4JI1C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji1C02
1FJGC 4KHPC 4DCTA 4K0KC 4LF9C 4JI2C 2UXDC 4DV6C 1HNXC 4LFCC 2CY1A 5IT9D 1WF3A 3GKUA 2E8CA 1HNWC 2VQFC 4X62C 3AF5A 5IWAC 4DV0C 1N34C 1ZB8A 2UUBC 2JMPA 2E7GA 2HHHC 1XNRC 2YCBA 4JI4C 1N36C 5LMNC 1JOSA 1ZB9A 4DR5C 2KZFA 2XR1A 5A2QD 2UUCC 4JI6C 1MKYA 1IBKC 1I94C 4JI0C 1USPA 4LF4C 1HH2P 2E5LC 4OX9C 3EERA 4YY3C 2E8FA 3J81D 4DV2C 4DCVA 4DUZC 5LMUC 2E8EA 1J5EC 3IEUA 1KKGA 1XNQC 4NXMC 5FLXD 3OTOC 4MTNA 4JI8C 3LUSA 4LFBC 4JV5C 4MH4A 1USPB 1N32C 4XX2A 3I07A 4DR4C 4DV7C 4DV4C 4GKKC 3R9WA 4DUYC 4DV3C 1K0RA 4DR1C 1LQLA 1QWIA 2UXCC 1EGAA 1NYEA 4LF8C 4YHHC 4LF6C 3AF6A 2DYJA 3IEVA 3CJEA 3JAMD 4B3RC 1WH9A 4NXNC 1N33C 4JI3C 2QL8A 2ATWA 4X66C 1N2FA 3T1YC 4DV1C 4NOZA 4GKJC 2OPLA 1XMOC 1PA4A 4LF7C 2HJGA 2ZM6C 1ML8A 2PT7G 4LF5C 2ONFA 2PN2A 2VQEC 3T1HC 2F4VC 4DR3C 4DCSA 4DR7C 4LFAC 4JI1C 4DR2C 4JI5C 2D7VA 4B3SC 2BJOA 2ASBA 4B3MC 4X64C 2UXBC 1HNZC 1HR0C 2OPLB 1IBLC 2EGTA 4B3TC 4AQYC 1L2FA 4BSZA 3J7AD 1IBMC 2UU9C 1XMQC 3R9XA 5BR8C 4X65C 1VLAA 2UUAC 4DCUA 4JI7C 4DR6C 3J80D 1UKKA 4DV5C 4JYAC 2CXCA
chains in the Genus database with same CATH superfamily
3DHVA 4KHPC 4K0KC 2PG1E 2M5OA 2PROA 4DV6C 3GKUA 3A25A 5KYTA 3E7XA 2VQFC 5A1IA 3CW8X 4X62C 3AF5A 1N34C 3A9VA 4I9FA 1NY8A 5AE3A 1BA3A 1P7LA 2M5HA 2D28C 4PUGA 1JOSA 4G37A 3H2TA 2Y4OA 3AY0A 1MKYA 4LF4C 1USPA 3CW9A 1QM4A 4IR7A 5BUSA 3EERA 4YY3C 1M6XA 3GR0A 4DUZC 5LMUC 2E8EA 3IEUA 2D1RA 4R0MA 1MXBA 4MTNA 3OTOC 2YWBA 3LUSA 4G1IA 1FUGA 1O92A 1USPB 4XX2A 4DR4C 4DV7C 1AMUA 2MCQA 4GKKC 3N2QA 4DUYC 4LF8C 1NYEA 4RVNA 4YHHC 4LF6C 4RMNA 1XRCA 3IEVA 3CJEA 3TDEA 1N33C 2ATWA 5AE1A 4DV1C 2P2BA 2MMAB 2P2FA 2PT7G 2P2JA 2D27A 5T8TA 3L8CA 2PN2A 2F4VC 3UZ0A 4LFAC 2BJOA 2ASBA 2UXBC 4L2ZA 4R1LA 1HR0C 5ADZA 3NYRA 1VLAA 3NYQA 3RV2A 4DCUA 3A9UA 4JI7C 2WP0C 4JYAC 1FJGC 4DCTA 4FUQA 1MXAA 1XS3A 1GPMA 3TQIA 5GTDA 3N54B 1WF3A 3LNOA 2WD9A 2Z51A 3GPCA 2JMPA 2E7GA 3NPDA 2HHHC 1XRBA 3UX3A 2KZFA 5BURA 5A2QD 2UUCC 4JI0C 4ZJZA 2E5LC 3TR3A 4DG9A 5H9UA 3LNVA 4DV2C 3PBKA 4ODJA 3FCEA 2KZ0A 4G36A 4R1MA 4NXMC 5FLXD 1XDXA 4MH4A 4PROC 1N32C 1LCIA 5JRHA 3VNQA 1XHJA 3KXWA 2UXCC 1LQLA 1O9TA 1QWIA 5BUQA 3UX2A 4ISBA 2DYJA 1TH5A 4B3RC 5BSTA 3O2EA 4OYCA 2QL8A 3LAXA 5BSVA 4X66C 1N2FA 5BSWA 3K6RA 2DPLA 4GKJC 2JNVA 1T5DX 1PA4A 1WCJA 5CZXA 2HJGA 5A19A 1ML8A 3E7WA 3PROC 5BSUA 2NCLA 4KTVA 5K8FA 2ZZMA 4WV3A 5LCIA 2ONFA 2VQEC 4K0BA 4JM1A 3R44A 3VNSA 4B3SC 4X64C 3RG2A 3UOWA 4OXIA 3FCCA 1IBLC 2EGTA 3J7AD 3R9XA 4X65C 4FTFA 4L7IA 1FLOA 3C5EA 5E7QA 4PHTA 1MDBA 4LF5C 3A4IA 1PU1A 4LF9C 2D1TA 1V26A 4JI2C 1O93A 3I08A 4LE5A 1P4EA 4LFCC 2ZTBA 2E8CA 1PG4A 3SO4A 5IWAC 1ZB8A 2KDNA 2V7BA 4D56A 3ETOA 4HPVA 2YWCA 1XNRC 4JI4C 1N36C 4RM2A 2MM9A 4BBYA 2P20A 1I94C 4GS5A 2D1SA 4OX9C 2D1QA 1MDFA 3GR1A 2E8FA 4GXRA 1RG9A 2QW0X 1T5HX 2OO4A 4RM3A 1KKGA 1XNQC 4TPSB 1O90A 1M6XC 4LFBC 1V25A 3I07A 1V60A 3UEBA 4DV4C 3B7WA 5BSMA 3DLPX 3G7SA 2Y27A 4DR1C 1K0RA 2VSQA 4PZPA 3AF6A 3JAMD 1WH9A 5K85A 4JI3C 3T1YC 2CU6A 4BC7A 1XMOC 4IZ6A 5AE2A 1XRAA 2ZM6C 5IFIA 5KEIA 1MD9A 4BC9A 1YGTA 4DCSA 4DR7C 4JI1C 4DR2C 2D7VA 5KYVA 1HNZC 2OPLB 4BCAA 4B3TC 4AQYC 4RLFA 1L2FA 3L95X 1IBMC 1XMQC 4U5YD 1YJ7A 4PUHA 4RVOA 3CQ3A 1UKKA 5CZVA 2YX1A 4I9GA 3CQ1A 2UXDC 3TUFA 2P02A 1HNXC 1RY2A 2CY1A 5IT9D 5BSRA 1HNWC 3LGXA 1ULTA 4D4GA 4DV0C 2UUBC 3IPLA 2DHMA 2YCBA 4ZLPA 5LMNC 4D4IA 4DR5C 1ZB9A 2XR1A 4JI6C 4GXQA 1IBKC 1HH2P 2BH1X 3S82A 3J81D 4DCVA 4NDNA 1P4EC 1J5EC 1VEHA 3DAYA 2AYAA 5A1GA 4JI8C 2VZEA 4JV5C 3ETCA 4WS9A 2OBVA 4PUIA 2P2MA 4L4QA 3PESA 3R9WA 4D57A 4RLQA 4DV3C 2QVYX 1EGAA 3NI2A 2ZZNA 3CQ2A 2E0GA 3VNRA 4NXNC 4EATA 3EQ6A 3IMLA 5T8SA 4NOZA 2OPLA 4LF7C 1IB8A 5DV9A 3FM7A 2QVZX 4DG8A 3T1HC 4DR3C 4FUTA 1UWDA 4JI5C 1MXCA 4B3MC 4KTTA 2QVXX 1PG3A 4BSZA 2UU9C 5BR8C 2Y4NA 2UUAC 3A26A 2P2QA 4DR6C 3J80D 4DV5C 2CXCA
chains in the Genus database with same CATH topology
3DHVA 4KHPC 4K0KC 2PROA 4DV6C 3GKUA 5KYTA 3E7XA 2VQFC 5A1IA 3CW8X 4X62C 3AF5A 1N34C 3A9VA 4I9FA 5AE3A 1BA3A 1P7LA 2D28C 1JOSA 4G37A 3H2TA 2Y4OA 1MKYA 4LF4C 1USPA 3CW9A 1QM4A 4IR7A 5BUSA 3EERA 4YY3C 3GR0A 4DUZC 5LMUC 2E8EA 3IEUA 2D1RA 4R0MA 1MXBA 4MTNA 3OTOC 2YWBA 3LUSA 4G1IA 1FUGA 1O92A 1USPB 4XX2A 4DR4C 4DV7C 1AMUA 4GKKC 3N2QA 4DUYC 4LF8C 1NYEA 4RVNA 4YHHC 4LF6C 4RMNA 1XRCA 3IEVA 3CJEA 3TDEA 1N33C 2ATWA 5AE1A 4DV1C 2P2BA 2P2FA 2PT7G 2P2JA 2D27A 5T8TA 3L8CA 2PN2A 2F4VC 3UZ0A 4LFAC 2BJOA 2ASBA 2UXBC 4L2ZA 4R1LA 1HR0C 5ADZA 3NYRA 1VLAA 3NYQA 3RV2A 4DCUA 3A9UA 4JI7C 2WP0C 4JYAC 1FJGC 4DCTA 4FUQA 1MXAA 3TQIA 1GPMA 5GTDA 3N54B 1WF3A 2WD9A 3GPCA 2JMPA 2E7GA 3NPDA 2HHHC 1XRBA 2KZFA 5BURA 5A2QD 2UUCC 4JI0C 4ZJZA 2E5LC 4DG9A 5H9UA 3LNVA 4DV2C 3PBKA 4ODJA 3FCEA 4G36A 4R1MA 4NXMC 5FLXD 4MH4A 4PROC 1N32C 1LCIA 5JRHA 3VNQA 3KXWA 2UXCC 1LQLA 1O9TA 1QWIA 5BUQA 4ISBA 2DYJA 4B3RC 5BSTA 4OYCA 2QL8A 3LAXA 5BSVA 4X66C 1N2FA 5BSWA 2DPLA 4GKJC 1T5DX 1PA4A 5CZXA 2HJGA 5A19A 1ML8A 3E7WA 3PROC 5BSUA 4KTVA 5K8FA 4WV3A 2ONFA 2VQEC 4K0BA 4JM1A 3R44A 3VNSA 4B3SC 4X64C 3RG2A 3UOWA 4OXIA 3FCCA 1IBLC 2EGTA 3J7AD 3R9XA 4X65C 4FTFA 4L7IA 3C5EA 5E7QA 4PHTA 4LF5C 1MDBA 3A4IA 4LF9C 2D1TA 1V26A 4JI2C 1O93A 3I08A 4LE5A 4LFCC 2E8CA 1PG4A 3SO4A 5IWAC 1ZB8A 2V7BA 4D56A 3ETOA 4HPVA 2YWCA 1XNRC 4JI4C 1N36C 4RM2A 4BBYA 2P20A 1I94C 4GS5A 2D1SA 4OX9C 2D1QA 1MDFA 3GR1A 2E8FA 4GXRA 1RG9A 2QW0X 1T5HX 2OO4A 4RM3A 1KKGA 1XNQC 4TPSB 1O90A 4LFBC 1V25A 3I07A 4DV4C 3B7WA 5BSMA 3DLPX 3G7SA 2Y27A 4DR1C 1K0RA 2VSQA 4PZPA 3AF6A 3JAMD 1WH9A 5K85A 4JI3C 3T1YC 4BC7A 1XMOC 4IZ6A 5AE2A 1XRAA 2ZM6C 5IFIA 5KEIA 1MD9A 4BC9A 4DCSA 4DR7C 4JI1C 4DR2C 2D7VA 5KYVA 1HNZC 2OPLB 4BCAA 4B3TC 4AQYC 4RLFA 1L2FA 3L95X 1IBMC 1XMQC 1YJ7A 4U5YD 4RVOA 1UKKA 5CZVA 4I9GA 2UXDC 3TUFA 2P02A 1HNXC 1RY2A 2CY1A 5IT9D 5BSRA 1HNWC 3LGXA 1ULTA 4D4GA 4DV0C 2UUBC 3IPLA 2YCBA 4ZLPA 5LMNC 4D4IA 1ZB9A 4DR5C 2XR1A 4JI6C 4GXQA 1IBKC 1HH2P 2BH1X 3S82A 3J81D 4DCVA 4NDNA 1J5EC 3DAYA 2AYAA 5A1GA 4JI8C 2VZEA 4JV5C 3ETCA 4WS9A 2OBVA 2P2MA 4L4QA 3PESA 3R9WA 4D57A 4RLQA 4DV3C 2QVYX 1EGAA 3NI2A 2E0GA 3VNRA 4NXNC 4EATA 3EQ6A 3IMLA 5T8SA 4NOZA 2OPLA 4LF7C 5DV9A 2QVZX 4DG8A 3T1HC 4DR3C 4FUTA 4JI5C 1MXCA 4B3MC 4KTTA 2QVXX 1PG3A 4BSZA 2UU9C 5BR8C 2UUAC 2Y4NA 2P2QA 4DR6C 3J80D 4DV5C 2CXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG C;  4KHP C;  4DCT A;  4K0K C;  4LF9 C;  4JI2 C;  2UXD C;  4DV6 C;  1HNX C;  4LFC C;  2CY1 A;  5IT9 D;  1WF3 A;  3GKU A;  2E8C A;  1HNW C;  2VQF C;  4X62 C;  3AF5 A;  5IWA C;  4DV0 C;  1N34 C;  1ZB8 A;  2UUB C;  2JMP A;  2E7G A;  2HHH C;  1XNR C;  2YCB A;  4JI4 C;  1N36 C;  5LMN C;  1JOS A;  1ZB9 A;  4DR5 C;  2KZF A;  2XR1 A;  5A2Q D;  2UUC C;  4JI6 C;  1MKY A;  1IBK C;  1I94 C;  4JI0 C;  1USP A;  4LF4 C;  1HH2 P;  2E5L C;  4OX9 C;  3EER A;  4YY3 C;  2E8F A;  3J81 D;  4DV2 C;  4DCV A;  4DUZ C;  5LMU C;  2E8E A;  1J5E C;  3IEU A;  1KKG A;  1XNQ C;  4NXM C;  5FLX D;  3OTO C;  4MTN A;  4JI8 C;  3LUS A;  4LFB C;  4JV5 C;  4MH4 A;  1USP B;  1N32 C;  4XX2 A;  3I07 A;  4DR4 C;  4DV7 C;  4DV4 C;  4GKK C;  3R9W A;  4DUY C;  4DV3 C;  1K0R A;  4DR1 C;  1LQL A;  1QWI A;  2UXC C;  1EGA A;  1NYE A;  4LF8 C;  4YHH C;  4LF6 C;  3AF6 A;  2DYJ A;  3IEV A;  3CJE A;  3JAM D;  4B3R C;  1WH9 A;  4NXN C;  1N33 C;  4JI3 C;  2QL8 A;  2ATW A;  4X66 C;  1N2F A;  3T1Y C;  4DV1 C;  4NOZ A;  4GKJ C;  2OPL A;  1XMO C;  1PA4 A;  4LF7 C;  2HJG A;  2ZM6 C;  1ML8 A;  2PT7 G;  4LF5 C;  2ONF A;  2PN2 A;  2VQE C;  3T1H C;  2F4V C;  4DR3 C;  4DCS A;  4DR7 C;  4LFA C;  4JI1 C;  4DR2 C;  4JI5 C;  2D7V A;  4B3S C;  2BJO A;  2ASB A;  4B3M C;  4X64 C;  2UXB C;  1HNZ C;  1HR0 C;  2OPL B;  1IBL C;  2EGT A;  4B3T C;  4AQY C;  1L2F A;  4BSZ A;  3J7A D;  1IBM C;  2UU9 C;  1XMQ C;  3R9X A;  5BR8 C;  4X65 C;  1VLA A;  2UUA C;  4DCU A;  4JI7 C;  4DR6 C;  3J80 D;  1UKK A;  4DV5 C;  4JYA C;  2CXC A; 
#chains in the Genus database with same CATH topology
 3DHV A;  4KHP C;  4K0K C;  2PG1 E;  2M5O A;  2PRO A;  4DV6 C;  3GKU A;  3A25 A;  5KYT A;  3E7X A;  2VQF C;  5A1I A;  3CW8 X;  4X62 C;  3AF5 A;  1N34 C;  3A9V A;  4I9F A;  1NY8 A;  5AE3 A;  1BA3 A;  1P7L A;  2M5H A;  2D28 C;  4PUG A;  1JOS A;  4G37 A;  3H2T A;  2Y4O A;  3AY0 A;  1MKY A;  4LF4 C;  1USP A;  3CW9 A;  1QM4 A;  4IR7 A;  5BUS A;  3EER A;  4YY3 C;  1M6X A;  3GR0 A;  4DUZ C;  5LMU C;  2E8E A;  3IEU A;  2D1R A;  4R0M A;  1MXB A;  4MTN A;  3OTO C;  2YWB A;  3LUS A;  4G1I A;  1FUG A;  1O92 A;  1USP B;  4XX2 A;  4DR4 C;  4DV7 C;  1AMU A;  2MCQ A;  4GKK C;  3N2Q A;  4DUY C;  4LF8 C;  1NYE A;  4RVN A;  4YHH C;  4LF6 C;  4RMN A;  1XRC A;  3IEV A;  3CJE A;  3TDE A;  1N33 C;  2ATW A;  5AE1 A;  4DV1 C;  2P2B A;  2MMA B;  2P2F A;  2PT7 G;  2P2J A;  2D27 A;  5T8T A;  3L8C A;  2PN2 A;  2F4V C;  3UZ0 A;  4LFA C;  2BJO A;  2ASB A;  2UXB C;  4L2Z A;  4R1L A;  1HR0 C;  5ADZ A;  3NYR A;  1VLA A;  3NYQ A;  3RV2 A;  4DCU A;  3A9U A;  4JI7 C;  2WP0 C;  4JYA C;  1FJG C;  4DCT A;  4FUQ A;  1MXA A;  1XS3 A;  1GPM A;  3TQI A;  5GTD A;  3N54 B;  1WF3 A;  3LNO A;  2WD9 A;  2Z51 A;  3GPC A;  2JMP A;  2E7G A;  3NPD A;  2HHH C;  1XRB A;  3UX3 A;  2KZF A;  5BUR A;  5A2Q D;  2UUC C;  4JI0 C;  4ZJZ A;  2E5L C;  3TR3 A;  4DG9 A;  5H9U A;  3LNV A;  4DV2 C;  3PBK A;  4ODJ A;  3FCE A;  2KZ0 A;  4G36 A;  4R1M A;  4NXM C;  5FLX D;  1XDX A;  4MH4 A;  4PRO C;  1N32 C;  1LCI A;  5JRH A;  3VNQ A;  1XHJ A;  3KXW A;  2UXC C;  1LQL A;  1O9T A;  1QWI A;  5BUQ A;  3UX2 A;  4ISB A;  2DYJ A;  1TH5 A;  4B3R C;  5BST A;  3O2E A;  4OYC A;  2QL8 A;  3LAX A;  5BSV A;  4X66 C;  1N2F A;  5BSW A;  3K6R A;  2DPL A;  4GKJ C;  2JNV A;  1T5D X;  1PA4 A;  1WCJ A;  5CZX A;  2HJG A;  5A19 A;  1ML8 A;  3E7W A;  3PRO C;  5BSU A;  2NCL A;  4KTV A;  5K8F A;  2ZZM A;  4WV3 A;  5LCI A;  2ONF A;  2VQE C;  4K0B A;  4JM1 A;  3R44 A;  3VNS A;  4B3S C;  4X64 C;  3RG2 A;  3UOW A;  4OXI A;  3FCC A;  1IBL C;  2EGT A;  3J7A D;  3R9X A;  4X65 C;  4FTF A;  4L7I A;  1FLO A;  3C5E A;  5E7Q A;  4PHT A;  1MDB A;  4LF5 C;  3A4I A;  1PU1 A;  4LF9 C;  2D1T A;  1V26 A;  4JI2 C;  1O93 A;  3I08 A;  4LE5 A;  1P4E A;  4LFC C;  2ZTB A;  2E8C A;  1PG4 A;  3SO4 A;  5IWA C;  1ZB8 A;  2KDN A;  2V7B A;  4D56 A;  3ETO A;  4HPV A;  2YWC A;  1XNR C;  4JI4 C;  1N36 C;  4RM2 A;  2MM9 A;  4BBY A;  2P20 A;  1I94 C;  4GS5 A;  2D1S A;  4OX9 C;  2D1Q A;  1MDF A;  3GR1 A;  2E8F A;  4GXR A;  1RG9 A;  2QW0 X;  1T5H X;  2OO4 A;  4RM3 A;  1KKG A;  1XNQ C;  4TPS B;  1O90 A;  1M6X C;  4LFB C;  1V25 A;  3I07 A;  1V60 A;  3UEB A;  4DV4 C;  3B7W A;  5BSM A;  3DLP X;  3G7S A;  2Y27 A;  4DR1 C;  1K0R A;  2VSQ A;  4PZP A;  3AF6 A;  3JAM D;  1WH9 A;  5K85 A;  4JI3 C;  3T1Y C;  2CU6 A;  4BC7 A;  1XMO C;  4IZ6 A;  5AE2 A;  1XRA A;  2ZM6 C;  5IFI A;  5KEI A;  1MD9 A;  4BC9 A;  1YGT A;  4DCS A;  4DR7 C;  4JI1 C;  4DR2 C;  2D7V A;  5KYV A;  1HNZ C;  2OPL B;  4BCA A;  4B3T C;  4AQY C;  4RLF A;  1L2F A;  3L95 X;  1IBM C;  1XMQ C;  4U5Y D;  1YJ7 A;  4PUH A;  4RVO A;  3CQ3 A;  1UKK A;  5CZV A;  2YX1 A;  4I9G A;  3CQ1 A;  2UXD C;  3TUF A;  2P02 A;  1HNX C;  1RY2 A;  2CY1 A;  5IT9 D;  5BSR A;  1HNW C;  3LGX A;  1ULT A;  4D4G A;  4DV0 C;  2UUB C;  3IPL A;  2DHM A;  2YCB A;  4ZLP A;  5LMN C;  4D4I A;  4DR5 C;  1ZB9 A;  2XR1 A;  4JI6 C;  4GXQ A;  1IBK C;  1HH2 P;  2BH1 X;  3S82 A;  3J81 D;  4DCV A;  4NDN A;  1P4E C;  1J5E C;  1VEH A;  3DAY A;  2AYA A;  5A1G A;  4JI8 C;  2VZE A;  4JV5 C;  3ETC A;  4WS9 A;  2OBV A;  4PUI A;  2P2M A;  4L4Q A;  3PES A;  3R9W A;  4D57 A;  4RLQ A;  4DV3 C;  2QVY X;  1EGA A;  3NI2 A;  2ZZN A;  3CQ2 A;  2E0G A;  3VNR A;  4NXN C;  4EAT A;  3EQ6 A;  3IML A;  5T8S A;  4NOZ A;  2OPL A;  4LF7 C;  1IB8 A;  5DV9 A;  3FM7 A;  2QVZ X;  4DG8 A;  3T1H C;  4DR3 C;  4FUT A;  1UWD A;  4JI5 C;  1MXC A;  4B3M C;  4KTT A;  2QVX X;  1PG3 A;  4BSZ A;  2UU9 C;  5BR8 C;  2Y4N A;  2UUA C;  3A26 A;  2P2Q A;  4DR6 C;  3J80 D;  4DV5 C;  2CXC A; 
#chains in the Genus database with same CATH homology
 3DHV A;  4KHP C;  4K0K C;  2PRO A;  4DV6 C;  3GKU A;  5KYT A;  3E7X A;  2VQF C;  5A1I A;  3CW8 X;  4X62 C;  3AF5 A;  1N34 C;  3A9V A;  4I9F A;  5AE3 A;  1BA3 A;  1P7L A;  2D28 C;  1JOS A;  4G37 A;  3H2T A;  2Y4O A;  1MKY A;  4LF4 C;  1USP A;  3CW9 A;  1QM4 A;  4IR7 A;  5BUS A;  3EER A;  4YY3 C;  3GR0 A;  4DUZ C;  5LMU C;  2E8E A;  3IEU A;  2D1R A;  4R0M A;  1MXB A;  4MTN A;  3OTO C;  2YWB A;  3LUS A;  4G1I A;  1FUG A;  1O92 A;  1USP B;  4XX2 A;  4DR4 C;  4DV7 C;  1AMU A;  4GKK C;  3N2Q A;  4DUY C;  4LF8 C;  1NYE A;  4RVN A;  4YHH C;  4LF6 C;  4RMN A;  1XRC A;  3IEV A;  3CJE A;  3TDE A;  1N33 C;  2ATW A;  5AE1 A;  4DV1 C;  2P2B A;  2P2F A;  2PT7 G;  2P2J A;  2D27 A;  5T8T A;  3L8C A;  2PN2 A;  2F4V C;  3UZ0 A;  4LFA C;  2BJO A;  2ASB A;  2UXB C;  4L2Z A;  4R1L A;  1HR0 C;  5ADZ A;  3NYR A;  1VLA A;  3NYQ A;  3RV2 A;  4DCU A;  3A9U A;  4JI7 C;  2WP0 C;  4JYA C;  1FJG C;  4DCT A;  4FUQ A;  1MXA A;  3TQI A;  1GPM A;  5GTD A;  3N54 B;  1WF3 A;  2WD9 A;  3GPC A;  2JMP A;  2E7G A;  3NPD A;  2HHH C;  1XRB A;  2KZF A;  5BUR A;  5A2Q D;  2UUC C;  4JI0 C;  4ZJZ A;  2E5L C;  4DG9 A;  5H9U A;  3LNV A;  4DV2 C;  3PBK A;  4ODJ A;  3FCE A;  4G36 A;  4R1M A;  4NXM C;  5FLX D;  4MH4 A;  4PRO C;  1N32 C;  1LCI A;  5JRH A;  3VNQ A;  3KXW A;  2UXC C;  1LQL A;  1O9T A;  1QWI A;  5BUQ A;  4ISB A;  2DYJ A;  4B3R C;  5BST A;  4OYC A;  2QL8 A;  3LAX A;  5BSV A;  4X66 C;  1N2F A;  5BSW A;  2DPL A;  4GKJ C;  1T5D X;  1PA4 A;  5CZX A;  2HJG A;  5A19 A;  1ML8 A;  3E7W A;  3PRO C;  5BSU A;  4KTV A;  5K8F A;  4WV3 A;  2ONF A;  2VQE C;  4K0B A;  4JM1 A;  3R44 A;  3VNS A;  4B3S C;  4X64 C;  3RG2 A;  3UOW A;  4OXI A;  3FCC A;  1IBL C;  2EGT A;  3J7A D;  3R9X A;  4X65 C;  4FTF A;  4L7I A;  3C5E A;  5E7Q A;  4PHT A;  4LF5 C;  1MDB A;  3A4I A;  4LF9 C;  2D1T A;  1V26 A;  4JI2 C;  1O93 A;  3I08 A;  4LE5 A;  4LFC C;  2E8C A;  1PG4 A;  3SO4 A;  5IWA C;  1ZB8 A;  2V7B A;  4D56 A;  3ETO A;  4HPV A;  2YWC A;  1XNR C;  4JI4 C;  1N36 C;  4RM2 A;  4BBY A;  2P20 A;  1I94 C;  4GS5 A;  2D1S A;  4OX9 C;  2D1Q A;  1MDF A;  3GR1 A;  2E8F A;  4GXR A;  1RG9 A;  2QW0 X;  1T5H X;  2OO4 A;  4RM3 A;  1KKG A;  1XNQ C;  4TPS B;  1O90 A;  4LFB C;  1V25 A;  3I07 A;  4DV4 C;  3B7W A;  5BSM A;  3DLP X;  3G7S A;  2Y27 A;  4DR1 C;  1K0R A;  2VSQ A;  4PZP A;  3AF6 A;  3JAM D;  1WH9 A;  5K85 A;  4JI3 C;  3T1Y C;  4BC7 A;  1XMO C;  4IZ6 A;  5AE2 A;  1XRA A;  2ZM6 C;  5IFI A;  5KEI A;  1MD9 A;  4BC9 A;  4DCS A;  4DR7 C;  4JI1 C;  4DR2 C;  2D7V A;  5KYV A;  1HNZ C;  2OPL B;  4BCA A;  4B3T C;  4AQY C;  4RLF A;  1L2F A;  3L95 X;  1IBM C;  1XMQ C;  1YJ7 A;  4U5Y D;  4RVO A;  1UKK A;  5CZV A;  4I9G A;  2UXD C;  3TUF A;  2P02 A;  1HNX C;  1RY2 A;  2CY1 A;  5IT9 D;  5BSR A;  1HNW C;  3LGX A;  1ULT A;  4D4G A;  4DV0 C;  2UUB C;  3IPL A;  2YCB A;  4ZLP A;  5LMN C;  4D4I A;  1ZB9 A;  4DR5 C;  2XR1 A;  4JI6 C;  4GXQ A;  1IBK C;  1HH2 P;  2BH1 X;  3S82 A;  3J81 D;  4DCV A;  4NDN A;  1J5E C;  3DAY A;  2AYA A;  5A1G A;  4JI8 C;  2VZE A;  4JV5 C;  3ETC A;  4WS9 A;  2OBV A;  2P2M A;  4L4Q A;  3PES A;  3R9W A;  4D57 A;  4RLQ A;  4DV3 C;  2QVY X;  1EGA A;  3NI2 A;  2E0G A;  3VNR A;  4NXN C;  4EAT A;  3EQ6 A;  3IML A;  5T8S A;  4NOZ A;  2OPL A;  4LF7 C;  5DV9 A;  2QVZ X;  4DG8 A;  3T1H C;  4DR3 C;  4FUT A;  4JI5 C;  1MXC A;  4B3M C;  4KTT A;  2QVX X;  1PG3 A;  4BSZ A;  2UU9 C;  5BR8 C;  2UUA C;  2Y4N A;  2P2Q A;  4DR6 C;  3J80 D;  4DV5 C;  2CXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...