2PG1E

Structural analysis of a cytoplasmic dynein light chain-intermediate chain complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Dynein light chain 1, cytoplasmic
publication title Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 27
structure length 104
sequence length 104
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 2pg1E01
1XDXA 3FM7A 2PG1E 1YGTA
chains in the Genus database with same CATH superfamily
3OTOC 4DV1C 4B3MC 4K0KC 2ZTBA 4JI2C 5LMUC 4LF8C 4BSZA 4DR3C 2UU9C 2VQEC 2F4VC 4JI0C 3J80D 1I94C 4DR6C 1XNRC 4LF5C 1HNXC 5BR8C 3J81D 2UXBC 1N34C 4DV6C 4NXMC 4OX9C 1XMOC 4NXNC 2HHHC 1N33C 2PG1E 4AQYC 4X66C 4JI7C 1FJGC 2UUBC 3FM7A 4JI3C 1J5EC 2UUAC 4DR1C 4YY3C 4LF7C 4LFBC 1IBKC 2UXCC 1HNWC 2VQFC 4DUZC 1IBMC 4B3TC 4JI6C 1N32C 4X65C 4JI8C 1IBLC 4DV4C 4X62C 4YHHC 4LFAC 3JAMD 2ZM6C 5IWAC 4JV5C 2UUCC 4X64C 2UXDC 4DR5C 4DUYC 4DR2C 1XMQC 4LF4C 4JI4C 1N36C 4JYAC 4LF6C 4DV7C 1HNZC 1HR0C 1XNQC 5A2QD 4GKKC 4DR4C 4B3RC 5LMNC 1XDXA 2E5LC 4DV0C 4GKJC 4B3SC 1YGTA 3J7AD 3T1YC 4DV5C 5IT9D 4DV3C 4JI5C 4DV2C 3T1HC 4JI1C 4KHPC 5FLXD 4LF9C 4DR7C 4LFCC
chains in the Genus database with same CATH topology
1YGTA 2ZTBA 3FM7A 1XDXA 2PG1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDX A;  3FM7 A;  2PG1 E;  1YGT A; 
#chains in the Genus database with same CATH topology
 3OTO C;  4DV1 C;  4B3M C;  4K0K C;  2ZTB A;  4JI2 C;  5LMU C;  4LF8 C;  4BSZ A;  4DR3 C;  2UU9 C;  2VQE C;  2F4V C;  4JI0 C;  3J80 D;  1I94 C;  4DR6 C;  1XNR C;  4LF5 C;  1HNX C;  5BR8 C;  3J81 D;  2UXB C;  1N34 C;  4DV6 C;  4NXM C;  4OX9 C;  1XMO C;  4NXN C;  2HHH C;  1N33 C;  2PG1 E;  4AQY C;  4X66 C;  4JI7 C;  1FJG C;  2UUB C;  3FM7 A;  4JI3 C;  1J5E C;  2UUA C;  4DR1 C;  4YY3 C;  4LF7 C;  4LFB C;  1IBK C;  2UXC C;  1HNW C;  2VQF C;  4DUZ C;  1IBM C;  4B3T C;  4JI6 C;  1N32 C;  4X65 C;  4JI8 C;  1IBL C;  4DV4 C;  4X62 C;  4YHH C;  4LFA C;  3JAM D;  2ZM6 C;  5IWA C;  4JV5 C;  2UUC C;  4X64 C;  2UXD C;  4DR5 C;  4DUY C;  4DR2 C;  1XMQ C;  4LF4 C;  4JI4 C;  1N36 C;  4JYA C;  4LF6 C;  4DV7 C;  1HNZ C;  1HR0 C;  1XNQ C;  5A2Q D;  4GKK C;  4DR4 C;  4B3R C;  5LMN C;  1XDX A;  2E5L C;  4DV0 C;  4GKJ C;  4B3S C;  1YGT A;  3J7A D;  3T1Y C;  4DV5 C;  5IT9 D;  4DV3 C;  4JI5 C;  4DV2 C;  3T1H C;  4JI1 C;  4KHP C;  5FLX D;  4LF9 C;  4DR7 C;  4LFC C; 
#chains in the Genus database with same CATH homology
 1YGT A;  2ZTB A;  3FM7 A;  1XDX A;  2PG1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...