4K0KC

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4k0kC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4k0kC02
5IWAC 4DV6C 3R9WA 4B3RC 4LF6C 1N34C 1IBKC 2E5LC 4JI7C 1ZB9A 3LUSA 1PA4A 3GKUA 2ATWA 4DR5C 3IEVA 4DUZC 1I94C 1HNXC 1N36C 2UUAC 2VQEC 1FJGC 4JV5C 2ASBA 2E7GA 4LF5C 2DYJA 4JI4C 4DR2C 1XMQC 3J81D 3EERA 2PT7G 2YCBA 4DV4C 2UXCC 2CY1A 3J7AD 1HNWC 4DV5C 4JI6C 1USPB 4B3SC 4JI1C 1EGAA 3T1YC 4LFAC 4GKJC 4K0KC 2E8CA 2ZM6C 4OX9C 1HH2P 1ML8A 4NXNC 4DR1C 3T1HC 4DR6C 4LF9C 4X66C 1XNQC 2ONFA 4AQYC 2UXDC 2UU9C 4DR3C 4JI0C 4DR7C 3J80D 3I07A 1XMOC 1WH9A 4JYAC 1QWIA 2E8FA 4DCSA 4YY3C 5BR8C 1KKGA 3CJEA 3AF6A 2HHHC 2UUBC 1JOSA 4BSZA 5LMNC 4JI8C 1XNRC 4GKKC 4LF7C 4DV3C 2HJGA 1ZB8A 4YHHC 1IBLC 2PN2A 2EGTA 4B3MC 3AF5A 2XR1A 4DCTA 4DV7C 2OPLA 1IBMC 5FLXD 4DV1C 1NYEA 3OTOC 4LF8C 2JMPA 4X64C 1J5EC 1N32C 4NOZA 4KHPC 4LFBC 4JI3C 4LFCC 2D7VA 1UKKA 2VQFC 4DCUA 1L2FA 2E8EA 2UUCC 1MKYA 4DUYC 1N33C 2F4VC 5LMUC 4LF4C 4DR4C 4DV2C 4B3TC 4XX2A 5A2QD 2CXCA 1VLAA 2OPLB 4JI5C 1WF3A 4MH4A 2BJOA 3JAMD 4X62C 1K0RA 4DV0C 4MTNA 1N2FA 4DCVA 1HR0C 4X65C 2QL8A 1HNZC 4JI2C 3R9XA 1LQLA 3IEUA 2KZFA 2UXBC 4NXMC 5IT9D 1USPA
chains in the Genus database with same CATH superfamily
2Y4NA 4DV6C 4DG9A 1FUGA 2ATWA 3NYRA 2KDNA 1V60A 4JM1A 1XRBA 2P2JA 4JI4C 5AE3A 4GS5A 2UXCC 3J7AD 1USPB 4B3SC 3T1YC 5CZVA 1GPMA 2NCLA 2QVYX 1RG9A 4R0MA 4PUIA 3E7XA 1PG3A 4X66C 3PBKA 3FM7A 4DR7C 2P02A 2YWBA 5A1IA 3CQ3A 4BCAA 4PZPA 3AF6A 5BSRA 1JOSA 1MDFA 4K0BA 4GKKC 4IZ6A 1ZB8A 2P2FA 1IBLC 2EGTA 1O92A 2XR1A 4DCTA 2OPLA 2V7BA 3OTOC 4FUQA 2JMPA 4X64C 1J5EC 3DLPX 4EATA 3O2EA 3VNQA 5KYVA 1L2FA 4D4GA 5BUSA 3TDEA 5JRHA 3NI2A 2CU6A 3GPCA 1N33C 5T8SA 2E0GA 5LMUC 1IB8A 4PUHA 4XX2A 3IMLA 3UX2A 1VLAA 2DPLA 4G37A 1WF3A 5GTDA 5DV9A 5BSUA 1N2FA 3A26A 1P4EC 5AE1A 1HNZC 2UXBC 1USPA 2ZTBA 1V25A 4HPVA 1M6XA 3N2QA 4B3RC 1IBKC 1ZB9A 3GKUA 1FLOA 4BBYA 4DUZC 5K85A 1I94C 2UUAC 3R44A 4JV5C 2VSQA 4G36A 3TQIA 3G7SA 2PT7G 2YCBA 4DG8A 2CY1A 1HNWC 4LE5A 4JI1C 3LAXA 4LFAC 4RLFA 2AYAA 2D1TA 2P2BA 4GXRA 2ZZMA 3N54B 2WD9A 3RV2A 3S82A 3J80D 1XRCA 2OBVA 3NYQA 3VNSA 4JYAC 1QWIA 5BR8C 1XDXA 2HHHC 2UUBC 4OYCA 3ETCA 5LMNC 1XNRC 1XHJA 4LF7C 3L95X 4FUTA 4D56A 4WS9A 2QVZX 4B3MC 2DHMA 4LF8C 4R1LA 1N32C 4KHPC 4LFCC 2YWCA 3AY0A 1O90A 4DCUA 2D1QA 3CW9A 2F4VC 4RM3A 3CW8X 2D28C 5KEIA 4DR4C 4B3TC 4RMNA 4OXIA 1P7LA 4R1MA 4JI5C 4MH4A 1TH5A 2BJOA 4X62C 1K0RA 2P2QA 4DV0C 3FCCA 3TR3A 1O9TA 3R9XA 1LQLA 3IEUA 1AMUA 2P20A 3PESA 5IWAC 5BSVA 4ODJA 4D57A 3UEBA 3CQ2A 2QW0X 4LF6C 3LNOA 2E5LC 3TUFA 1O93A 3LUSA 1PA4A 5AE2A 2JNVA 3A9VA 3IEVA 4RM2A 1HNXC 1FJGC 2E7GA 5BSTA 2QVXX 2DYJA 5T8TA 3EERA 4DV4C 1ULTA 3UZ0A 4DV5C 3LNVA 1EGAA 4K0KC 4OX9C 2D1RA 1LCIA 1MXBA 2D1SA 1ML8A 5LCIA 4DR1C 1UWDA 3UX3A 2PROA 3A25A 5BURA 4LF9C 3DHVA 5KYTA 3SO4A 4AQYC 2UXDC 4DR3C 4JI0C 3I07A 4L2ZA 2D27A 1XMOC 2MM9A 4I9FA 3H2TA 2E8FA 4DCSA 4FTFA 3CJEA 3UOWA 5IFIA 5BSWA 3K6RA 4JI8C 3CQ1A 4WV3A 4PROC 1XRAA 2PN2A 4TPSB 1T5HX 3AF5A 4DV7C 1IBMC 1M6XC 1V26A 3RG2A 5K8FA 4KTTA 1NYEA 4NOZA 4LFBC 3VNRA 1BA3A 2BH1X 2D7VA 1MXCA 1UKKA 5BSMA 2E8EA 4DUYC 4BC9A 4LF4C 4L7IA 2Z51A 2CXCA 3B7WA 2P2MA 4RVOA 3C5EA 2M5HA 1PG4A 1MD9A 4MTNA 1HR0C 2WP0C 4JI2C 3KXWA 2KZFA 3EQ6A 5IT9D 3E7WA 3R9WA 3DAYA 4ZJZA 1N34C 4JI7C 1VEHA 5A19A 2KZ0A 4ISBA 2MCQA 4GXQA 4DR5C 2Y27A 1N36C 2VQEC 3A9UA 2ASBA 1T5DX 5CZXA 4LF5C 4DR2C 1XMQC 3J81D 1WCJA 5BUQA 4JI6C 4L4QA 1YGTA 4GKJC 3GR0A 2PG1E 2E8CA 2ZM6C 1HH2P 3ETOA 1QM4A 4NXNC 3T1HC 4DR6C 1MDBA 4RLQA 1XNQC 2ONFA 1P4EA 2Y4OA 4NDNA 2UU9C 3A4IA 1WH9A 2MMAB 4YY3C 1KKGA 3NPDA 2VZEA 2YX1A 4BC7A 4BSZA 5ADZA 4KTVA 4DV3C 2ZZNA 4ZLPA 2HJGA 4YHHC 3LGXA 4RVNA 3IPLA 5FLXD 4G1IA 4DV1C 3PROC 1YJ7A 5A1GA 1XS3A 4JI3C 2VQFC 2UUCC 1NY8A 5E7QA 5H9UA 1MKYA 1PU1A 2M5OA 4DV2C 3L8CA 5A2QD 4U5YD 4I9GA 2OPLB 4D4IA 3JAMD 3FCEA 4PHTA 4DCVA 3I08A 4X65C 1MXAA 1RY2A 2OO4A 2QL8A 3GR1A 4IR7A 4NXMC 4PUGA
chains in the Genus database with same CATH topology
2Y4NA 4DV6C 4DG9A 1FUGA 2ATWA 3NYRA 4JM1A 1XRBA 2P2JA 4JI4C 5AE3A 4GS5A 2UXCC 3J7AD 1USPB 4B3SC 3T1YC 5CZVA 1GPMA 2QVYX 1RG9A 4R0MA 3E7XA 1PG3A 4X66C 3PBKA 4DR7C 2P02A 2YWBA 5A1IA 4BCAA 4PZPA 3AF6A 5BSRA 1JOSA 1MDFA 4K0BA 4GKKC 4IZ6A 1ZB8A 2P2FA 1IBLC 2EGTA 1O92A 2XR1A 4DCTA 2OPLA 2V7BA 3OTOC 4FUQA 2JMPA 4X64C 1J5EC 3DLPX 4EATA 3VNQA 5KYVA 1L2FA 4D4GA 5BUSA 3TDEA 5JRHA 3NI2A 3GPCA 1N33C 5T8SA 2E0GA 5LMUC 4XX2A 3IMLA 1VLAA 2DPLA 4G37A 1WF3A 5GTDA 5DV9A 5BSUA 1N2FA 5AE1A 1HNZC 2UXBC 1USPA 1V25A 4HPVA 3N2QA 4B3RC 1IBKC 1ZB9A 3GKUA 4BBYA 4DUZC 5K85A 1I94C 2UUAC 3R44A 4JV5C 2VSQA 4G36A 3TQIA 3G7SA 2PT7G 2YCBA 4DG8A 2CY1A 1HNWC 4LE5A 4JI1C 3LAXA 4LFAC 4RLFA 2AYAA 2D1TA 2P2BA 4GXRA 3N54B 2WD9A 3RV2A 3S82A 3J80D 1XRCA 2OBVA 3NYQA 3VNSA 4JYAC 1QWIA 5BR8C 2HHHC 2UUBC 4OYCA 3ETCA 5LMNC 1XNRC 4LF7C 3L95X 4FUTA 4D56A 4WS9A 2QVZX 4B3MC 4LF8C 4R1LA 1N32C 4KHPC 4LFCC 2YWCA 1O90A 4DCUA 2D1QA 3CW9A 2F4VC 4RM3A 3CW8X 2D28C 5KEIA 4DR4C 4B3TC 4RMNA 4OXIA 1P7LA 4R1MA 4JI5C 4MH4A 2BJOA 4X62C 1K0RA 2P2QA 4DV0C 3FCCA 1O9TA 3R9XA 1LQLA 3IEUA 1AMUA 2P20A 3PESA 5IWAC 5BSVA 4ODJA 4D57A 2QW0X 4LF6C 2E5LC 3TUFA 1O93A 3LUSA 1PA4A 5AE2A 3A9VA 3IEVA 4RM2A 1HNXC 1FJGC 2E7GA 5BSTA 2QVXX 2DYJA 5T8TA 3EERA 4DV4C 1ULTA 3UZ0A 4DV5C 3LNVA 1EGAA 4K0KC 4OX9C 2D1RA 1LCIA 1MXBA 2D1SA 1ML8A 4DR1C 2PROA 5BURA 4LF9C 3DHVA 5KYTA 3SO4A 4AQYC 2UXDC 4DR3C 4JI0C 3I07A 4L2ZA 2D27A 1XMOC 4I9FA 3H2TA 2E8FA 4DCSA 4FTFA 3CJEA 3UOWA 5IFIA 5BSWA 4JI8C 4WV3A 4PROC 1XRAA 2PN2A 4TPSB 1T5HX 3AF5A 4DV7C 1IBMC 1V26A 3RG2A 5K8FA 4KTTA 1NYEA 4NOZA 4LFBC 3VNRA 1BA3A 2BH1X 2D7VA 1MXCA 1UKKA 5BSMA 2E8EA 4DUYC 4BC9A 4LF4C 4L7IA 2CXCA 3B7WA 2P2MA 4RVOA 3C5EA 1PG4A 1MD9A 4MTNA 1HR0C 2WP0C 4JI2C 3KXWA 2KZFA 3EQ6A 5IT9D 3E7WA 3R9WA 3DAYA 4ZJZA 1N34C 4JI7C 5A19A 4ISBA 4GXQA 4DR5C 2Y27A 1N36C 2VQEC 3A9UA 2ASBA 1T5DX 5CZXA 4LF5C 4DR2C 1XMQC 3J81D 5BUQA 4JI6C 4L4QA 4GKJC 3GR0A 2E8CA 2ZM6C 1HH2P 3ETOA 1QM4A 4NXNC 3T1HC 4DR6C 1MDBA 4RLQA 1XNQC 2ONFA 2Y4OA 4NDNA 2UU9C 3A4IA 1WH9A 4YY3C 1KKGA 3NPDA 2VZEA 4BC7A 4BSZA 5ADZA 4KTVA 4DV3C 4ZLPA 2HJGA 4YHHC 3LGXA 4RVNA 3IPLA 5FLXD 4G1IA 4DV1C 3PROC 1YJ7A 5A1GA 4JI3C 2VQFC 2UUCC 5E7QA 1MKYA 4DV2C 3L8CA 5A2QD 4U5YD 4I9GA 2OPLB 4D4IA 3JAMD 3FCEA 4PHTA 4DCVA 3I08A 4X65C 1MXAA 1RY2A 2OO4A 2QL8A 3GR1A 4IR7A 4NXMC 5H9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA C;  4DV6 C;  3R9W A;  4B3R C;  4LF6 C;  1N34 C;  1IBK C;  2E5L C;  4JI7 C;  1ZB9 A;  3LUS A;  1PA4 A;  3GKU A;  2ATW A;  4DR5 C;  3IEV A;  4DUZ C;  1I94 C;  1HNX C;  1N36 C;  2UUA C;  2VQE C;  1FJG C;  4JV5 C;  2ASB A;  2E7G A;  4LF5 C;  2DYJ A;  4JI4 C;  4DR2 C;  1XMQ C;  3J81 D;  3EER A;  2PT7 G;  2YCB A;  4DV4 C;  2UXC C;  2CY1 A;  3J7A D;  1HNW C;  4DV5 C;  4JI6 C;  1USP B;  4B3S C;  4JI1 C;  1EGA A;  3T1Y C;  4LFA C;  4GKJ C;  4K0K C;  2E8C A;  2ZM6 C;  4OX9 C;  1HH2 P;  1ML8 A;  4NXN C;  4DR1 C;  3T1H C;  4DR6 C;  4LF9 C;  4X66 C;  1XNQ C;  2ONF A;  4AQY C;  2UXD C;  2UU9 C;  4DR3 C;  4JI0 C;  4DR7 C;  3J80 D;  3I07 A;  1XMO C;  1WH9 A;  4JYA C;  1QWI A;  2E8F A;  4DCS A;  4YY3 C;  5BR8 C;  1KKG A;  3CJE A;  3AF6 A;  2HHH C;  2UUB C;  1JOS A;  4BSZ A;  5LMN C;  4JI8 C;  1XNR C;  4GKK C;  4LF7 C;  4DV3 C;  2HJG A;  1ZB8 A;  4YHH C;  1IBL C;  2PN2 A;  2EGT A;  4B3M C;  3AF5 A;  2XR1 A;  4DCT A;  4DV7 C;  2OPL A;  1IBM C;  5FLX D;  4DV1 C;  1NYE A;  3OTO C;  4LF8 C;  2JMP A;  4X64 C;  1J5E C;  1N32 C;  4NOZ A;  4KHP C;  4LFB C;  4JI3 C;  4LFC C;  2D7V A;  1UKK A;  2VQF C;  4DCU A;  1L2F A;  2E8E A;  2UUC C;  1MKY A;  4DUY C;  1N33 C;  2F4V C;  5LMU C;  4LF4 C;  4DR4 C;  4DV2 C;  4B3T C;  4XX2 A;  5A2Q D;  2CXC A;  1VLA A;  2OPL B;  4JI5 C;  1WF3 A;  4MH4 A;  2BJO A;  3JAM D;  4X62 C;  1K0R A;  4DV0 C;  4MTN A;  1N2F A;  4DCV A;  1HR0 C;  4X65 C;  2QL8 A;  1HNZ C;  4JI2 C;  3R9X A;  1LQL A;  3IEU A;  2KZF A;  2UXB C;  4NXM C;  5IT9 D;  1USP A; 
#chains in the Genus database with same CATH topology
 2Y4N A;  4DV6 C;  4DG9 A;  1FUG A;  2ATW A;  3NYR A;  2KDN A;  1V60 A;  4JM1 A;  1XRB A;  2P2J A;  4JI4 C;  5AE3 A;  4GS5 A;  2UXC C;  3J7A D;  1USP B;  4B3S C;  3T1Y C;  5CZV A;  1GPM A;  2NCL A;  2QVY X;  1RG9 A;  4R0M A;  4PUI A;  3E7X A;  1PG3 A;  4X66 C;  3PBK A;  3FM7 A;  4DR7 C;  2P02 A;  2YWB A;  5A1I A;  3CQ3 A;  4BCA A;  4PZP A;  3AF6 A;  5BSR A;  1JOS A;  1MDF A;  4K0B A;  4GKK C;  4IZ6 A;  1ZB8 A;  2P2F A;  1IBL C;  2EGT A;  1O92 A;  2XR1 A;  4DCT A;  2OPL A;  2V7B A;  3OTO C;  4FUQ A;  2JMP A;  4X64 C;  1J5E C;  3DLP X;  4EAT A;  3O2E A;  3VNQ A;  5KYV A;  1L2F A;  4D4G A;  5BUS A;  3TDE A;  5JRH A;  3NI2 A;  2CU6 A;  3GPC A;  1N33 C;  5T8S A;  2E0G A;  5LMU C;  1IB8 A;  4PUH A;  4XX2 A;  3IML A;  3UX2 A;  1VLA A;  2DPL A;  4G37 A;  1WF3 A;  5GTD A;  5DV9 A;  5BSU A;  1N2F A;  3A26 A;  1P4E C;  5AE1 A;  1HNZ C;  2UXB C;  1USP A;  2ZTB A;  1V25 A;  4HPV A;  1M6X A;  3N2Q A;  4B3R C;  1IBK C;  1ZB9 A;  3GKU A;  1FLO A;  4BBY A;  4DUZ C;  5K85 A;  1I94 C;  2UUA C;  3R44 A;  4JV5 C;  2VSQ A;  4G36 A;  3TQI A;  3G7S A;  2PT7 G;  2YCB A;  4DG8 A;  2CY1 A;  1HNW C;  4LE5 A;  4JI1 C;  3LAX A;  4LFA C;  4RLF A;  2AYA A;  2D1T A;  2P2B A;  4GXR A;  2ZZM A;  3N54 B;  2WD9 A;  3RV2 A;  3S82 A;  3J80 D;  1XRC A;  2OBV A;  3NYQ A;  3VNS A;  4JYA C;  1QWI A;  5BR8 C;  1XDX A;  2HHH C;  2UUB C;  4OYC A;  3ETC A;  5LMN C;  1XNR C;  1XHJ A;  4LF7 C;  3L95 X;  4FUT A;  4D56 A;  4WS9 A;  2QVZ X;  4B3M C;  2DHM A;  4LF8 C;  4R1L A;  1N32 C;  4KHP C;  4LFC C;  2YWC A;  3AY0 A;  1O90 A;  4DCU A;  2D1Q A;  3CW9 A;  2F4V C;  4RM3 A;  3CW8 X;  2D28 C;  5KEI A;  4DR4 C;  4B3T C;  4RMN A;  4OXI A;  1P7L A;  4R1M A;  4JI5 C;  4MH4 A;  1TH5 A;  2BJO A;  4X62 C;  1K0R A;  2P2Q A;  4DV0 C;  3FCC A;  3TR3 A;  1O9T A;  3R9X A;  1LQL A;  3IEU A;  1AMU A;  2P20 A;  3PES A;  5IWA C;  5BSV A;  4ODJ A;  4D57 A;  3UEB A;  3CQ2 A;  2QW0 X;  4LF6 C;  3LNO A;  2E5L C;  3TUF A;  1O93 A;  3LUS A;  1PA4 A;  5AE2 A;  2JNV A;  3A9V A;  3IEV A;  4RM2 A;  1HNX C;  1FJG C;  2E7G A;  5BST A;  2QVX X;  2DYJ A;  5T8T A;  3EER A;  4DV4 C;  1ULT A;  3UZ0 A;  4DV5 C;  3LNV A;  1EGA A;  4K0K C;  4OX9 C;  2D1R A;  1LCI A;  1MXB A;  2D1S A;  1ML8 A;  5LCI A;  4DR1 C;  1UWD A;  3UX3 A;  2PRO A;  3A25 A;  5BUR A;  4LF9 C;  3DHV A;  5KYT A;  3SO4 A;  4AQY C;  2UXD C;  4DR3 C;  4JI0 C;  3I07 A;  4L2Z A;  2D27 A;  1XMO C;  2MM9 A;  4I9F A;  3H2T A;  2E8F A;  4DCS A;  4FTF A;  3CJE A;  3UOW A;  5IFI A;  5BSW A;  3K6R A;  4JI8 C;  3CQ1 A;  4WV3 A;  4PRO C;  1XRA A;  2PN2 A;  4TPS B;  1T5H X;  3AF5 A;  4DV7 C;  1IBM C;  1M6X C;  1V26 A;  3RG2 A;  5K8F A;  4KTT A;  1NYE A;  4NOZ A;  4LFB C;  3VNR A;  1BA3 A;  2BH1 X;  2D7V A;  1MXC A;  1UKK A;  5BSM A;  2E8E A;  4DUY C;  4BC9 A;  4LF4 C;  4L7I A;  2Z51 A;  2CXC A;  3B7W A;  2P2M A;  4RVO A;  3C5E A;  2M5H A;  1PG4 A;  1MD9 A;  4MTN A;  1HR0 C;  2WP0 C;  4JI2 C;  3KXW A;  2KZF A;  3EQ6 A;  5IT9 D;  3E7W A;  3R9W A;  3DAY A;  4ZJZ A;  1N34 C;  4JI7 C;  1VEH A;  5A19 A;  2KZ0 A;  4ISB A;  2MCQ A;  4GXQ A;  4DR5 C;  2Y27 A;  1N36 C;  2VQE C;  3A9U A;  2ASB A;  1T5D X;  5CZX A;  4LF5 C;  4DR2 C;  1XMQ C;  3J81 D;  1WCJ A;  5BUQ A;  4JI6 C;  4L4Q A;  1YGT A;  4GKJ C;  3GR0 A;  2PG1 E;  2E8C A;  2ZM6 C;  1HH2 P;  3ETO A;  1QM4 A;  4NXN C;  3T1H C;  4DR6 C;  1MDB A;  4RLQ A;  1XNQ C;  2ONF A;  1P4E A;  2Y4O A;  4NDN A;  2UU9 C;  3A4I A;  1WH9 A;  2MMA B;  4YY3 C;  1KKG A;  3NPD A;  2VZE A;  2YX1 A;  4BC7 A;  4BSZ A;  5ADZ A;  4KTV A;  4DV3 C;  2ZZN A;  4ZLP A;  2HJG A;  4YHH C;  3LGX A;  4RVN A;  3IPL A;  5FLX D;  4G1I A;  4DV1 C;  3PRO C;  1YJ7 A;  5A1G A;  1XS3 A;  4JI3 C;  2VQF C;  2UUC C;  1NY8 A;  5E7Q A;  5H9U A;  1MKY A;  1PU1 A;  2M5O A;  4DV2 C;  3L8C A;  5A2Q D;  4U5Y D;  4I9G A;  2OPL B;  4D4I A;  3JAM D;  3FCE A;  4PHT A;  4DCV A;  3I08 A;  4X65 C;  1MXA A;  1RY2 A;  2OO4 A;  2QL8 A;  3GR1 A;  4IR7 A;  4NXM C;  4PUG A; 
#chains in the Genus database with same CATH homology
 2Y4N A;  4DV6 C;  4DG9 A;  1FUG A;  2ATW A;  3NYR A;  4JM1 A;  1XRB A;  2P2J A;  4JI4 C;  5AE3 A;  4GS5 A;  2UXC C;  3J7A D;  1USP B;  4B3S C;  3T1Y C;  5CZV A;  1GPM A;  2QVY X;  1RG9 A;  4R0M A;  3E7X A;  1PG3 A;  4X66 C;  3PBK A;  4DR7 C;  2P02 A;  2YWB A;  5A1I A;  4BCA A;  4PZP A;  3AF6 A;  5BSR A;  1JOS A;  1MDF A;  4K0B A;  4GKK C;  4IZ6 A;  1ZB8 A;  2P2F A;  1IBL C;  2EGT A;  1O92 A;  2XR1 A;  4DCT A;  2OPL A;  2V7B A;  3OTO C;  4FUQ A;  2JMP A;  4X64 C;  1J5E C;  3DLP X;  4EAT A;  3VNQ A;  5KYV A;  1L2F A;  4D4G A;  5BUS A;  3TDE A;  5JRH A;  3NI2 A;  3GPC A;  1N33 C;  5T8S A;  2E0G A;  5LMU C;  4XX2 A;  3IML A;  1VLA A;  2DPL A;  4G37 A;  1WF3 A;  5GTD A;  5DV9 A;  5BSU A;  1N2F A;  5AE1 A;  1HNZ C;  2UXB C;  1USP A;  1V25 A;  4HPV A;  3N2Q A;  4B3R C;  1IBK C;  1ZB9 A;  3GKU A;  4BBY A;  4DUZ C;  5K85 A;  1I94 C;  2UUA C;  3R44 A;  4JV5 C;  2VSQ A;  4G36 A;  3TQI A;  3G7S A;  2PT7 G;  2YCB A;  4DG8 A;  2CY1 A;  1HNW C;  4LE5 A;  4JI1 C;  3LAX A;  4LFA C;  4RLF A;  2AYA A;  2D1T A;  2P2B A;  4GXR A;  3N54 B;  2WD9 A;  3RV2 A;  3S82 A;  3J80 D;  1XRC A;  2OBV A;  3NYQ A;  3VNS A;  4JYA C;  1QWI A;  5BR8 C;  2HHH C;  2UUB C;  4OYC A;  3ETC A;  5LMN C;  1XNR C;  4LF7 C;  3L95 X;  4FUT A;  4D56 A;  4WS9 A;  2QVZ X;  4B3M C;  4LF8 C;  4R1L A;  1N32 C;  4KHP C;  4LFC C;  2YWC A;  1O90 A;  4DCU A;  2D1Q A;  3CW9 A;  2F4V C;  4RM3 A;  3CW8 X;  2D28 C;  5KEI A;  4DR4 C;  4B3T C;  4RMN A;  4OXI A;  1P7L A;  4R1M A;  4JI5 C;  4MH4 A;  2BJO A;  4X62 C;  1K0R A;  2P2Q A;  4DV0 C;  3FCC A;  1O9T A;  3R9X A;  1LQL A;  3IEU A;  1AMU A;  2P20 A;  3PES A;  5IWA C;  5BSV A;  4ODJ A;  4D57 A;  2QW0 X;  4LF6 C;  2E5L C;  3TUF A;  1O93 A;  3LUS A;  1PA4 A;  5AE2 A;  3A9V A;  3IEV A;  4RM2 A;  1HNX C;  1FJG C;  2E7G A;  5BST A;  2QVX X;  2DYJ A;  5T8T A;  3EER A;  4DV4 C;  1ULT A;  3UZ0 A;  4DV5 C;  3LNV A;  1EGA A;  4K0K C;  4OX9 C;  2D1R A;  1LCI A;  1MXB A;  2D1S A;  1ML8 A;  4DR1 C;  2PRO A;  5BUR A;  4LF9 C;  3DHV A;  5KYT A;  3SO4 A;  4AQY C;  2UXD C;  4DR3 C;  4JI0 C;  3I07 A;  4L2Z A;  2D27 A;  1XMO C;  4I9F A;  3H2T A;  2E8F A;  4DCS A;  4FTF A;  3CJE A;  3UOW A;  5IFI A;  5BSW A;  4JI8 C;  4WV3 A;  4PRO C;  1XRA A;  2PN2 A;  4TPS B;  1T5H X;  3AF5 A;  4DV7 C;  1IBM C;  1V26 A;  3RG2 A;  5K8F A;  4KTT A;  1NYE A;  4NOZ A;  4LFB C;  3VNR A;  1BA3 A;  2BH1 X;  2D7V A;  1MXC A;  1UKK A;  5BSM A;  2E8E A;  4DUY C;  4BC9 A;  4LF4 C;  4L7I A;  2CXC A;  3B7W A;  2P2M A;  4RVO A;  3C5E A;  1PG4 A;  1MD9 A;  4MTN A;  1HR0 C;  2WP0 C;  4JI2 C;  3KXW A;  2KZF A;  3EQ6 A;  5IT9 D;  3E7W A;  3R9W A;  3DAY A;  4ZJZ A;  1N34 C;  4JI7 C;  5A19 A;  4ISB A;  4GXQ A;  4DR5 C;  2Y27 A;  1N36 C;  2VQE C;  3A9U A;  2ASB A;  1T5D X;  5CZX A;  4LF5 C;  4DR2 C;  1XMQ C;  3J81 D;  5BUQ A;  4JI6 C;  4L4Q A;  4GKJ C;  3GR0 A;  2E8C A;  2ZM6 C;  1HH2 P;  3ETO A;  1QM4 A;  4NXN C;  3T1H C;  4DR6 C;  1MDB A;  4RLQ A;  1XNQ C;  2ONF A;  2Y4O A;  4NDN A;  2UU9 C;  3A4I A;  1WH9 A;  4YY3 C;  1KKG A;  3NPD A;  2VZE A;  4BC7 A;  4BSZ A;  5ADZ A;  4KTV A;  4DV3 C;  4ZLP A;  2HJG A;  4YHH C;  3LGX A;  4RVN A;  3IPL A;  5FLX D;  4G1I A;  4DV1 C;  3PRO C;  1YJ7 A;  5A1G A;  4JI3 C;  2VQF C;  2UUC C;  5E7Q A;  1MKY A;  4DV2 C;  3L8C A;  5A2Q D;  4U5Y D;  4I9G A;  2OPL B;  4D4I A;  3JAM D;  3FCE A;  4PHT A;  4DCV A;  3I08 A;  4X65 C;  1MXA A;  1RY2 A;  2OO4 A;  2QL8 A;  3GR1 A;  4IR7 A;  4NXM C;  5H9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...