2PG1E

Structural analysis of a cytoplasmic dynein light chain-intermediate chain complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
molecule keywords Dynein light chain 1, cytoplasmic
total genus 27
structure length 104
sequence length 104
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03645 Tctex-1 Tctex-1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1140.40 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 2pg1E01
3FM7A 1YGTA 1XDXA 2PG1E
chains in the Genus database with same CATH superfamily
2UUCC 4DV0C 4JI7C 1IBKC 4DR4C 4B3MC 4JI6C 3FM7A 4DV1C 5BR8C 1HNXC 2UUBC 1HNZC 4JYAC 3J81D 1IBLC 5LMNC 2VQEC 4LF5C 4X62C 4X65C 4JI2C 4DV4C 3J7AD 4JI0C 2E5LC 4LF4C 3J80D 4JI8C 3JAMD 4B3RC 4DR2C 1J5EC 4DV5C 1IBMC 1XNRC 4JI1C 4DR3C 4NXMC 4KHPC 3OTOC 2UXDC 1XNQC 2PG1E 1HNWC 2HHHC 4LF7C 4GKKC 1XMQC 4BSZA 4LF6C 5IWAC 2UXCC 1XMOC 4LFCC 1N33C 4K0KC 4JI3C 4AQYC 4DUYC 4DV2C 4DR7C 4DR6C 5FLXD 3T1YC 4JI4C 5IT9D 4NXNC 4DR5C 2UU9C 4X64C 1XDXA 5A2QD 4B3TC 4GKJC 5LMUC 4DV6C 1N36C 4JV5C 4LFBC 2ZM6C 4LF8C 4OX9C 4YY3C 4JI5C 4YHHC 2VQFC 4DV7C 1HR0C 4DUZC 1N34C 4DV3C 4B3SC 4DR1C 4LF9C 2ZTBA 1I94C 1N32C 2UUAC 3T1HC 2F4VC 2UXBC 1YGTA 1FJGC 4LFAC 4X66C
chains in the Genus database with same CATH topology
3FM7A 1YGTA 2PG1E 2ZTBA 1XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM7 A;  1YGT A;  1XDX A;  2PG1 E; 
#chains in the Genus database with same CATH topology
 2UUC C;  4DV0 C;  4JI7 C;  1IBK C;  4DR4 C;  4B3M C;  4JI6 C;  3FM7 A;  4DV1 C;  5BR8 C;  1HNX C;  2UUB C;  1HNZ C;  4JYA C;  3J81 D;  1IBL C;  5LMN C;  2VQE C;  4LF5 C;  4X62 C;  4X65 C;  4JI2 C;  4DV4 C;  3J7A D;  4JI0 C;  2E5L C;  4LF4 C;  3J80 D;  4JI8 C;  3JAM D;  4B3R C;  4DR2 C;  1J5E C;  4DV5 C;  1IBM C;  1XNR C;  4JI1 C;  4DR3 C;  4NXM C;  4KHP C;  3OTO C;  2UXD C;  1XNQ C;  2PG1 E;  1HNW C;  2HHH C;  4LF7 C;  4GKK C;  1XMQ C;  4BSZ A;  4LF6 C;  5IWA C;  2UXC C;  1XMO C;  4LFC C;  1N33 C;  4K0K C;  4JI3 C;  4AQY C;  4DUY C;  4DV2 C;  4DR7 C;  4DR6 C;  5FLX D;  3T1Y C;  4JI4 C;  5IT9 D;  4NXN C;  4DR5 C;  2UU9 C;  4X64 C;  1XDX A;  5A2Q D;  4B3T C;  4GKJ C;  5LMU C;  4DV6 C;  1N36 C;  4JV5 C;  4LFB C;  2ZM6 C;  4LF8 C;  4OX9 C;  4YY3 C;  4JI5 C;  4YHH C;  2VQF C;  4DV7 C;  1HR0 C;  4DUZ C;  1N34 C;  4DV3 C;  4B3S C;  4DR1 C;  4LF9 C;  2ZTB A;  1I94 C;  1N32 C;  2UUA C;  3T1H C;  2F4V C;  2UXB C;  1YGT A;  1FJG C;  4LFA C;  4X66 C; 
#chains in the Genus database with same CATH homology
 3FM7 A;  1YGT A;  2PG1 E;  2ZTB A;  1XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...