2PG1E

Structural analysis of a cytoplasmic dynein light chain-intermediate chain complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 1, cytoplasmic
publication title Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
total genus 27
structure length 104
sequence length 104
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 2pg1E01
3FM7A 1YGTA 2PG1E 1XDXA
chains in the Genus database with same CATH superfamily
1N34C 4JI6C 4LF5C 5IWAC 5IT9D 2UXCC 1N36C 3FM7A 4LF4C 4DR5C 4DR2C 1HNWC 4JI3C 4GKJC 1YGTA 3JAMD 4NXNC 4X66C 2F4VC 2UUCC 4DR7C 1HR0C 5LMNC 5FLXD 4DR6C 4X65C 1XNRC 4LF6C 4B3RC 4DR3C 2UUBC 4LF9C 2UUAC 1FJGC 1N33C 4DUYC 4DV7C 2ZM6C 1XDXA 4JI4C 4X64C 2VQEC 2UU9C 4JI0C 4JI8C 1IBLC 4JYAC 2UXBC 1I94C 3J81D 2PG1E 3J80D 1HNZC 1J5EC 4DV0C 4DV6C 4DV2C 2ZTBA 4YY3C 4DV5C 4DV1C 1XMQC 5BR8C 4JI5C 4AQYC 4LFBC 1XNQC 4JI7C 4DUZC 5LMUC 4LFAC 4YHHC 4DR4C 5A2QD 2HHHC 2UXDC 4X62C 4OX9C 1XMOC 4KHPC 1N32C 2E5LC 1HNXC 4JI1C 4K0KC 1IBKC 4LFCC 3J7AD 4BSZA 1IBMC 2VQFC 4LF8C 4DV4C 4GKKC 4JI2C 4NXMC 3T1YC 4DR1C 4B3SC 4B3TC 4DV3C 3OTOC 4B3MC 4LF7C 4JV5C 3T1HC
chains in the Genus database with same CATH topology
1YGTA 2PG1E 2ZTBA 3FM7A 1XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM7 A;  1YGT A;  2PG1 E;  1XDX A; 
#chains in the Genus database with same CATH topology
 1N34 C;  4JI6 C;  4LF5 C;  5IWA C;  5IT9 D;  2UXC C;  1N36 C;  3FM7 A;  4LF4 C;  4DR5 C;  4DR2 C;  1HNW C;  4JI3 C;  4GKJ C;  1YGT A;  3JAM D;  4NXN C;  4X66 C;  2F4V C;  2UUC C;  4DR7 C;  1HR0 C;  5LMN C;  5FLX D;  4DR6 C;  4X65 C;  1XNR C;  4LF6 C;  4B3R C;  4DR3 C;  2UUB C;  4LF9 C;  2UUA C;  1FJG C;  1N33 C;  4DUY C;  4DV7 C;  2ZM6 C;  1XDX A;  4JI4 C;  4X64 C;  2VQE C;  2UU9 C;  4JI0 C;  4JI8 C;  1IBL C;  4JYA C;  2UXB C;  1I94 C;  3J81 D;  2PG1 E;  3J80 D;  1HNZ C;  1J5E C;  4DV0 C;  4DV6 C;  4DV2 C;  2ZTB A;  4YY3 C;  4DV5 C;  4DV1 C;  1XMQ C;  5BR8 C;  4JI5 C;  4AQY C;  4LFB C;  1XNQ C;  4JI7 C;  4DUZ C;  5LMU C;  4LFA C;  4YHH C;  4DR4 C;  5A2Q D;  2HHH C;  2UXD C;  4X62 C;  4OX9 C;  1XMO C;  4KHP C;  1N32 C;  2E5L C;  1HNX C;  4JI1 C;  4K0K C;  1IBK C;  4LFC C;  3J7A D;  4BSZ A;  1IBM C;  2VQF C;  4LF8 C;  4DV4 C;  4GKK C;  4JI2 C;  4NXM C;  3T1Y C;  4DR1 C;  4B3S C;  4B3T C;  4DV3 C;  3OTO C;  4B3M C;  4LF7 C;  4JV5 C;  3T1H C; 
#chains in the Genus database with same CATH homology
 1YGT A;  2PG1 E;  2ZTB A;  3FM7 A;  1XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...