2PG1E

Structural analysis of a cytoplasmic dynein light chain-intermediate chain complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 1, cytoplasmic
publication title Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
total genus 27
structure length 104
sequence length 104
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 2pg1E01
3FM7A 2PG1E 1XDXA 1YGTA
chains in the Genus database with same CATH superfamily
1HNZC 4LF8C 4JI2C 2UXCC 4DV0C 4NXNC 4JI5C 4B3MC 4JI6C 4JI1C 5LMNC 4DV6C 4B3TC 2UUBC 4YHHC 1XNRC 4X65C 1J5EC 4JI4C 2VQFC 4DR2C 1HNXC 4X64C 4DV2C 2VQEC 4X66C 1N34C 4B3RC 3J81D 4LFAC 4DR3C 3JAMD 4LFCC 1XMQC 2UXDC 4DR1C 4DR4C 4KHPC 4JI3C 2E5LC 5IWAC 4JYAC 1FJGC 4B3SC 2UUCC 1N36C 1HR0C 1N33C 5FLXD 4GKJC 5A2QD 4DR5C 1XNQC 4DV7C 4X62C 4LF4C 3FM7A 1HNWC 4OX9C 2UU9C 4LF9C 4AQYC 1IBKC 5BR8C 2F4VC 1YGTA 4LF6C 4LF5C 4DV5C 4DUYC 4DV3C 3T1YC 2UUAC 1XDXA 3J80D 4JI7C 4LF7C 4DUZC 4DR7C 4JV5C 4DV4C 3OTOC 4GKKC 4LFBC 1IBMC 4YY3C 4K0KC 2HHHC 3T1HC 4DR6C 2UXBC 1N32C 1IBLC 5LMUC 4NXMC 1I94C 4JI8C 4BSZA 4DV1C 2ZM6C 1XMOC 2ZTBA 3J7AD 2PG1E 5IT9D 4JI0C
chains in the Genus database with same CATH topology
3FM7A 2ZTBA 2PG1E 1XDXA 1YGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM7 A;  2PG1 E;  1XDX A;  1YGT A; 
#chains in the Genus database with same CATH topology
 1HNZ C;  4LF8 C;  4JI2 C;  2UXC C;  4DV0 C;  4NXN C;  4JI5 C;  4B3M C;  4JI6 C;  4JI1 C;  5LMN C;  4DV6 C;  4B3T C;  2UUB C;  4YHH C;  1XNR C;  4X65 C;  1J5E C;  4JI4 C;  2VQF C;  4DR2 C;  1HNX C;  4X64 C;  4DV2 C;  2VQE C;  4X66 C;  1N34 C;  4B3R C;  3J81 D;  4LFA C;  4DR3 C;  3JAM D;  4LFC C;  1XMQ C;  2UXD C;  4DR1 C;  4DR4 C;  4KHP C;  4JI3 C;  2E5L C;  5IWA C;  4JYA C;  1FJG C;  4B3S C;  2UUC C;  1N36 C;  1HR0 C;  1N33 C;  5FLX D;  4GKJ C;  5A2Q D;  4DR5 C;  1XNQ C;  4DV7 C;  4X62 C;  4LF4 C;  3FM7 A;  1HNW C;  4OX9 C;  2UU9 C;  4LF9 C;  4AQY C;  1IBK C;  5BR8 C;  2F4V C;  1YGT A;  4LF6 C;  4LF5 C;  4DV5 C;  4DUY C;  4DV3 C;  3T1Y C;  2UUA C;  1XDX A;  3J80 D;  4JI7 C;  4LF7 C;  4DUZ C;  4DR7 C;  4JV5 C;  4DV4 C;  3OTO C;  4GKK C;  4LFB C;  1IBM C;  4YY3 C;  4K0K C;  2HHH C;  3T1H C;  4DR6 C;  2UXB C;  1N32 C;  1IBL C;  5LMU C;  4NXM C;  1I94 C;  4JI8 C;  4BSZ A;  4DV1 C;  2ZM6 C;  1XMO C;  2ZTB A;  3J7A D;  2PG1 E;  5IT9 D;  4JI0 C; 
#chains in the Genus database with same CATH homology
 3FM7 A;  2ZTB A;  2PG1 E;  1XDX A;  1YGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...