4JI1C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji1C02
2HJGA 5LMNC 1WF3A 4YY3C 2E7GA 4DR3C 4LF6C 3R9XA 2VQFC 2PT7G 4LFBC 4OX9C 5IT9D 3OTOC 4JI4C 3CJEA 3IEUA 4DR2C 2UXDC 3AF5A 4JI8C 2ATWA 4DV1C 4XX2A 5IWAC 4X62C 1XNRC 2YCBA 4JI5C 3J81D 4DCTA 2E8FA 4DCVA 4X66C 1N32C 2JMPA 4LF4C 2ONFA 3JAMD 1HNZC 4JYAC 3IEVA 2QL8A 1UKKA 4LF7C 4JI6C 2XR1A 2D7VA 1ZB8A 2CXCA 2DYJA 1HNWC 4X65C 2E8CA 1K0RA 4DR4C 1J5EC 2HHHC 2UUAC 2EGTA 1ML8A 4LF8C 5BR8C 3GKUA 2UU9C 4GKJC 3T1HC 4DV2C 1IBMC 4GKKC 2F4VC 1N2FA 4DV5C 4DV6C 3LUSA 2UUCC 4MTNA 4X64C 1IBLC 3J80D 1JOSA 3T1YC 3I07A 4DV3C 4NOZA 1NYEA 1N33C 4DR5C 1VLAA 3R9WA 2E5LC 4JI3C 3J7AD 1HNXC 4DUZC 2VQEC 1XNQC 4MH4A 1L2FA 4DR7C 4DV0C 1EGAA 1ZB9A 4LF9C 4B3TC 1LQLA 4DCSA 1USPA 4NXNC 4B3RC 4DCUA 4DV7C 2E8EA 2ASBA 2UXCC 2UXBC 1I94C 1XMQC 2OPLB 4YHHC 1QWIA 4JI0C 3EERA 4KHPC 4LF5C 4B3MC 2PN2A 5A2QD 2ZM6C 2CY1A 1XMOC 1USPB 1KKGA 5LMUC 4JV5C 2OPLA 4LFAC 4JI1C 1FJGC 4BSZA 4LFCC 4AQYC 4DR6C 2UUBC 1HR0C 4B3SC 3AF6A 4JI2C 1N36C 4K0KC 4JI7C 4NXMC 4DUYC 2BJOA 1WH9A 1MKYA 4DR1C 1PA4A 2KZFA 1IBKC 1HH2P 5FLXD 4DV4C 1N34C
chains in the Genus database with same CATH superfamily
1XRBA 2HJGA 1V25A 4YY3C 3R9XA 3A4IA 2PT7G 5BSRA 2VSQA 2UXDC 3AF5A 1V26A 5BUQA 3PROC 3TUFA 3TDEA 3UOWA 4DG9A 2ZZMA 2E8FA 5BUSA 3LGXA 3ETOA 3R44A 1MXBA 3CQ1A 2ONFA 5BSVA 3IEVA 2Y4NA 1UKKA 1BA3A 2D7VA 5T8SA 4IZ6A 5IFIA 4X65C 1K0RA 4PUIA 3IPLA 4LF8C 4R0MA 1PG4A 4GKJC 3L95X 4G1IA 2WP0C 4DV5C 3CQ3A 4OYCA 3LUSA 1M6XA 4X64C 4ODJA 4R1MA 4LE5A 2AYAA 2E5LC 4JI3C 1HNXC 5A1IA 4WV3A 4BBYA 3H2TA 3VNRA 4BC7A 4B3TC 1USPA 4RM3A 5AE2A 3DLPX 4PUGA 2PROA 1QWIA 1MDFA 1XRAA 2CU6A 4R1LA 2P2MA 3G7SA 2Y4OA 3VNSA 1P7LA 1O9TA 2Y27A 4LFAC 4LFCC 4DR6C 1XS3A 2UUBC 3LNVA 3TR3A 2OO4A 4JI2C 1T5DX 4DUYC 5JRHA 3RG2A 1VEHA 1PA4A 2KZFA 5A1GA 3GR0A 4D4GA 4WS9A 2E0GA 1WF3A 3CW8X 4TPSB 1LCIA 3A9VA 2KDNA 4DR2C 5IWAC 4X62C 5KEIA 4G37A 5KYVA 5KYTA 4DCTA 5BSUA 1FLOA 2ZZNA 4BC9A 2M5HA 2YWCA 2D28C 2MMAB 4JYAC 2MCQA 3GPCA 3O2EA 4LF7C 5H9UA 2P2JA 2D1SA 1J5EC 1O92A 3UX2A 2EGTA 1ML8A 3GKUA 2QVZX 1IBMC 4GKKC 4PROC 4RLFA 3VNQA 2UUCC 1M6XC 3UEBA 1JOSA 3T1YC 4NOZA 2NCLA 4DR5C 4RVOA 3J7AD 4DUZC 1XNQC 1L2FA 1O90A 4DV0C 1LQLA 4D57A 3A26A 3N2QA 2E8EA 2V7BA 2D1TA 3NYRA 4K0BA 2UXCC 1XHJA 2UXBC 1I94C 1O93A 1XMQC 3A25A 4JI0C 4GS5A 5BSWA 3DHVA 4JV5C 2OPLA 2ZTBA 4JI1C 4AQYC 3FCCA 3AF6A 4I9GA 4K0KC 4JI7C 1WH9A 1T5HX 1YGTA 3IMLA 5CZXA 1N34C 5LMNC 2E7GA 4DR3C 4LF6C 5BURA 2VQFC 4D4IA 4LFBC 5IT9D 3IEUA 3UZ0A 3AY0A 4JI8C 2ATWA 4XX2A 2YX1A 1XNRC 5BSMA 4G36A 4FTFA 2YCBA 4I9FA 4JI5C 4ISBA 3J81D 4L7IA 1V60A 1N32C 4U5YD 4LF4C 3ETCA 1MDBA 3JAMD 1HNZC 2QL8A 4JI6C 2XR1A 1GPMA 1ZB8A 2CXCA 2DYJA 1HNWC 4KTTA 3GR1A 2M5OA 2E8CA 2QW0X 4DG8A 5DV9A 2HHHC 2VZEA 4NDNA 4DV2C 3SO4A 1WCJA 4D56A 2F4VC 1UWDA 2YWBA 4L4QA 2KZ0A 2DPLA 4FUQA 4MTNA 3K6RA 1IBLC 3J80D 4PUHA 4DV3C 2D1RA 2PG1E 1NYEA 5GTDA 3KXWA 5BSTA 1PU1A 3LAXA 4L2ZA 4LF9C 5AE1A 3RV2A 4DCSA 2P02A 4PHTA 2WD9A 4B3RC 2MM9A 4EATA 1P4EC 2ASBA 2OPLB 3C5EA 4YHHC 3EERA 4KHPC 4LF5C 4B3MC 5A2QD 3PBKA 4PZPA 2CY1A 4RLQA 1USPB 1KKGA 5A19A 4BSZA 5LCIA 1HR0C 4B3SC 3E7WA 4GXQA 3CW9A 4NXMC 5AE3A 3N54B 3NPDA 4DR1C 1P4EA 1IBKC 5T8TA 1HH2P 2Z51A 2P2QA 4JM1A 4RM2A 5K8FA 2D27A 3LNOA 4OX9C 3OTOC 4JI4C 3CJEA 3S82A 4KTVA 1IB8A 3EQ6A 4DV1C 1AMUA 5ADZA 1FUGA 3DAYA 4DCVA 4X66C 3UX3A 4RMNA 2JMPA 1PG3A 3PESA 5E7QA 4DR4C 4ZLPA 2UUAC 1NY8A 2D1QA 5BR8C 2UU9C 3T1HC 4HPVA 1MD9A 4GXRA 1MXAA 1N2FA 1XDXA 2OBVA 2QVXX 2DHMA 4DV6C 1RY2A 1RG9A 3I07A 3FCEA 1N33C 2JNVA 4RVNA 1VLAA 3R9WA 2P2BA 2BH1X 3NYQA 2VQEC 4MH4A 3L8CA 4DR7C 2P20A 1EGAA 1ULTA 1ZB9A 3E7XA 2QVYX 4BCAA 3NI2A 4NXNC 4DCUA 1YJ7A 4ZJZA 4DV7C 4FUTA 3CQ2A 2P2FA 5K85A 3FM7A 3B7WA 1XRCA 2PN2A 2ZM6C 3I08A 4OXIA 1XMOC 5LMUC 1QM4A 1FJGC 1MXCA 4IR7A 3TQIA 1N36C 2BJOA 1TH5A 1MKYA 3A9UA 5CZVA 5FLXD 4DV4C
chains in the Genus database with same CATH topology
1XRBA 2HJGA 1V25A 4YY3C 3R9XA 3A4IA 2PT7G 5BSRA 2VSQA 2UXDC 3AF5A 1V26A 5BUQA 3PROC 3TUFA 3TDEA 3UOWA 4DG9A 2E8FA 5BUSA 3LGXA 3ETOA 3R44A 1MXBA 2ONFA 5BSVA 3IEVA 2Y4NA 1UKKA 1BA3A 2D7VA 5T8SA 4IZ6A 5IFIA 4X65C 1K0RA 3IPLA 4LF8C 4R0MA 1PG4A 4GKJC 3L95X 4G1IA 2WP0C 4DV5C 4OYCA 3LUSA 4X64C 4ODJA 4R1MA 4LE5A 2AYAA 2E5LC 4JI3C 1HNXC 5A1IA 4WV3A 4BBYA 3H2TA 3VNRA 4BC7A 4B3TC 1USPA 4RM3A 5AE2A 3DLPX 2PROA 1QWIA 1MDFA 1XRAA 4R1LA 2P2MA 3G7SA 2Y4OA 3VNSA 1P7LA 1O9TA 2Y27A 4LFAC 4LFCC 4DR6C 2UUBC 3LNVA 2OO4A 4JI2C 1T5DX 4DUYC 5JRHA 3RG2A 1PA4A 2KZFA 5A1GA 3GR0A 4D4GA 4WS9A 2E0GA 1WF3A 3CW8X 4TPSB 1LCIA 3A9VA 4DR2C 5IWAC 4X62C 5KEIA 4G37A 5KYVA 5KYTA 4DCTA 5BSUA 4BC9A 2YWCA 2D28C 4JYAC 3GPCA 4LF7C 5H9UA 2P2JA 2D1SA 1J5EC 1O92A 2EGTA 1ML8A 3GKUA 2QVZX 1IBMC 4GKKC 4PROC 4RLFA 3VNQA 2UUCC 1JOSA 3T1YC 4NOZA 4DR5C 4RVOA 3J7AD 4DUZC 1XNQC 1L2FA 1O90A 4DV0C 1LQLA 4D57A 3N2QA 2E8EA 2V7BA 2D1TA 3NYRA 4K0BA 2UXCC 2UXBC 1I94C 1O93A 1XMQC 4JI0C 4GS5A 5BSWA 3DHVA 4JV5C 2OPLA 4JI1C 4AQYC 3FCCA 3AF6A 4I9GA 4K0KC 4JI7C 1WH9A 1T5HX 3IMLA 5CZXA 1N34C 5LMNC 2E7GA 4DR3C 4LF6C 5BURA 2VQFC 4D4IA 4LFBC 5IT9D 3IEUA 3UZ0A 4JI8C 2ATWA 4XX2A 1XNRC 5BSMA 4G36A 4FTFA 2YCBA 4I9FA 4JI5C 4ISBA 3J81D 4L7IA 1N32C 4U5YD 4LF4C 3ETCA 1MDBA 3JAMD 1HNZC 2QL8A 4JI6C 2XR1A 1GPMA 1ZB8A 2CXCA 2DYJA 1HNWC 4KTTA 3GR1A 2E8CA 2QW0X 4DG8A 5DV9A 2HHHC 2VZEA 4NDNA 4DV2C 3SO4A 4D56A 2F4VC 2YWBA 4L4QA 2DPLA 4FUQA 4MTNA 1IBLC 3J80D 4DV3C 2D1RA 1NYEA 5GTDA 3KXWA 5BSTA 3LAXA 4L2ZA 4LF9C 5AE1A 3RV2A 4DCSA 2P02A 4PHTA 2WD9A 4B3RC 4EATA 2ASBA 2OPLB 3C5EA 4YHHC 3EERA 4KHPC 4LF5C 4B3MC 5A2QD 3PBKA 4PZPA 2CY1A 4RLQA 1USPB 1KKGA 5A19A 4BSZA 1HR0C 4B3SC 3E7WA 4GXQA 3CW9A 4NXMC 5AE3A 3N54B 3NPDA 4DR1C 1IBKC 5T8TA 1HH2P 2P2QA 4JM1A 4RM2A 5K8FA 2D27A 4OX9C 3OTOC 4JI4C 3CJEA 3S82A 4KTVA 3EQ6A 4DV1C 1AMUA 5ADZA 1FUGA 3DAYA 4DCVA 4X66C 4RMNA 2JMPA 1PG3A 3PESA 5E7QA 4DR4C 4ZLPA 2UUAC 2D1QA 5BR8C 2UU9C 3T1HC 4HPVA 1MD9A 4GXRA 1MXAA 1N2FA 2OBVA 2QVXX 4DV6C 1RY2A 1RG9A 3I07A 3FCEA 1N33C 4RVNA 1VLAA 3R9WA 2P2BA 2BH1X 3NYQA 2VQEC 4MH4A 3L8CA 4DR7C 2P20A 1EGAA 1ULTA 1ZB9A 3E7XA 2QVYX 4BCAA 3NI2A 4NXNC 4DCUA 1YJ7A 4ZJZA 4DV7C 4FUTA 2P2FA 5K85A 3B7WA 1XRCA 2PN2A 2ZM6C 3I08A 4OXIA 1XMOC 5LMUC 1QM4A 1FJGC 1MXCA 4IR7A 3TQIA 1N36C 2BJOA 1MKYA 3A9UA 5CZVA 5FLXD 4DV4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  5LMN C;  1WF3 A;  4YY3 C;  2E7G A;  4DR3 C;  4LF6 C;  3R9X A;  2VQF C;  2PT7 G;  4LFB C;  4OX9 C;  5IT9 D;  3OTO C;  4JI4 C;  3CJE A;  3IEU A;  4DR2 C;  2UXD C;  3AF5 A;  4JI8 C;  2ATW A;  4DV1 C;  4XX2 A;  5IWA C;  4X62 C;  1XNR C;  2YCB A;  4JI5 C;  3J81 D;  4DCT A;  2E8F A;  4DCV A;  4X66 C;  1N32 C;  2JMP A;  4LF4 C;  2ONF A;  3JAM D;  1HNZ C;  4JYA C;  3IEV A;  2QL8 A;  1UKK A;  4LF7 C;  4JI6 C;  2XR1 A;  2D7V A;  1ZB8 A;  2CXC A;  2DYJ A;  1HNW C;  4X65 C;  2E8C A;  1K0R A;  4DR4 C;  1J5E C;  2HHH C;  2UUA C;  2EGT A;  1ML8 A;  4LF8 C;  5BR8 C;  3GKU A;  2UU9 C;  4GKJ C;  3T1H C;  4DV2 C;  1IBM C;  4GKK C;  2F4V C;  1N2F A;  4DV5 C;  4DV6 C;  3LUS A;  2UUC C;  4MTN A;  4X64 C;  1IBL C;  3J80 D;  1JOS A;  3T1Y C;  3I07 A;  4DV3 C;  4NOZ A;  1NYE A;  1N33 C;  4DR5 C;  1VLA A;  3R9W A;  2E5L C;  4JI3 C;  3J7A D;  1HNX C;  4DUZ C;  2VQE C;  1XNQ C;  4MH4 A;  1L2F A;  4DR7 C;  4DV0 C;  1EGA A;  1ZB9 A;  4LF9 C;  4B3T C;  1LQL A;  4DCS A;  1USP A;  4NXN C;  4B3R C;  4DCU A;  4DV7 C;  2E8E A;  2ASB A;  2UXC C;  2UXB C;  1I94 C;  1XMQ C;  2OPL B;  4YHH C;  1QWI A;  4JI0 C;  3EER A;  4KHP C;  4LF5 C;  4B3M C;  2PN2 A;  5A2Q D;  2ZM6 C;  2CY1 A;  1XMO C;  1USP B;  1KKG A;  5LMU C;  4JV5 C;  2OPL A;  4LFA C;  4JI1 C;  1FJG C;  4BSZ A;  4LFC C;  4AQY C;  4DR6 C;  2UUB C;  1HR0 C;  4B3S C;  3AF6 A;  4JI2 C;  1N36 C;  4K0K C;  4JI7 C;  4NXM C;  4DUY C;  2BJO A;  1WH9 A;  1MKY A;  4DR1 C;  1PA4 A;  2KZF A;  1IBK C;  1HH2 P;  5FLX D;  4DV4 C;  1N34 C; 
#chains in the Genus database with same CATH topology
 1XRB A;  2HJG A;  1V25 A;  4YY3 C;  3R9X A;  3A4I A;  2PT7 G;  5BSR A;  2VSQ A;  2UXD C;  3AF5 A;  1V26 A;  5BUQ A;  3PRO C;  3TUF A;  3TDE A;  3UOW A;  4DG9 A;  2ZZM A;  2E8F A;  5BUS A;  3LGX A;  3ETO A;  3R44 A;  1MXB A;  3CQ1 A;  2ONF A;  5BSV A;  3IEV A;  2Y4N A;  1UKK A;  1BA3 A;  2D7V A;  5T8S A;  4IZ6 A;  5IFI A;  4X65 C;  1K0R A;  4PUI A;  3IPL A;  4LF8 C;  4R0M A;  1PG4 A;  4GKJ C;  3L95 X;  4G1I A;  2WP0 C;  4DV5 C;  3CQ3 A;  4OYC A;  3LUS A;  1M6X A;  4X64 C;  4ODJ A;  4R1M A;  4LE5 A;  2AYA A;  2E5L C;  4JI3 C;  1HNX C;  5A1I A;  4WV3 A;  4BBY A;  3H2T A;  3VNR A;  4BC7 A;  4B3T C;  1USP A;  4RM3 A;  5AE2 A;  3DLP X;  4PUG A;  2PRO A;  1QWI A;  1MDF A;  1XRA A;  2CU6 A;  4R1L A;  2P2M A;  3G7S A;  2Y4O A;  3VNS A;  1P7L A;  1O9T A;  2Y27 A;  4LFA C;  4LFC C;  4DR6 C;  1XS3 A;  2UUB C;  3LNV A;  3TR3 A;  2OO4 A;  4JI2 C;  1T5D X;  4DUY C;  5JRH A;  3RG2 A;  1VEH A;  1PA4 A;  2KZF A;  5A1G A;  3GR0 A;  4D4G A;  4WS9 A;  2E0G A;  1WF3 A;  3CW8 X;  4TPS B;  1LCI A;  3A9V A;  2KDN A;  4DR2 C;  5IWA C;  4X62 C;  5KEI A;  4G37 A;  5KYV A;  5KYT A;  4DCT A;  5BSU A;  1FLO A;  2ZZN A;  4BC9 A;  2M5H A;  2YWC A;  2D28 C;  2MMA B;  4JYA C;  2MCQ A;  3GPC A;  3O2E A;  4LF7 C;  5H9U A;  2P2J A;  2D1S A;  1J5E C;  1O92 A;  3UX2 A;  2EGT A;  1ML8 A;  3GKU A;  2QVZ X;  1IBM C;  4GKK C;  4PRO C;  4RLF A;  3VNQ A;  2UUC C;  1M6X C;  3UEB A;  1JOS A;  3T1Y C;  4NOZ A;  2NCL A;  4DR5 C;  4RVO A;  3J7A D;  4DUZ C;  1XNQ C;  1L2F A;  1O90 A;  4DV0 C;  1LQL A;  4D57 A;  3A26 A;  3N2Q A;  2E8E A;  2V7B A;  2D1T A;  3NYR A;  4K0B A;  2UXC C;  1XHJ A;  2UXB C;  1I94 C;  1O93 A;  1XMQ C;  3A25 A;  4JI0 C;  4GS5 A;  5BSW A;  3DHV A;  4JV5 C;  2OPL A;  2ZTB A;  4JI1 C;  4AQY C;  3FCC A;  3AF6 A;  4I9G A;  4K0K C;  4JI7 C;  1WH9 A;  1T5H X;  1YGT A;  3IML A;  5CZX A;  1N34 C;  5LMN C;  2E7G A;  4DR3 C;  4LF6 C;  5BUR A;  2VQF C;  4D4I A;  4LFB C;  5IT9 D;  3IEU A;  3UZ0 A;  3AY0 A;  4JI8 C;  2ATW A;  4XX2 A;  2YX1 A;  1XNR C;  5BSM A;  4G36 A;  4FTF A;  2YCB A;  4I9F A;  4JI5 C;  4ISB A;  3J81 D;  4L7I A;  1V60 A;  1N32 C;  4U5Y D;  4LF4 C;  3ETC A;  1MDB A;  3JAM D;  1HNZ C;  2QL8 A;  4JI6 C;  2XR1 A;  1GPM A;  1ZB8 A;  2CXC A;  2DYJ A;  1HNW C;  4KTT A;  3GR1 A;  2M5O A;  2E8C A;  2QW0 X;  4DG8 A;  5DV9 A;  2HHH C;  2VZE A;  4NDN A;  4DV2 C;  3SO4 A;  1WCJ A;  4D56 A;  2F4V C;  1UWD A;  2YWB A;  4L4Q A;  2KZ0 A;  2DPL A;  4FUQ A;  4MTN A;  3K6R A;  1IBL C;  3J80 D;  4PUH A;  4DV3 C;  2D1R A;  2PG1 E;  1NYE A;  5GTD A;  3KXW A;  5BST A;  1PU1 A;  3LAX A;  4L2Z A;  4LF9 C;  5AE1 A;  3RV2 A;  4DCS A;  2P02 A;  4PHT A;  2WD9 A;  4B3R C;  2MM9 A;  4EAT A;  1P4E C;  2ASB A;  2OPL B;  3C5E A;  4YHH C;  3EER A;  4KHP C;  4LF5 C;  4B3M C;  5A2Q D;  3PBK A;  4PZP A;  2CY1 A;  4RLQ A;  1USP B;  1KKG A;  5A19 A;  4BSZ A;  5LCI A;  1HR0 C;  4B3S C;  3E7W A;  4GXQ A;  3CW9 A;  4NXM C;  5AE3 A;  3N54 B;  3NPD A;  4DR1 C;  1P4E A;  1IBK C;  5T8T A;  1HH2 P;  2Z51 A;  2P2Q A;  4JM1 A;  4RM2 A;  5K8F A;  2D27 A;  3LNO A;  4OX9 C;  3OTO C;  4JI4 C;  3CJE A;  3S82 A;  4KTV A;  1IB8 A;  3EQ6 A;  4DV1 C;  1AMU A;  5ADZ A;  1FUG A;  3DAY A;  4DCV A;  4X66 C;  3UX3 A;  4RMN A;  2JMP A;  1PG3 A;  3PES A;  5E7Q A;  4DR4 C;  4ZLP A;  2UUA C;  1NY8 A;  2D1Q A;  5BR8 C;  2UU9 C;  3T1H C;  4HPV A;  1MD9 A;  4GXR A;  1MXA A;  1N2F A;  1XDX A;  2OBV A;  2QVX X;  2DHM A;  4DV6 C;  1RY2 A;  1RG9 A;  3I07 A;  3FCE A;  1N33 C;  2JNV A;  4RVN A;  1VLA A;  3R9W A;  2P2B A;  2BH1 X;  3NYQ A;  2VQE C;  4MH4 A;  3L8C A;  4DR7 C;  2P20 A;  1EGA A;  1ULT A;  1ZB9 A;  3E7X A;  2QVY X;  4BCA A;  3NI2 A;  4NXN C;  4DCU A;  1YJ7 A;  4ZJZ A;  4DV7 C;  4FUT A;  3CQ2 A;  2P2F A;  5K85 A;  3FM7 A;  3B7W A;  1XRC A;  2PN2 A;  2ZM6 C;  3I08 A;  4OXI A;  1XMO C;  5LMU C;  1QM4 A;  1FJG C;  1MXC A;  4IR7 A;  3TQI A;  1N36 C;  2BJO A;  1TH5 A;  1MKY A;  3A9U A;  5CZV A;  5FLX D;  4DV4 C; 
#chains in the Genus database with same CATH homology
 1XRB A;  2HJG A;  1V25 A;  4YY3 C;  3R9X A;  3A4I A;  2PT7 G;  5BSR A;  2VSQ A;  2UXD C;  3AF5 A;  1V26 A;  5BUQ A;  3PRO C;  3TUF A;  3TDE A;  3UOW A;  4DG9 A;  2E8F A;  5BUS A;  3LGX A;  3ETO A;  3R44 A;  1MXB A;  2ONF A;  5BSV A;  3IEV A;  2Y4N A;  1UKK A;  1BA3 A;  2D7V A;  5T8S A;  4IZ6 A;  5IFI A;  4X65 C;  1K0R A;  3IPL A;  4LF8 C;  4R0M A;  1PG4 A;  4GKJ C;  3L95 X;  4G1I A;  2WP0 C;  4DV5 C;  4OYC A;  3LUS A;  4X64 C;  4ODJ A;  4R1M A;  4LE5 A;  2AYA A;  2E5L C;  4JI3 C;  1HNX C;  5A1I A;  4WV3 A;  4BBY A;  3H2T A;  3VNR A;  4BC7 A;  4B3T C;  1USP A;  4RM3 A;  5AE2 A;  3DLP X;  2PRO A;  1QWI A;  1MDF A;  1XRA A;  4R1L A;  2P2M A;  3G7S A;  2Y4O A;  3VNS A;  1P7L A;  1O9T A;  2Y27 A;  4LFA C;  4LFC C;  4DR6 C;  2UUB C;  3LNV A;  2OO4 A;  4JI2 C;  1T5D X;  4DUY C;  5JRH A;  3RG2 A;  1PA4 A;  2KZF A;  5A1G A;  3GR0 A;  4D4G A;  4WS9 A;  2E0G A;  1WF3 A;  3CW8 X;  4TPS B;  1LCI A;  3A9V A;  4DR2 C;  5IWA C;  4X62 C;  5KEI A;  4G37 A;  5KYV A;  5KYT A;  4DCT A;  5BSU A;  4BC9 A;  2YWC A;  2D28 C;  4JYA C;  3GPC A;  4LF7 C;  5H9U A;  2P2J A;  2D1S A;  1J5E C;  1O92 A;  2EGT A;  1ML8 A;  3GKU A;  2QVZ X;  1IBM C;  4GKK C;  4PRO C;  4RLF A;  3VNQ A;  2UUC C;  1JOS A;  3T1Y C;  4NOZ A;  4DR5 C;  4RVO A;  3J7A D;  4DUZ C;  1XNQ C;  1L2F A;  1O90 A;  4DV0 C;  1LQL A;  4D57 A;  3N2Q A;  2E8E A;  2V7B A;  2D1T A;  3NYR A;  4K0B A;  2UXC C;  2UXB C;  1I94 C;  1O93 A;  1XMQ C;  4JI0 C;  4GS5 A;  5BSW A;  3DHV A;  4JV5 C;  2OPL A;  4JI1 C;  4AQY C;  3FCC A;  3AF6 A;  4I9G A;  4K0K C;  4JI7 C;  1WH9 A;  1T5H X;  3IML A;  5CZX A;  1N34 C;  5LMN C;  2E7G A;  4DR3 C;  4LF6 C;  5BUR A;  2VQF C;  4D4I A;  4LFB C;  5IT9 D;  3IEU A;  3UZ0 A;  4JI8 C;  2ATW A;  4XX2 A;  1XNR C;  5BSM A;  4G36 A;  4FTF A;  2YCB A;  4I9F A;  4JI5 C;  4ISB A;  3J81 D;  4L7I A;  1N32 C;  4U5Y D;  4LF4 C;  3ETC A;  1MDB A;  3JAM D;  1HNZ C;  2QL8 A;  4JI6 C;  2XR1 A;  1GPM A;  1ZB8 A;  2CXC A;  2DYJ A;  1HNW C;  4KTT A;  3GR1 A;  2E8C A;  2QW0 X;  4DG8 A;  5DV9 A;  2HHH C;  2VZE A;  4NDN A;  4DV2 C;  3SO4 A;  4D56 A;  2F4V C;  2YWB A;  4L4Q A;  2DPL A;  4FUQ A;  4MTN A;  1IBL C;  3J80 D;  4DV3 C;  2D1R A;  1NYE A;  5GTD A;  3KXW A;  5BST A;  3LAX A;  4L2Z A;  4LF9 C;  5AE1 A;  3RV2 A;  4DCS A;  2P02 A;  4PHT A;  2WD9 A;  4B3R C;  4EAT A;  2ASB A;  2OPL B;  3C5E A;  4YHH C;  3EER A;  4KHP C;  4LF5 C;  4B3M C;  5A2Q D;  3PBK A;  4PZP A;  2CY1 A;  4RLQ A;  1USP B;  1KKG A;  5A19 A;  4BSZ A;  1HR0 C;  4B3S C;  3E7W A;  4GXQ A;  3CW9 A;  4NXM C;  5AE3 A;  3N54 B;  3NPD A;  4DR1 C;  1IBK C;  5T8T A;  1HH2 P;  2P2Q A;  4JM1 A;  4RM2 A;  5K8F A;  2D27 A;  4OX9 C;  3OTO C;  4JI4 C;  3CJE A;  3S82 A;  4KTV A;  3EQ6 A;  4DV1 C;  1AMU A;  5ADZ A;  1FUG A;  3DAY A;  4DCV A;  4X66 C;  4RMN A;  2JMP A;  1PG3 A;  3PES A;  5E7Q A;  4DR4 C;  4ZLP A;  2UUA C;  2D1Q A;  5BR8 C;  2UU9 C;  3T1H C;  4HPV A;  1MD9 A;  4GXR A;  1MXA A;  1N2F A;  2OBV A;  2QVX X;  4DV6 C;  1RY2 A;  1RG9 A;  3I07 A;  3FCE A;  1N33 C;  4RVN A;  1VLA A;  3R9W A;  2P2B A;  2BH1 X;  3NYQ A;  2VQE C;  4MH4 A;  3L8C A;  4DR7 C;  2P20 A;  1EGA A;  1ULT A;  1ZB9 A;  3E7X A;  2QVY X;  4BCA A;  3NI2 A;  4NXN C;  4DCU A;  1YJ7 A;  4ZJZ A;  4DV7 C;  4FUT A;  2P2F A;  5K85 A;  3B7W A;  1XRC A;  2PN2 A;  2ZM6 C;  3I08 A;  4OXI A;  1XMO C;  5LMU C;  1QM4 A;  1FJG C;  1MXC A;  4IR7 A;  3TQI A;  1N36 C;  2BJO A;  1MKY A;  3A9U A;  5CZV A;  5FLX D;  4DV4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...