4JI1C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji1C02
1HR0C 4JI6C 1XNRC 2UXBC 4NOZA 1ZB9A 4X64C 4DV4C 4JYAC 4JI3C 2E7GA 5A2QD 2CY1A 1VLAA 1L2FA 5LMNC 2UU9C 4DV2C 3I07A 1PA4A 3EERA 2BJOA 4DR4C 4DR3C 4JI2C 2KZFA 4B3MC 2E5LC 4MTNA 2E8FA 5LMUC 4JI4C 1UKKA 4LF9C 5IWAC 2UUCC 2PT7G 3LUSA 1N36C 3AF5A 4LF8C 1XMQC 3T1HC 2XR1A 1N2FA 4AQYC 1I94C 4DV5C 4OX9C 4GKJC 1N32C 1JOSA 4B3RC 2DYJA 2VQEC 4LF6C 3GKUA 4DR7C 4BSZA 5IT9D 4DV1C 1K0RA 2YCBA 4LF5C 3CJEA 4JI7C 3IEVA 3AF6A 4DV6C 4B3TC 2E8CA 3R9WA 1IBLC 4LFAC 4GKKC 1EGAA 2HHHC 1HNWC 4DR5C 4LF4C 1ZB8A 1HH2P 1MKYA 3R9XA 4DV7C 4X62C 4B3SC 4DCUA 1J5EC 4JI5C 4NXMC 4MH4A 3IEUA 4DUZC 5BR8C 2ONFA 4X66C 2E8EA 2HJGA 2JMPA 3J80D 2ZM6C 4LF7C 4KHPC 2QL8A 4YY3C 4JV5C 5FLXD 4LFCC 3J7AD 1XMOC 2F4VC 2UXCC 2OPLB 2PN2A 1USPB 2D7VA 4DCSA 2ASBA 4YHHC 4DR6C 2EGTA 2CXCA 2UUBC 2UXDC 3JAMD 4K0KC 1QWIA 1NYEA 4JI1C 3OTOC 4X65C 1IBMC 4JI8C 2VQFC 4DCVA 4DV0C 1N33C 1FJGC 1IBKC 4DCTA 1LQLA 1WH9A 3J81D 2UUAC 4JI0C 1N34C 1XNQC 4NXNC 4DUYC 4DV3C 4XX2A 1HNXC 2OPLA 2ATWA 1USPA 1WF3A 1KKGA 1HNZC 1ML8A 4DR1C 4DR2C 3T1YC 4LFBC
chains in the Genus database with same CATH superfamily
1O92A 2UXBC 4HPVA 4L4QA 4DV4C 4JI3C 2CY1A 1VLAA 3N54B 1PU1A 1RG9A 1MXCA 4ZLPA 2JNVA 4D57A 1YJ7A 5LMUC 3G7SA 5IWAC 2UUCC 2QW0X 2XR1A 3IPLA 1N2FA 2OBVA 1N32C 5BSVA 1JOSA 1QM4A 4PHTA 2VQEC 2AYAA 4BSZA 2M5HA 3FCCA 2ZTBA 4TPSB 2BH1X 3R9WA 5IFIA 4LFAC 4DG9A 4GXQA 4R1MA 3R44A 1MKYA 2MCQA 1MDFA 4PZPA 2MM9A 4I9GA 4JI5C 4NDNA 2P2MA 4DUZC 3A25A 2ONFA 1V26A 4R1LA 2P2JA 3N2QA 4YY3C 5GTDA 4DCSA 4YHHC 1XRAA 5BSWA 4DR6C 2EGTA 2YWBA 3TUFA 5CZXA 1O93A 4X65C 2VQFC 1M6XC 1FJGC 4KTVA 1LQLA 3GR1A 1N34C 3A9UA 4RVNA 1WF3A 5KEIA 3DHVA 1HNZC 4RMNA 3O2EA 4DR2C 1GPMA 3TDEA 1XNRC 4NOZA 4ODJA 2Z51A 2D1SA 4JYAC 2E7GA 5A2QD 1UWDA 3RV2A 3LNVA 4FUQA 5K85A 3RG2A 2QVYX 5DV9A 5AE2A 4DR4C 3UX2A 2E5LC 5ADZA 4PUHA 4D56A 1P7LA 1UKKA 2PT7G 1N36C 3AF5A 4LF8C 1XMQC 4L2ZA 3FCEA 4FUTA 4DV5C 2DYJA 5BUSA 1O9TA 4RLQA 4DR7C 1V60A 4BC9A 5IT9D 1ULTA 1K0RA 2YCBA 2VSQA 4GXRA 4GS5A 3CW9A 3CW8X 1TH5A 1WCJA 2D27A 4B3TC 1EGAA 4OYCA 1XS3A 2P2QA 3VNQA 4DCUA 1PG4A 2D28C 1O90A 3IMLA 2P20A 1MD9A 4L7IA 2JMPA 3J80D 2ZM6C 1V25A 1LCIA 4JV5C 4LFCC 3J7AD 1XMOC 2UXCC 2PN2A 2D1RA 1USPB 3LNOA 4BBYA 2WP0C 2D7VA 3A4IA 2UUBC 4PROC 3ETCA 1QWIA 2NCLA 1IBMC 2KDNA 2MMAB 5H9UA 1IBKC 4EATA 1WH9A 3GR0A 3NYRA 4PUIA 3E7WA 1XRBA 2OPLA 3K6RA 1KKGA 3A26A 4LF9C 4LFBC 1T5DX 4LE5A 5AE3A 2KZ0A 5KYTA 3DAYA 2ZZNA 1HR0C 2P02A 1ZB9A 3UEBA 4X64C 3S82A 5AE1A 3UOWA 3TQIA 2Y4OA 5LMNC 4DV2C 1MXAA 3PBKA 4DR3C 2KZFA 4JI2C 2M5OA 1MXBA 2E8FA 4KTTA 3UX3A 3LUSA 3LGXA 4G36A 4U5YD 3T1HC 4AQYC 2VZEA 4B3RC 4LF6C 3VNRA 3GKUA 2Y27A 4DV1C 3CQ1A 4LF5C 3CJEA 3IEVA 3AF6A 4DG8A 4DV6C 2E8CA 4GKKC 1FUGA 4DR5C 4LF4C 1HH2P 4JM1A 4X62C 4WS9A 1P4EA 4BCAA 5LCIA 2DHMA 3PROC 3IEUA 3LAXA 4IR7A 2E8EA 5BSTA 3KXWA 2HJGA 4RVOA 1FLOA 2P2FA 1T5HX 2D1QA 5CZVA 4BC7A 1IB8A 1BA3A 3CQ2A 2CXCA 3JAMD 1XHJA 4JI1C 3OTOC 4RM2A 4JI8C 3H2TA 3C5EA 4DCVA 3DLPX 3B7WA 3J81D 2UUAC 2P2BA 1XNQC 2ZZMA 4RM3A 4DV3C 4G1IA 1HNXC 4PUGA 3NI2A 3FM7A 1M6XA 1ML8A 4ISBA 3A9VA 1XDXA 2PG1E 4JI6C 1VEHA 2YWCA 3SO4A 1L2FA 1P4EC 2UU9C 3I07A 1PA4A 2QVZX 3EERA 3NYQA 4D4GA 2BJOA 3I08A 4B3MC 4IZ6A 4MTNA 4JI4C 4RLFA 5JRHA 3NPDA 3ETOA 4D4IA 1MDBA 1I94C 4OX9C 4GKJC 5T8SA 1YGTA 3TR3A 3L95X 5BURA 4JI7C 1RY2A 3PESA 1IBLC 4G37A 2HHHC 1HNWC 2E0GA 1ZB8A 3E7XA 3EQ6A 2CU6A 5BSRA 3R9XA 5KYVA 4DV7C 3CQ3A 5A1IA 2D1TA 4B3SC 4R0MA 1J5EC 4OXIA 5K8FA 4NXMC 1XRCA 3GPCA 4MH4A 5A1GA 5BR8C 5BUQA 4X66C 1AMUA 4LF7C 1NY8A 4KHPC 2QL8A 5FLXD 2F4VC 2OPLB 3VNSA 2ASBA 2WD9A 2Y4NA 2YX1A 4ZJZA 4FTFA 2UXDC 3AY0A 4K0KC 1NYEA 1PG3A 2QVXX 4I9FA 3UZ0A 4K0BA 4DV0C 1N33C 5A19A 2PROA 4DCTA 2V7BA 4JI0C 5T8TA 5E7QA 4NXNC 4WV3A 4DUYC 3L8CA 4XX2A 5BSMA 5BSUA 2ATWA 1USPA 2OO4A 4DR1C 2DPLA 3T1YC
chains in the Genus database with same CATH topology
1O92A 2UXBC 4HPVA 4L4QA 4DV4C 4JI3C 2CY1A 1VLAA 3N54B 1RG9A 1MXCA 4ZLPA 4D57A 1YJ7A 5LMUC 3G7SA 5IWAC 2UUCC 2QW0X 2XR1A 3IPLA 1N2FA 2OBVA 1N32C 5BSVA 1JOSA 1QM4A 4PHTA 2VQEC 2AYAA 4BSZA 3FCCA 4TPSB 2BH1X 3R9WA 5IFIA 4LFAC 4DG9A 4GXQA 4R1MA 3R44A 1MKYA 1MDFA 4PZPA 4I9GA 4JI5C 4NDNA 2P2MA 4DUZC 2ONFA 1V26A 4R1LA 2P2JA 3N2QA 4YY3C 5GTDA 4DCSA 4YHHC 1XRAA 5BSWA 4DR6C 2EGTA 2YWBA 3TUFA 5CZXA 1O93A 4X65C 2VQFC 1FJGC 4KTVA 1LQLA 3GR1A 1N34C 3A9UA 4RVNA 1WF3A 5KEIA 3DHVA 1HNZC 4RMNA 4DR2C 1GPMA 3TDEA 1XNRC 4NOZA 4ODJA 2D1SA 4JYAC 2E7GA 5A2QD 3RV2A 3LNVA 4FUQA 5K85A 3RG2A 2QVYX 5DV9A 5AE2A 4DR4C 2E5LC 5ADZA 4D56A 1P7LA 1UKKA 2PT7G 1N36C 3AF5A 4LF8C 1XMQC 4L2ZA 3FCEA 4FUTA 4DV5C 2DYJA 5BUSA 1O9TA 4RLQA 4DR7C 4BC9A 5IT9D 1ULTA 1K0RA 2YCBA 2VSQA 4GXRA 4GS5A 3CW9A 3CW8X 4B3TC 2D27A 1EGAA 4OYCA 2P2QA 3VNQA 4DCUA 1PG4A 2D28C 1O90A 3IMLA 2P20A 1MD9A 4L7IA 2JMPA 3J80D 2ZM6C 1V25A 1LCIA 4JV5C 4LFCC 3J7AD 1XMOC 2UXCC 2PN2A 2D1RA 1USPB 4BBYA 2WP0C 2D7VA 3A4IA 2UUBC 4PROC 3ETCA 1QWIA 1IBMC 5H9UA 1IBKC 4EATA 1WH9A 3GR0A 3NYRA 3E7WA 1XRBA 2OPLA 1KKGA 4LF9C 4LFBC 1T5DX 4LE5A 5AE3A 5KYTA 3DAYA 1HR0C 2P02A 1ZB9A 4X64C 3S82A 5AE1A 3UOWA 3TQIA 2Y4OA 5LMNC 4DV2C 1MXAA 3PBKA 4DR3C 2KZFA 4JI2C 1MXBA 2E8FA 4KTTA 3LUSA 3LGXA 4G36A 4U5YD 3T1HC 4AQYC 2VZEA 4B3RC 4LF6C 3VNRA 3GKUA 2Y27A 4DV1C 4LF5C 3CJEA 3IEVA 3AF6A 4DG8A 4DV6C 2E8CA 4GKKC 1FUGA 4DR5C 4LF4C 1HH2P 4JM1A 4X62C 4WS9A 4BCAA 3PROC 3IEUA 3LAXA 4IR7A 2E8EA 5BSTA 3KXWA 2HJGA 4RVOA 2P2FA 1T5HX 2D1QA 5CZVA 4BC7A 1BA3A 2CXCA 3JAMD 4JI1C 3OTOC 4RM2A 4JI8C 3H2TA 3C5EA 4DCVA 3DLPX 3B7WA 3J81D 2UUAC 2P2BA 1XNQC 4RM3A 4DV3C 4G1IA 1HNXC 3NI2A 1ML8A 4ISBA 3A9VA 4JI6C 2YWCA 3SO4A 1L2FA 2UU9C 3I07A 1PA4A 2QVZX 3EERA 3NYQA 4D4GA 2BJOA 3I08A 4B3MC 4IZ6A 4MTNA 4JI4C 4RLFA 5JRHA 3NPDA 3ETOA 4D4IA 1MDBA 1I94C 4OX9C 4GKJC 5T8SA 3L95X 5BURA 4JI7C 1RY2A 3PESA 1IBLC 4G37A 2HHHC 1HNWC 2E0GA 1ZB8A 3E7XA 3EQ6A 5BSRA 3R9XA 5KYVA 4DV7C 5A1IA 2D1TA 4B3SC 4R0MA 1J5EC 4OXIA 5K8FA 4NXMC 1XRCA 3GPCA 4MH4A 5A1GA 5BR8C 5BUQA 4X66C 1AMUA 4LF7C 4KHPC 2QL8A 5FLXD 2F4VC 2OPLB 3VNSA 2ASBA 2WD9A 2Y4NA 4ZJZA 4FTFA 2UXDC 4K0KC 1NYEA 1PG3A 2QVXX 4I9FA 3UZ0A 4K0BA 4DV0C 1N33C 5A19A 2PROA 4DCTA 2V7BA 4JI0C 5T8TA 5E7QA 4NXNC 4WV3A 4DUYC 3L8CA 4XX2A 5BSMA 5BSUA 2ATWA 1USPA 2OO4A 4DR1C 2DPLA 3T1YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 C;  4JI6 C;  1XNR C;  2UXB C;  4NOZ A;  1ZB9 A;  4X64 C;  4DV4 C;  4JYA C;  4JI3 C;  2E7G A;  5A2Q D;  2CY1 A;  1VLA A;  1L2F A;  5LMN C;  2UU9 C;  4DV2 C;  3I07 A;  1PA4 A;  3EER A;  2BJO A;  4DR4 C;  4DR3 C;  4JI2 C;  2KZF A;  4B3M C;  2E5L C;  4MTN A;  2E8F A;  5LMU C;  4JI4 C;  1UKK A;  4LF9 C;  5IWA C;  2UUC C;  2PT7 G;  3LUS A;  1N36 C;  3AF5 A;  4LF8 C;  1XMQ C;  3T1H C;  2XR1 A;  1N2F A;  4AQY C;  1I94 C;  4DV5 C;  4OX9 C;  4GKJ C;  1N32 C;  1JOS A;  4B3R C;  2DYJ A;  2VQE C;  4LF6 C;  3GKU A;  4DR7 C;  4BSZ A;  5IT9 D;  4DV1 C;  1K0R A;  2YCB A;  4LF5 C;  3CJE A;  4JI7 C;  3IEV A;  3AF6 A;  4DV6 C;  4B3T C;  2E8C A;  3R9W A;  1IBL C;  4LFA C;  4GKK C;  1EGA A;  2HHH C;  1HNW C;  4DR5 C;  4LF4 C;  1ZB8 A;  1HH2 P;  1MKY A;  3R9X A;  4DV7 C;  4X62 C;  4B3S C;  4DCU A;  1J5E C;  4JI5 C;  4NXM C;  4MH4 A;  3IEU A;  4DUZ C;  5BR8 C;  2ONF A;  4X66 C;  2E8E A;  2HJG A;  2JMP A;  3J80 D;  2ZM6 C;  4LF7 C;  4KHP C;  2QL8 A;  4YY3 C;  4JV5 C;  5FLX D;  4LFC C;  3J7A D;  1XMO C;  2F4V C;  2UXC C;  2OPL B;  2PN2 A;  1USP B;  2D7V A;  4DCS A;  2ASB A;  4YHH C;  4DR6 C;  2EGT A;  2CXC A;  2UUB C;  2UXD C;  3JAM D;  4K0K C;  1QWI A;  1NYE A;  4JI1 C;  3OTO C;  4X65 C;  1IBM C;  4JI8 C;  2VQF C;  4DCV A;  4DV0 C;  1N33 C;  1FJG C;  1IBK C;  4DCT A;  1LQL A;  1WH9 A;  3J81 D;  2UUA C;  4JI0 C;  1N34 C;  1XNQ C;  4NXN C;  4DUY C;  4DV3 C;  4XX2 A;  1HNX C;  2OPL A;  2ATW A;  1USP A;  1WF3 A;  1KKG A;  1HNZ C;  1ML8 A;  4DR1 C;  4DR2 C;  3T1Y C;  4LFB C; 
#chains in the Genus database with same CATH topology
 1O92 A;  2UXB C;  4HPV A;  4L4Q A;  4DV4 C;  4JI3 C;  2CY1 A;  1VLA A;  3N54 B;  1PU1 A;  1RG9 A;  1MXC A;  4ZLP A;  2JNV A;  4D57 A;  1YJ7 A;  5LMU C;  3G7S A;  5IWA C;  2UUC C;  2QW0 X;  2XR1 A;  3IPL A;  1N2F A;  2OBV A;  1N32 C;  5BSV A;  1JOS A;  1QM4 A;  4PHT A;  2VQE C;  2AYA A;  4BSZ A;  2M5H A;  3FCC A;  2ZTB A;  4TPS B;  2BH1 X;  3R9W A;  5IFI A;  4LFA C;  4DG9 A;  4GXQ A;  4R1M A;  3R44 A;  1MKY A;  2MCQ A;  1MDF A;  4PZP A;  2MM9 A;  4I9G A;  4JI5 C;  4NDN A;  2P2M A;  4DUZ C;  3A25 A;  2ONF A;  1V26 A;  4R1L A;  2P2J A;  3N2Q A;  4YY3 C;  5GTD A;  4DCS A;  4YHH C;  1XRA A;  5BSW A;  4DR6 C;  2EGT A;  2YWB A;  3TUF A;  5CZX A;  1O93 A;  4X65 C;  2VQF C;  1M6X C;  1FJG C;  4KTV A;  1LQL A;  3GR1 A;  1N34 C;  3A9U A;  4RVN A;  1WF3 A;  5KEI A;  3DHV A;  1HNZ C;  4RMN A;  3O2E A;  4DR2 C;  1GPM A;  3TDE A;  1XNR C;  4NOZ A;  4ODJ A;  2Z51 A;  2D1S A;  4JYA C;  2E7G A;  5A2Q D;  1UWD A;  3RV2 A;  3LNV A;  4FUQ A;  5K85 A;  3RG2 A;  2QVY X;  5DV9 A;  5AE2 A;  4DR4 C;  3UX2 A;  2E5L C;  5ADZ A;  4PUH A;  4D56 A;  1P7L A;  1UKK A;  2PT7 G;  1N36 C;  3AF5 A;  4LF8 C;  1XMQ C;  4L2Z A;  3FCE A;  4FUT A;  4DV5 C;  2DYJ A;  5BUS A;  1O9T A;  4RLQ A;  4DR7 C;  1V60 A;  4BC9 A;  5IT9 D;  1ULT A;  1K0R A;  2YCB A;  2VSQ A;  4GXR A;  4GS5 A;  3CW9 A;  3CW8 X;  1TH5 A;  1WCJ A;  2D27 A;  4B3T C;  1EGA A;  4OYC A;  1XS3 A;  2P2Q A;  3VNQ A;  4DCU A;  1PG4 A;  2D28 C;  1O90 A;  3IML A;  2P20 A;  1MD9 A;  4L7I A;  2JMP A;  3J80 D;  2ZM6 C;  1V25 A;  1LCI A;  4JV5 C;  4LFC C;  3J7A D;  1XMO C;  2UXC C;  2PN2 A;  2D1R A;  1USP B;  3LNO A;  4BBY A;  2WP0 C;  2D7V A;  3A4I A;  2UUB C;  4PRO C;  3ETC A;  1QWI A;  2NCL A;  1IBM C;  2KDN A;  2MMA B;  5H9U A;  1IBK C;  4EAT A;  1WH9 A;  3GR0 A;  3NYR A;  4PUI A;  3E7W A;  1XRB A;  2OPL A;  3K6R A;  1KKG A;  3A26 A;  4LF9 C;  4LFB C;  1T5D X;  4LE5 A;  5AE3 A;  2KZ0 A;  5KYT A;  3DAY A;  2ZZN A;  1HR0 C;  2P02 A;  1ZB9 A;  3UEB A;  4X64 C;  3S82 A;  5AE1 A;  3UOW A;  3TQI A;  2Y4O A;  5LMN C;  4DV2 C;  1MXA A;  3PBK A;  4DR3 C;  2KZF A;  4JI2 C;  2M5O A;  1MXB A;  2E8F A;  4KTT A;  3UX3 A;  3LUS A;  3LGX A;  4G36 A;  4U5Y D;  3T1H C;  4AQY C;  2VZE A;  4B3R C;  4LF6 C;  3VNR A;  3GKU A;  2Y27 A;  4DV1 C;  3CQ1 A;  4LF5 C;  3CJE A;  3IEV A;  3AF6 A;  4DG8 A;  4DV6 C;  2E8C A;  4GKK C;  1FUG A;  4DR5 C;  4LF4 C;  1HH2 P;  4JM1 A;  4X62 C;  4WS9 A;  1P4E A;  4BCA A;  5LCI A;  2DHM A;  3PRO C;  3IEU A;  3LAX A;  4IR7 A;  2E8E A;  5BST A;  3KXW A;  2HJG A;  4RVO A;  1FLO A;  2P2F A;  1T5H X;  2D1Q A;  5CZV A;  4BC7 A;  1IB8 A;  1BA3 A;  3CQ2 A;  2CXC A;  3JAM D;  1XHJ A;  4JI1 C;  3OTO C;  4RM2 A;  4JI8 C;  3H2T A;  3C5E A;  4DCV A;  3DLP X;  3B7W A;  3J81 D;  2UUA C;  2P2B A;  1XNQ C;  2ZZM A;  4RM3 A;  4DV3 C;  4G1I A;  1HNX C;  4PUG A;  3NI2 A;  3FM7 A;  1M6X A;  1ML8 A;  4ISB A;  3A9V A;  1XDX A;  2PG1 E;  4JI6 C;  1VEH A;  2YWC A;  3SO4 A;  1L2F A;  1P4E C;  2UU9 C;  3I07 A;  1PA4 A;  2QVZ X;  3EER A;  3NYQ A;  4D4G A;  2BJO A;  3I08 A;  4B3M C;  4IZ6 A;  4MTN A;  4JI4 C;  4RLF A;  5JRH A;  3NPD A;  3ETO A;  4D4I A;  1MDB A;  1I94 C;  4OX9 C;  4GKJ C;  5T8S A;  1YGT A;  3TR3 A;  3L95 X;  5BUR A;  4JI7 C;  1RY2 A;  3PES A;  1IBL C;  4G37 A;  2HHH C;  1HNW C;  2E0G A;  1ZB8 A;  3E7X A;  3EQ6 A;  2CU6 A;  5BSR A;  3R9X A;  5KYV A;  4DV7 C;  3CQ3 A;  5A1I A;  2D1T A;  4B3S C;  4R0M A;  1J5E C;  4OXI A;  5K8F A;  4NXM C;  1XRC A;  3GPC A;  4MH4 A;  5A1G A;  5BR8 C;  5BUQ A;  4X66 C;  1AMU A;  4LF7 C;  1NY8 A;  4KHP C;  2QL8 A;  5FLX D;  2F4V C;  2OPL B;  3VNS A;  2ASB A;  2WD9 A;  2Y4N A;  2YX1 A;  4ZJZ A;  4FTF A;  2UXD C;  3AY0 A;  4K0K C;  1NYE A;  1PG3 A;  2QVX X;  4I9F A;  3UZ0 A;  4K0B A;  4DV0 C;  1N33 C;  5A19 A;  2PRO A;  4DCT A;  2V7B A;  4JI0 C;  5T8T A;  5E7Q A;  4NXN C;  4WV3 A;  4DUY C;  3L8C A;  4XX2 A;  5BSM A;  5BSU A;  2ATW A;  1USP A;  2OO4 A;  4DR1 C;  2DPL A;  3T1Y C; 
#chains in the Genus database with same CATH homology
 1O92 A;  2UXB C;  4HPV A;  4L4Q A;  4DV4 C;  4JI3 C;  2CY1 A;  1VLA A;  3N54 B;  1RG9 A;  1MXC A;  4ZLP A;  4D57 A;  1YJ7 A;  5LMU C;  3G7S A;  5IWA C;  2UUC C;  2QW0 X;  2XR1 A;  3IPL A;  1N2F A;  2OBV A;  1N32 C;  5BSV A;  1JOS A;  1QM4 A;  4PHT A;  2VQE C;  2AYA A;  4BSZ A;  3FCC A;  4TPS B;  2BH1 X;  3R9W A;  5IFI A;  4LFA C;  4DG9 A;  4GXQ A;  4R1M A;  3R44 A;  1MKY A;  1MDF A;  4PZP A;  4I9G A;  4JI5 C;  4NDN A;  2P2M A;  4DUZ C;  2ONF A;  1V26 A;  4R1L A;  2P2J A;  3N2Q A;  4YY3 C;  5GTD A;  4DCS A;  4YHH C;  1XRA A;  5BSW A;  4DR6 C;  2EGT A;  2YWB A;  3TUF A;  5CZX A;  1O93 A;  4X65 C;  2VQF C;  1FJG C;  4KTV A;  1LQL A;  3GR1 A;  1N34 C;  3A9U A;  4RVN A;  1WF3 A;  5KEI A;  3DHV A;  1HNZ C;  4RMN A;  4DR2 C;  1GPM A;  3TDE A;  1XNR C;  4NOZ A;  4ODJ A;  2D1S A;  4JYA C;  2E7G A;  5A2Q D;  3RV2 A;  3LNV A;  4FUQ A;  5K85 A;  3RG2 A;  2QVY X;  5DV9 A;  5AE2 A;  4DR4 C;  2E5L C;  5ADZ A;  4D56 A;  1P7L A;  1UKK A;  2PT7 G;  1N36 C;  3AF5 A;  4LF8 C;  1XMQ C;  4L2Z A;  3FCE A;  4FUT A;  4DV5 C;  2DYJ A;  5BUS A;  1O9T A;  4RLQ A;  4DR7 C;  4BC9 A;  5IT9 D;  1ULT A;  1K0R A;  2YCB A;  2VSQ A;  4GXR A;  4GS5 A;  3CW9 A;  3CW8 X;  4B3T C;  2D27 A;  1EGA A;  4OYC A;  2P2Q A;  3VNQ A;  4DCU A;  1PG4 A;  2D28 C;  1O90 A;  3IML A;  2P20 A;  1MD9 A;  4L7I A;  2JMP A;  3J80 D;  2ZM6 C;  1V25 A;  1LCI A;  4JV5 C;  4LFC C;  3J7A D;  1XMO C;  2UXC C;  2PN2 A;  2D1R A;  1USP B;  4BBY A;  2WP0 C;  2D7V A;  3A4I A;  2UUB C;  4PRO C;  3ETC A;  1QWI A;  1IBM C;  5H9U A;  1IBK C;  4EAT A;  1WH9 A;  3GR0 A;  3NYR A;  3E7W A;  1XRB A;  2OPL A;  1KKG A;  4LF9 C;  4LFB C;  1T5D X;  4LE5 A;  5AE3 A;  5KYT A;  3DAY A;  1HR0 C;  2P02 A;  1ZB9 A;  4X64 C;  3S82 A;  5AE1 A;  3UOW A;  3TQI A;  2Y4O A;  5LMN C;  4DV2 C;  1MXA A;  3PBK A;  4DR3 C;  2KZF A;  4JI2 C;  1MXB A;  2E8F A;  4KTT A;  3LUS A;  3LGX A;  4G36 A;  4U5Y D;  3T1H C;  4AQY C;  2VZE A;  4B3R C;  4LF6 C;  3VNR A;  3GKU A;  2Y27 A;  4DV1 C;  4LF5 C;  3CJE A;  3IEV A;  3AF6 A;  4DG8 A;  4DV6 C;  2E8C A;  4GKK C;  1FUG A;  4DR5 C;  4LF4 C;  1HH2 P;  4JM1 A;  4X62 C;  4WS9 A;  4BCA A;  3PRO C;  3IEU A;  3LAX A;  4IR7 A;  2E8E A;  5BST A;  3KXW A;  2HJG A;  4RVO A;  2P2F A;  1T5H X;  2D1Q A;  5CZV A;  4BC7 A;  1BA3 A;  2CXC A;  3JAM D;  4JI1 C;  3OTO C;  4RM2 A;  4JI8 C;  3H2T A;  3C5E A;  4DCV A;  3DLP X;  3B7W A;  3J81 D;  2UUA C;  2P2B A;  1XNQ C;  4RM3 A;  4DV3 C;  4G1I A;  1HNX C;  3NI2 A;  1ML8 A;  4ISB A;  3A9V A;  4JI6 C;  2YWC A;  3SO4 A;  1L2F A;  2UU9 C;  3I07 A;  1PA4 A;  2QVZ X;  3EER A;  3NYQ A;  4D4G A;  2BJO A;  3I08 A;  4B3M C;  4IZ6 A;  4MTN A;  4JI4 C;  4RLF A;  5JRH A;  3NPD A;  3ETO A;  4D4I A;  1MDB A;  1I94 C;  4OX9 C;  4GKJ C;  5T8S A;  3L95 X;  5BUR A;  4JI7 C;  1RY2 A;  3PES A;  1IBL C;  4G37 A;  2HHH C;  1HNW C;  2E0G A;  1ZB8 A;  3E7X A;  3EQ6 A;  5BSR A;  3R9X A;  5KYV A;  4DV7 C;  5A1I A;  2D1T A;  4B3S C;  4R0M A;  1J5E C;  4OXI A;  5K8F A;  4NXM C;  1XRC A;  3GPC A;  4MH4 A;  5A1G A;  5BR8 C;  5BUQ A;  4X66 C;  1AMU A;  4LF7 C;  4KHP C;  2QL8 A;  5FLX D;  2F4V C;  2OPL B;  3VNS A;  2ASB A;  2WD9 A;  2Y4N A;  4ZJZ A;  4FTF A;  2UXD C;  4K0K C;  1NYE A;  1PG3 A;  2QVX X;  4I9F A;  3UZ0 A;  4K0B A;  4DV0 C;  1N33 C;  5A19 A;  2PRO A;  4DCT A;  2V7B A;  4JI0 C;  5T8T A;  5E7Q A;  4NXN C;  4WV3 A;  4DUY C;  3L8C A;  4XX2 A;  5BSM A;  5BSU A;  2ATW A;  1USP A;  2OO4 A;  4DR1 C;  2DPL A;  3T1Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...