4JI0 C;  4DR1 C;  1J5E C;  4K0K C;  1WH9 A;  3AF5 A;  1HNX C;  2OPL A;  2QL8 A;  4DV2 C;  1KKG A;  4DUZ C;  2ZM6 C;  4B3M C;  4X65 C;  2OPL B;  4LFC C;  1N36 C;  1VLA A;  5FLX D;  4DCV A;  1N2F A;  4JI4 C;  4DV3 C;  4AQY C;  4X62 C;  3R9X A;  3IEV A;  1ZB9 A;  3T1H C;  2BJO A;  4JI3 C;  4JV5 C;  2CXC A;  4OX9 C;  4LF6 C;  4GKK C;  2UU9 C;  4DR4 C;  4DV4 C;  2YCB A;  1HNZ C;  2UXC C;  1USP B;  4X64 C;  3OTO C;  2UUB C;  1MKY A;  2PT7 G;  4BSZ A;  2DYJ A;  4DR6 C;  2UXD C;  1WF3 A;  4DUY C;  2VQE C;  4YY3 C;  2UUA C;  4DV0 C;  4DCS A;  1EGA A;  4DR3 C;  3T1Y C;  4JI5 C;  1PA4 A;  4X66 C;  4DR7 C;  1HNW C; 
#chains in the Genus database with same CATH topology
 5JRH A;  1N34 C;  1FUG A;  4BC7 A;  1UKK A;  4R1L A;  4RMN A;  2PRO A;  2YWC A;  3S82 A;  5BR8 C;  4L7I A;  3PRO C;  3UOW A;  5AE1 A;  5K85 A;  1XMQ C;  4PZP A;  4KHP C;  3I07 A;  1PG4 A;  2HJG A;  5IT9 D;  2QVZ X;  4JYA C;  1ZB8 A;  3CW8 X;  5ADZ A;  4DR7 C;  3IEU A;  5BSU A;  4HPV A;  1YGT A;  3CW9 A;  1I94 C;  1O93 A;  4MTN A;  3VNS A;  2F4V C;  1XRB A;  3RV2 A;  4LE5 A;  4K0B A;  3ETO A;  1HR0 C;  2D28 C;  3FCC A;  4BC9 A;  3CQ1 A;  1IBK C;  3J7A D;  2D7V A;  4OXI A;  4GKJ C;  4DG9 A;  5A2Q D;  4DR1 C;  1J5E C;  1WH9 A;  5LCI A;  4DV2 C;  2ZTB A;  3RG2 A;  5AE3 A;  2VZE A;  3A26 A;  1IB8 A;  4DUZ C;  4ODJ A;  4U5Y D;  2OPL B;  2Y4O A;  4LFC C;  5FLX D;  4DV3 C;  5A19 A;  3ETC A;  3N54 B;  5GTD A;  1RG9 A;  3E7W A;  5CZX A;  1GPM A;  4GKK C;  1XRA A;  3G7S A;  1HNZ C;  1WCJ A;  2UXC C;  2M5H A;  4X64 C;  4ZJZ A;  3FM7 A;  4FUQ A;  2UXD C;  1V26 A;  4I9G A;  1QM4 A;  4DCS A;  1XDX A;  1LQL A;  2P2Q A;  3DHV A;  2ZZM A;  4B3S C;  3VNQ A;  4LFA C;  4G36 A;  1FJG C;  1O90 A;  3LNV A;  2ASB A;  3A4I A;  3CQ3 A;  3LNO A;  3AY0 A;  4DV1 C;  2P02 A;  4YHH C;  2HHH C;  5BSV A;  3L95 X;  1QWI A;  5BST A;  4DG8 A;  3TR3 A;  2UUC C;  5KYV A;  4ZLP A;  2Y27 A;  2UXB C;  2ATW A;  4TPS B;  1MXC A;  1AMU A;  5LMN C;  4LF5 C;  1XNR C;  3VNR A;  4BBY A;  4DV6 C;  4JI2 C;  2DHM A;  3J80 D;  3E7X A;  2Z51 A;  3KXW A;  1JOS A;  4PRO C;  4G37 A;  5IWA C;  3CQ2 A;  4LF9 C;  2OBV A;  1XMO C;  4GXQ A;  4RLF A;  2E8F A;  3UX3 A;  4NXN C;  1V25 A;  1HH2 P;  1XHJ A;  1P4E C;  4L4Q A;  2E5L C;  1MDF A;  5KYT A;  1PG3 A;  3L8C A;  2JNV A;  2QL8 A;  1FLO A;  2OO4 A;  2D1T A;  4FUT A;  4RVO A;  1MXA A;  2MMA B;  3LGX A;  1VLA A;  1MXB A;  4DCV A;  1N2F A;  4X62 C;  3FCE A;  1M6X A;  3IML A;  3T1H C;  2BJO A;  2Y4N A;  3GPC A;  3UEB A;  2D27 A;  4JI3 C;  5AE2 A;  2NCL A;  2CXC A;  5BUR A;  1USP B;  5H9U A;  4D4I A;  3OTO C;  1TH5 A;  1UWD A;  4RM2 A;  2VSQ A;  1WF3 A;  4DUY C;  3N2Q A;  4YY3 C;  2UUA C;  4I9F A;  3NYQ A;  4D4G A;  4X66 C;  3GKU A;  2WD9 A;  2KDN A;  1K0R A;  4D56 A;  2JMP A;  4FTF A;  1PU1 A;  4DV7 C;  1IBM C;  3TDE A;  1IBL C;  1L2F A;  2D1Q A;  5K8F A;  2M5O A;  1ML8 A;  3R9W A;  4L2Z A;  3R44 A;  3LAX A;  2QVX X;  2KZF A;  1N33 C;  1M6X C;  1T5D X;  3NI2 A;  2E7G A;  4ISB A;  5A1G A;  3JAM D;  5CZV A;  4B3T C;  4RLQ A;  4EAT A;  1NYE A;  5E7Q A;  5KEI A;  4PUH A;  3EER A;  4GS5 A;  5IFI A;  4JM1 A;  2P2J A;  2MCQ A;  2XR1 A;  4PUI A;  4JI1 C;  4WS9 A;  4WV3 A;  2EGT A;  4LFB C;  5BUS A;  1P7L A;  2WP0 C;  4NXM C;  1XRC A;  1T5H X;  4DCU A;  4LF7 C;  4B3R C;  3GR1 A;  4IZ6 A;  3K6R A;  3CJE A;  1XS3 A;  3NYR A;  2AYA A;  3LUS A;  4R0M A;  2KZ0 A;  1MDB A;  2QW0 X;  3AF5 A;  1KKG A;  2ZM6 C;  4X65 C;  1P4E A;  4G1I A;  1N36 C;  3GR0 A;  3UX2 A;  3UZ0 A;  2P2F A;  4R1M A;  1VEH A;  4LF6 C;  5BSM A;  2UU9 C;  3C5E A;  4DR4 C;  2YCB A;  1LCI A;  2P20 A;  3EQ6 A;  3A9V A;  1MKY A;  2PT7 G;  2DYJ A;  4DR6 C;  2YWB A;  4DV0 C;  4KTT A;  2CU6 A;  4DR3 C;  4JI5 C;  1HNW C;  1YJ7 A;  2PN2 A;  3TQI A;  4IR7 A;  2PG1 E;  3DLP X;  3DAY A;  4BCA A;  4DV5 C;  2VQF C;  2CY1 A;  4LF4 C;  2P2B A;  3PBK A;  1USP A;  3NPD A;  4JI6 C;  1BA3 A;  1NY8 A;  3B7W A;  1XNQ C;  5T8T A;  2E8E A;  4MH4 A;  3TUF A;  2QVY X;  1N32 C;  4KTV A;  4LF8 C;  1MD9 A;  4JI7 C;  1O92 A;  3IPL A;  4DCT A;  1O9T A;  5DV9 A;  2MM9 A;  4XX2 A;  4NOZ A;  3PES A;  2YX1 A;  4PUG A;  2P2M A;  4DR2 C;  3I08 A;  3AF6 A;  5LMU C;  2ONF A;  4GXR A;  4JI8 C;  3A9U A;  5BSW A;  4RVN A;  3SO4 A;  2E8C A;  3J81 D;  4DR5 C;  4OYC A;  4JI0 C;  4D57 A;  4K0K C;  1RY2 A;  1V60 A;  1HNX C;  2E0G A;  2OPL A;  2D1S A;  2DPL A;  4B3M C;  2ZZN A;  5BUQ A;  4JI4 C;  3A25 A;  4AQY C;  3R9X A;  3IEV A;  3O2E A;  5BSR A;  1ZB9 A;  3H2T A;  2BH1 X;  4RM3 A;  4JV5 C;  4OX9 C;  4NDN A;  4DV4 C;  2UUB C;  4BSZ A;  1ULT A;  4PHT A;  5T8S A;  2V7B A;  2VQE C;  2D1R A;  1EGA A;  3T1Y C;  1PA4 A;  5A1I A; 
#chains in the Genus database with same CATH homology
 5JRH A;  1N34 C;  1FUG A;  4BC7 A;  1UKK A;  4R1L A;  4RMN A;  2PRO A;  2YWC A;  3S82 A;  5BR8 C;  4L7I A;  3PRO C;  3UOW A;  5AE1 A;  5K85 A;  1XMQ C;  4PZP A;  4KHP C;  3I07 A;  1PG4 A;  2HJG A;  5IT9 D;  2QVZ X;  4JYA C;  1ZB8 A;  3CW8 X;  5ADZ A;  4DR7 C;  3IEU A;  5BSU A;  4HPV A;  3CW9 A;  1I94 C;  1O93 A;  4MTN A;  3VNS A;  2F4V C;  1XRB A;  3RV2 A;  4LE5 A;  4K0B A;  3ETO A;  1HR0 C;  2D28 C;  3FCC A;  4BC9 A;  1IBK C;  3J7A D;  2D7V A;  4OXI A;  4GKJ C;  4DG9 A;  5A2Q D;  4DR1 C;  1J5E C;  1WH9 A;  4DV2 C;  3RG2 A;  5AE3 A;  2VZE A;  4DUZ C;  4ODJ A;  4U5Y D;  2OPL B;  2Y4O A;  4LFC C;  5FLX D;  4DV3 C;  5A19 A;  3ETC A;  3N54 B;  5GTD A;  1RG9 A;  3E7W A;  5CZX A;  1GPM A;  4GKK C;  1XRA A;  3G7S A;  1HNZ C;  2UXC C;  4X64 C;  4ZJZ A;  4FUQ A;  2UXD C;  1V26 A;  4I9G A;  1QM4 A;  4DCS A;  1LQL A;  2P2Q A;  3DHV A;  4B3S C;  3VNQ A;  4LFA C;  4G36 A;  1FJG C;  1O90 A;  3LNV A;  2ASB A;  3A4I A;  4DV1 C;  2P02 A;  4YHH C;  2HHH C;  5BSV A;  3L95 X;  1QWI A;  5BST A;  4DG8 A;  2UUC C;  5KYV A;  4ZLP A;  2Y27 A;  2UXB C;  2ATW A;  4TPS B;  1MXC A;  1AMU A;  5LMN C;  4LF5 C;  1XNR C;  3VNR A;  4BBY A;  4DV6 C;  4JI2 C;  3J80 D;  3E7X A;  3KXW A;  1JOS A;  4PRO C;  4G37 A;  5IWA C;  4LF9 C;  2OBV A;  1XMO C;  4GXQ A;  4RLF A;  2E8F A;  4NXN C;  1V25 A;  1HH2 P;  4L4Q A;  2E5L C;  1MDF A;  5KYT A;  1PG3 A;  3L8C A;  2QL8 A;  2OO4 A;  2D1T A;  4FUT A;  4RVO A;  1MXA A;  3LGX A;  1VLA A;  1MXB A;  4DCV A;  1N2F A;  4X62 C;  3FCE A;  3IML A;  3T1H C;  2BJO A;  2Y4N A;  3GPC A;  2D27 A;  4JI3 C;  5AE2 A;  2CXC A;  5BUR A;  1USP B;  5H9U A;  4D4I A;  3OTO C;  4RM2 A;  2VSQ A;  1WF3 A;  4DUY C;  3N2Q A;  4YY3 C;  2UUA C;  4I9F A;  3NYQ A;  4D4G A;  4X66 C;  3GKU A;  2WD9 A;  1K0R A;  4D56 A;  2JMP A;  4FTF A;  4DV7 C;  1IBM C;  3TDE A;  1IBL C;  1L2F A;  2D1Q A;  5K8F A;  1ML8 A;  3R9W A;  4L2Z A;  3R44 A;  3LAX A;  2QVX X;  2KZF A;  1N33 C;  1T5D X;  3NI2 A;  2E7G A;  4ISB A;  5A1G A;  3JAM D;  5CZV A;  4B3T C;  4RLQ A;  4EAT A;  1NYE A;  5E7Q A;  5KEI A;  3EER A;  4GS5 A;  5IFI A;  4JM1 A;  2P2J A;  2XR1 A;  4JI1 C;  4WS9 A;  4WV3 A;  2EGT A;  4LFB C;  5BUS A;  1P7L A;  2WP0 C;  4NXM C;  1XRC A;  1T5H X;  4DCU A;  4LF7 C;  4B3R C;  3GR1 A;  4IZ6 A;  3CJE A;  3NYR A;  2AYA A;  3LUS A;  4R0M A;  1MDB A;  2QW0 X;  3AF5 A;  1KKG A;  2ZM6 C;  4X65 C;  4G1I A;  1N36 C;  3GR0 A;  3UZ0 A;  2P2F A;  4R1M A;  4LF6 C;  5BSM A;  2UU9 C;  3C5E A;  4DR4 C;  2YCB A;  1LCI A;  2P20 A;  3EQ6 A;  3A9V A;  1MKY A;  2PT7 G;  2DYJ A;  4DR6 C;  2YWB A;  4DV0 C;  4KTT A;  4DR3 C;  4JI5 C;  1HNW C;  1YJ7 A;  2PN2 A;  3TQI A;  4IR7 A;  3DLP X;  3DAY A;  4BCA A;  4DV5 C;  2VQF C;  2CY1 A;  4LF4 C;  2P2B A;  3PBK A;  1USP A;  3NPD A;  4JI6 C;  1BA3 A;  3B7W A;  1XNQ C;  5T8T A;  2E8E A;  4MH4 A;  3TUF A;  2QVY X;  1N32 C;  4KTV A;  4LF8 C;  1MD9 A;  4JI7 C;  1O92 A;  3IPL A;  4DCT A;  1O9T A;  5DV9 A;  4XX2 A;  4NOZ A;  3PES A;  2P2M A;  4DR2 C;  3I08 A;  3AF6 A;  5LMU C;  2ONF A;  4GXR A;  4JI8 C;  3A9U A;  5BSW A;  4RVN A;  3SO4 A;  2E8C A;  3J81 D;  4DR5 C;  4OYC A;  4JI0 C;  4D57 A;  4K0K C;  1RY2 A;  1HNX C;  2E0G A;  2OPL A;  2D1S A;  2DPL A;  4B3M C;  5BUQ A;  4JI4 C;  4AQY C;  3R9X A;  3IEV A;  5BSR A;  1ZB9 A;  3H2T A;  2BH1 X;  4RM3 A;  4JV5 C;  4OX9 C;  4NDN A;  4DV4 C;  2UUB C;  4BSZ A;  1ULT A;  4PHT A;  5T8S A;  2V7B A;  2VQE C;  2D1R A;  1EGA A;  3T1Y C;  1PA4 A;  5A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...