4K0KC

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4k0kC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4k0kC02
4JI6C 1XNQC 2OPLB 2UUCC 4NXNC 1J5EC 4DCTA 4NOZA 4KHPC 4YHHC 2F4VC 2CY1A 3IEUA 4JI1C 2HJGA 4LFAC 1XNRC 4JYAC 4MH4A 4K0KC 1L2FA 4DV0C 4JI3C 1MKYA 4X65C 3AF6A 4DV1C 1HNXC 3CJEA 3OTOC 1WF3A 5IWAC 4B3RC 1K0RA 3T1HC 2ASBA 4LFCC 2E7GA 1XMOC 2EGTA 2OPLA 4DV7C 4GKJC 4LF4C 4JI7C 2UUBC 1IBKC 4B3SC 3J7AD 3LUSA 2VQFC 4LF7C 4DCSA 1I94C 4DV5C 1HH2P 1N34C 1ZB8A 2PN2A 3AF5A 4NXMC 1KKGA 3R9XA 5LMUC 1N2FA 5LMNC 2CXCA 4DR4C 2UXBC 4DV3C 4DCVA 2ZM6C 4DUZC 2E8CA 1XMQC 2E8EA 1ZB9A 4DR6C 4AQYC 2KZFA 1PA4A 1HR0C 3GKUA 4DR1C 1IBMC 2JMPA 1N32C 4JI8C 5BR8C 4DV6C 3R9WA 5A2QD 4XX2A 4DR3C 3I07A 2UU9C 2D7VA 2QL8A 4X62C 2PT7G 2DYJA 2UXDC 1LQLA 1QWIA 4JI0C 2VQEC 1EGAA 4DR2C 3T1YC 4OX9C 2E8FA 4JI5C 4DV4C 4JV5C 1HNWC 4YY3C 2ONFA 2YCBA 1JOSA 1IBLC 4JI2C 2E5LC 4BSZA 2UUAC 2HHHC 4GKKC 4LF8C 3J80D 4X66C 3IEVA 4DR5C 1USPB 4DCUA 2UXCC 1ML8A 2ATWA 3J81D 4DUYC 1FJGC 4LF5C 4LF6C 1NYEA 5IT9D 5FLXD 3EERA 4DR7C 1UKKA 4B3MC 4DV2C 1WH9A 4X64C 1VLAA 1USPA 4MTNA 4JI4C 4LFBC 4B3TC 2BJOA 2XR1A 1N33C 1N36C 3JAMD 4LF9C 1HNZC
chains in the Genus database with same CATH superfamily
4KTTA 3L95X 2MCQA 4YHHC 4G1IA 1M6XA 2ZTBA 4JYAC 4MH4A 4RVNA 1L2FA 1MXCA 4DV0C 2CU6A 4BBYA 5IWAC 2P2JA 1T5DX 4LFCC 2E7GA 2OPLA 1P4EC 3RV2A 3I08A 1IBKC 1PU1A 5A1GA 3J7AD 5CZXA 2VZEA 4LF7C 5BUSA 4RM3A 1O93A 5LMUC 4ZJZA 2CXCA 2P2BA 4DV3C 3A4IA 1VEHA 2E8EA 2YX1A 2WP0C 3GKUA 1IBMC 5A2QD 4DR3C 2UU9C 2Y27A 2YWCA 4PUIA 4K0BA 4X62C 2UXDC 1LQLA 3VNQA 4BCAA 4JI5C 1HNWC 1M6XC 2YCBA 5BSMA 2JNVA 1WCJA 1IBLC 1RY2A 1YJ7A 5BSRA 2QW0X 3GR0A 3A9VA 4DCUA 2UXCC 3VNSA 4D4IA 3B7WA 3J81D 5IT9D 4DR7C 1IB8A 1VLAA 1GPMA 4PHTA 4LFBC 5DV9A 3VNRA 3JAMD 3CW9A 2D28C 4LF9C 2AYAA 1HNZC 2OPLB 2UUCC 5AE3A 4I9FA 4KHPC 3TR3A 5ADZA 2CY1A 1XS3A 4L2ZA 1YGTA 2Z51A 4FTFA 1MKYA 4X65C 3UX3A 2YWBA 4DV1C 3N2QA 5KYTA 3T1HC 1O9TA 2KZ0A 2ASBA 3NI2A 3NPDA 2VQFC 1ULTA 2PROA 4DCSA 4DV5C 3AF5A 1MXBA 4IR7A 3G7SA 3A25A 2ZM6C 2E8CA 1ZB9A 3H2TA 4AQYC 3CW8X 1HR0C 4GXRA 4TPSB 2MM9A 4R1MA 4R0MA 4DR1C 4DV6C 3I07A 2QVXX 3LAXA 1PG4A 2PT7G 4U5YD 3UEBA 5AE2A 2DYJA 3A9UA 4DR2C 2VQEC 1EGAA 3T1YC 2M5OA 4RVOA 3AY0A 3CQ3A 2QVYX 2KDNA 3NYQA 2D1SA 4DG8A 2HHHC 4GKKC 4LF8C 3KXWA 3DHVA 5H9UA 4X66C 3IEVA 1AMUA 1ML8A 3N54B 3RG2A 3A26A 1FJGC 4OXIA 4LF6C 5T8SA 1FUGA 5A1IA 4NDNA 4RM2A 3TQIA 4DG9A 4B3TC 1PG3A 2BJOA 1N33C 5K85A 1MD9A 5LCIA 4GS5A 4JI6C 4OYCA 2P02A 4DCTA 4RLQA 2F4VC 1NY8A 2VSQA 3IEUA 4JI1C 4ZLPA 4LFAC 3TUFA 1MXAA 4K0KC 3IPLA 4L4QA 3LNOA 3CJEA 1WF3A 5CZVA 4BC7A 5A19A 5BSTA 2D1RA 2EGTA 2OO4A 4DV7C 4GKJC 4D4GA 3DAYA 2D1QA 4B3SC 3CQ2A 5AE1A 1I94C 2ZZNA 1HH2P 3PROC 1ZB8A 1O90A 1XRCA 4NXMC 2PN2A 1T5HX 5JRHA 4WS9A 3TDEA 5BUQA 2UXBC 4DCVA 1XMQC 4RLFA 5K8FA 1PA4A 2P2QA 4RMNA 1XDXA 1N32C 3R9WA 3ETCA 3NYRA 4D56A 1V25A 3CQ1A 2QL8A 5BSWA 2P2FA 2MMAB 1FLOA 2E0GA 1QWIA 2P20A 4ISBA 3L8CA 2E8FA 2WD9A 1O92A 1TH5A 4DV4C 4JV5C 4EATA 2Y4NA 2ONFA 1JOSA 3UZ0A 3K6RA 5KYVA 4JI2C 2E5LC 2UUAC 2M5HA 2P2MA 4FUQA 4PZPA 3J80D 4DR5C 1USPB 3S82A 2QVZX 4DUYC 4L7IA 1P4EA 4LF5C 1XRBA 4G36A 2NCLA 3FCEA 3PBKA 3E7WA 4X64C 1USPA 4MTNA 4GXQA 1V60A 4PUGA 4JI4C 2XR1A 3ETOA 3FCCA 1LCIA 1N36C 2BH1X 1BA3A 4B3RC 3LNVA 3DLPX 1XNQC 4NXNC 1J5EC 2D1TA 4NOZA 4PUHA 2HJGA 1XNRC 3FM7A 4JI3C 1XRAA 3AF6A 1MDFA 1HNXC 3OTOC 5BURA 1K0RA 1QM4A 5BSVA 1XMOC 1MDBA 5BSUA 4LF4C 4JI7C 4ODJA 2UUBC 2OBVA 4FUTA 3LUSA 3E7XA 4KTVA 5E7QA 1RG9A 1N34C 1KKGA 3R44A 3GR1A 3EQ6A 3R9XA 1N2FA 4DR4C 2DPLA 5LMNC 4WV3A 2PG1E 4DUZC 4DR6C 2KZFA 4G37A 4HPVA 2JMPA 4JI8C 5BR8C 2V7BA 4LE5A 3SO4A 4XX2A 3LGXA 2ZZMA 2D7VA 4BC9A 3UOWA 4D57A 3O2EA 3C5EA 4I9GA 4JI0C 4OX9C 4PROC 5KEIA 4YY3C 4R1LA 4IZ6A 4JM1A 5GTDA 4BSZA 2DHMA 3UX2A 2D27A 2ATWA 5IFIA 1V26A 1XHJA 3PESA 1UWDA 1NYEA 5FLXD 2Y4OA 3EERA 3IMLA 1UKKA 4B3MC 4DV2C 1WH9A 3GPCA 1P7LA 5T8TA
chains in the Genus database with same CATH topology
4KTTA 3L95X 4YHHC 4G1IA 4JYAC 4MH4A 4RVNA 1L2FA 1MXCA 4DV0C 4BBYA 5IWAC 2P2JA 1T5DX 4LFCC 2E7GA 2OPLA 3RV2A 3I08A 1IBKC 5A1GA 3J7AD 5CZXA 2VZEA 4LF7C 5BUSA 4RM3A 1O93A 5LMUC 4ZJZA 2CXCA 2P2BA 4DV3C 3A4IA 2E8EA 2WP0C 3GKUA 1IBMC 5A2QD 4DR3C 2UU9C 2Y27A 2YWCA 4K0BA 4X62C 2UXDC 1LQLA 3VNQA 4BCAA 4JI5C 1HNWC 2YCBA 5BSMA 1IBLC 1RY2A 1YJ7A 5BSRA 2QW0X 3GR0A 3A9VA 4DCUA 2UXCC 3VNSA 4D4IA 3B7WA 3J81D 5IT9D 4DR7C 1VLAA 1GPMA 4PHTA 4LFBC 5DV9A 3VNRA 3JAMD 3CW9A 2D28C 4LF9C 1HNZC 2AYAA 2OPLB 2UUCC 5AE3A 4I9FA 4KHPC 5ADZA 2CY1A 4L2ZA 4FTFA 1MKYA 4X65C 2YWBA 4DV1C 3N2QA 5KYTA 3T1HC 1O9TA 2ASBA 3NI2A 3NPDA 2VQFC 1ULTA 2PROA 4DCSA 4DV5C 3AF5A 1MXBA 4IR7A 3G7SA 2ZM6C 2E8CA 1ZB9A 3H2TA 4AQYC 3CW8X 1HR0C 4GXRA 4TPSB 4R1MA 4R0MA 4DR1C 4DV6C 3I07A 2QVXX 3LAXA 1PG4A 2PT7G 4U5YD 2DYJA 5AE2A 3A9UA 4DR2C 2VQEC 1EGAA 3T1YC 4RVOA 2QVYX 3NYQA 2D1SA 4DG8A 2HHHC 4GKKC 4LF8C 3KXWA 3DHVA 5H9UA 4X66C 3IEVA 1AMUA 1ML8A 3N54B 3RG2A 1FJGC 4OXIA 4LF6C 5T8SA 1FUGA 5A1IA 4NDNA 4RM2A 3TQIA 4DG9A 4B3TC 1PG3A 2BJOA 1N33C 5K85A 1MD9A 4GS5A 4JI6C 4OYCA 2P02A 4DCTA 4RLQA 2F4VC 2VSQA 3IEUA 4JI1C 4ZLPA 4LFAC 3TUFA 1MXAA 4K0KC 3IPLA 4L4QA 3CJEA 1WF3A 5CZVA 4BC7A 5A19A 5BSTA 2D1RA 2EGTA 2OO4A 4DV7C 4GKJC 4D4GA 3DAYA 2D1QA 4B3SC 5AE1A 1I94C 1HH2P 3PROC 1ZB8A 2PN2A 1O90A 4NXMC 1XRCA 1T5HX 5JRHA 4WS9A 3TDEA 5BUQA 2UXBC 4DCVA 1XMQC 4RLFA 5K8FA 1PA4A 2P2QA 4RMNA 1N32C 3R9WA 3ETCA 3NYRA 4D56A 1V25A 2QL8A 5BSWA 2P2FA 2E0GA 1QWIA 2P20A 4ISBA 3L8CA 2E8FA 2WD9A 1O92A 4DV4C 4JV5C 4EATA 2Y4NA 2ONFA 1JOSA 3UZ0A 5KYVA 4JI2C 2E5LC 2UUAC 2P2MA 4FUQA 4PZPA 3J80D 4DR5C 1USPB 3S82A 2QVZX 4DUYC 4L7IA 4LF5C 1XRBA 4G36A 3FCEA 3PBKA 3E7WA 4X64C 1USPA 4MTNA 4GXQA 4JI4C 2XR1A 3ETOA 3FCCA 1LCIA 1N36C 2BH1X 1BA3A 4B3RC 3LNVA 3DLPX 1XNQC 4NXNC 1J5EC 2D1TA 4NOZA 2HJGA 1XNRC 4JI3C 1XRAA 3AF6A 1MDFA 1HNXC 3OTOC 5BURA 1K0RA 1QM4A 5BSVA 1XMOC 1MDBA 5BSUA 4LF4C 4JI7C 4ODJA 2UUBC 2OBVA 4FUTA 3LUSA 3E7XA 4KTVA 5E7QA 1RG9A 1N34C 1KKGA 3R44A 3GR1A 3EQ6A 3R9XA 1N2FA 4DR4C 2DPLA 5LMNC 4WV3A 4DUZC 4DR6C 2KZFA 4G37A 4HPVA 2JMPA 4JI8C 5BR8C 2V7BA 4LE5A 3SO4A 4XX2A 3LGXA 2D7VA 4BC9A 3UOWA 4D57A 3C5EA 4I9GA 4JI0C 4OX9C 4PROC 5KEIA 4YY3C 4R1LA 4IZ6A 4JM1A 5GTDA 4BSZA 2D27A 2ATWA 5IFIA 1V26A 3PESA 1NYEA 5FLXD 2Y4OA 3EERA 3IMLA 1UKKA 4B3MC 4DV2C 1WH9A 3GPCA 1P7LA 5T8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 C;  1XNQ C;  2OPL B;  2UUC C;  4NXN C;  1J5E C;  4DCT A;  4NOZ A;  4KHP C;  4YHH C;  2F4V C;  2CY1 A;  3IEU A;  4JI1 C;  2HJG A;  4LFA C;  1XNR C;  4JYA C;  4MH4 A;  4K0K C;  1L2F A;  4DV0 C;  4JI3 C;  1MKY A;  4X65 C;  3AF6 A;  4DV1 C;  1HNX C;  3CJE A;  3OTO C;  1WF3 A;  5IWA C;  4B3R C;  1K0R A;  3T1H C;  2ASB A;  4LFC C;  2E7G A;  1XMO C;  2EGT A;  2OPL A;  4DV7 C;  4GKJ C;  4LF4 C;  4JI7 C;  2UUB C;  1IBK C;  4B3S C;  3J7A D;  3LUS A;  2VQF C;  4LF7 C;  4DCS A;  1I94 C;  4DV5 C;  1HH2 P;  1N34 C;  1ZB8 A;  2PN2 A;  3AF5 A;  4NXM C;  1KKG A;  3R9X A;  5LMU C;  1N2F A;  5LMN C;  2CXC A;  4DR4 C;  2UXB C;  4DV3 C;  4DCV A;  2ZM6 C;  4DUZ C;  2E8C A;  1XMQ C;  2E8E A;  1ZB9 A;  4DR6 C;  4AQY C;  2KZF A;  1PA4 A;  1HR0 C;  3GKU A;  4DR1 C;  1IBM C;  2JMP A;  1N32 C;  4JI8 C;  5BR8 C;  4DV6 C;  3R9W A;  5A2Q D;  4XX2 A;  4DR3 C;  3I07 A;  2UU9 C;  2D7V A;  2QL8 A;  4X62 C;  2PT7 G;  2DYJ A;  2UXD C;  1LQL A;  1QWI A;  4JI0 C;  2VQE C;  1EGA A;  4DR2 C;  3T1Y C;  4OX9 C;  2E8F A;  4JI5 C;  4DV4 C;  4JV5 C;  1HNW C;  4YY3 C;  2ONF A;  2YCB A;  1JOS A;  1IBL C;  4JI2 C;  2E5L C;  4BSZ A;  2UUA C;  2HHH C;  4GKK C;  4LF8 C;  3J80 D;  4X66 C;  3IEV A;  4DR5 C;  1USP B;  4DCU A;  2UXC C;  1ML8 A;  2ATW A;  3J81 D;  4DUY C;  1FJG C;  4LF5 C;  4LF6 C;  1NYE A;  5IT9 D;  5FLX D;  3EER A;  4DR7 C;  1UKK A;  4B3M C;  4DV2 C;  1WH9 A;  4X64 C;  1VLA A;  1USP A;  4MTN A;  4JI4 C;  4LFB C;  4B3T C;  2BJO A;  2XR1 A;  1N33 C;  1N36 C;  3JAM D;  4LF9 C;  1HNZ C; 
#chains in the Genus database with same CATH topology
 4KTT A;  3L95 X;  2MCQ A;  4YHH C;  4G1I A;  1M6X A;  2ZTB A;  4JYA C;  4MH4 A;  4RVN A;  1L2F A;  1MXC A;  4DV0 C;  2CU6 A;  4BBY A;  5IWA C;  2P2J A;  1T5D X;  4LFC C;  2E7G A;  2OPL A;  1P4E C;  3RV2 A;  3I08 A;  1IBK C;  1PU1 A;  5A1G A;  3J7A D;  5CZX A;  2VZE A;  4LF7 C;  5BUS A;  4RM3 A;  1O93 A;  5LMU C;  4ZJZ A;  2CXC A;  2P2B A;  4DV3 C;  3A4I A;  1VEH A;  2E8E A;  2YX1 A;  2WP0 C;  3GKU A;  1IBM C;  5A2Q D;  4DR3 C;  2UU9 C;  2Y27 A;  2YWC A;  4PUI A;  4K0B A;  4X62 C;  2UXD C;  1LQL A;  3VNQ A;  4BCA A;  4JI5 C;  1HNW C;  1M6X C;  2YCB A;  5BSM A;  2JNV A;  1WCJ A;  1IBL C;  1RY2 A;  1YJ7 A;  5BSR A;  2QW0 X;  3GR0 A;  3A9V A;  4DCU A;  2UXC C;  3VNS A;  4D4I A;  3B7W A;  3J81 D;  5IT9 D;  4DR7 C;  1IB8 A;  1VLA A;  1GPM A;  4PHT A;  4LFB C;  5DV9 A;  3VNR A;  3JAM D;  3CW9 A;  2D28 C;  4LF9 C;  2AYA A;  1HNZ C;  2OPL B;  2UUC C;  5AE3 A;  4I9F A;  4KHP C;  3TR3 A;  5ADZ A;  2CY1 A;  1XS3 A;  4L2Z A;  1YGT A;  2Z51 A;  4FTF A;  1MKY A;  4X65 C;  3UX3 A;  2YWB A;  4DV1 C;  3N2Q A;  5KYT A;  3T1H C;  1O9T A;  2KZ0 A;  2ASB A;  3NI2 A;  3NPD A;  2VQF C;  1ULT A;  2PRO A;  4DCS A;  4DV5 C;  3AF5 A;  1MXB A;  4IR7 A;  3G7S A;  3A25 A;  2ZM6 C;  2E8C A;  1ZB9 A;  3H2T A;  4AQY C;  3CW8 X;  1HR0 C;  4GXR A;  4TPS B;  2MM9 A;  4R1M A;  4R0M A;  4DR1 C;  4DV6 C;  3I07 A;  2QVX X;  3LAX A;  1PG4 A;  2PT7 G;  4U5Y D;  3UEB A;  5AE2 A;  2DYJ A;  3A9U A;  4DR2 C;  2VQE C;  1EGA A;  3T1Y C;  2M5O A;  4RVO A;  3AY0 A;  3CQ3 A;  2QVY X;  2KDN A;  3NYQ A;  2D1S A;  4DG8 A;  2HHH C;  4GKK C;  4LF8 C;  3KXW A;  3DHV A;  5H9U A;  4X66 C;  3IEV A;  1AMU A;  1ML8 A;  3N54 B;  3RG2 A;  3A26 A;  1FJG C;  4OXI A;  4LF6 C;  5T8S A;  1FUG A;  5A1I A;  4NDN A;  4RM2 A;  3TQI A;  4DG9 A;  4B3T C;  1PG3 A;  2BJO A;  1N33 C;  5K85 A;  1MD9 A;  5LCI A;  4GS5 A;  4JI6 C;  4OYC A;  2P02 A;  4DCT A;  4RLQ A;  2F4V C;  1NY8 A;  2VSQ A;  3IEU A;  4JI1 C;  4ZLP A;  4LFA C;  3TUF A;  1MXA A;  4K0K C;  3IPL A;  4L4Q A;  3LNO A;  3CJE A;  1WF3 A;  5CZV A;  4BC7 A;  5A19 A;  5BST A;  2D1R A;  2EGT A;  2OO4 A;  4DV7 C;  4GKJ C;  4D4G A;  3DAY A;  2D1Q A;  4B3S C;  3CQ2 A;  5AE1 A;  1I94 C;  2ZZN A;  1HH2 P;  3PRO C;  1ZB8 A;  1O90 A;  1XRC A;  4NXM C;  2PN2 A;  1T5H X;  5JRH A;  4WS9 A;  3TDE A;  5BUQ A;  2UXB C;  4DCV A;  1XMQ C;  4RLF A;  5K8F A;  1PA4 A;  2P2Q A;  4RMN A;  1XDX A;  1N32 C;  3R9W A;  3ETC A;  3NYR A;  4D56 A;  1V25 A;  3CQ1 A;  2QL8 A;  5BSW A;  2P2F A;  2MMA B;  1FLO A;  2E0G A;  1QWI A;  2P20 A;  4ISB A;  3L8C A;  2E8F A;  2WD9 A;  1O92 A;  1TH5 A;  4DV4 C;  4JV5 C;  4EAT A;  2Y4N A;  2ONF A;  1JOS A;  3UZ0 A;  3K6R A;  5KYV A;  4JI2 C;  2E5L C;  2UUA C;  2M5H A;  2P2M A;  4FUQ A;  4PZP A;  3J80 D;  4DR5 C;  1USP B;  3S82 A;  2QVZ X;  4DUY C;  4L7I A;  1P4E A;  4LF5 C;  1XRB A;  4G36 A;  2NCL A;  3FCE A;  3PBK A;  3E7W A;  4X64 C;  1USP A;  4MTN A;  4GXQ A;  1V60 A;  4PUG A;  4JI4 C;  2XR1 A;  3ETO A;  3FCC A;  1LCI A;  1N36 C;  2BH1 X;  1BA3 A;  4B3R C;  3LNV A;  3DLP X;  1XNQ C;  4NXN C;  1J5E C;  2D1T A;  4NOZ A;  4PUH A;  2HJG A;  1XNR C;  3FM7 A;  4JI3 C;  1XRA A;  3AF6 A;  1MDF A;  1HNX C;  3OTO C;  5BUR A;  1K0R A;  1QM4 A;  5BSV A;  1XMO C;  1MDB A;  5BSU A;  4LF4 C;  4JI7 C;  4ODJ A;  2UUB C;  2OBV A;  4FUT A;  3LUS A;  3E7X A;  4KTV A;  5E7Q A;  1RG9 A;  1N34 C;  1KKG A;  3R44 A;  3GR1 A;  3EQ6 A;  3R9X A;  1N2F A;  4DR4 C;  2DPL A;  5LMN C;  4WV3 A;  2PG1 E;  4DUZ C;  4DR6 C;  2KZF A;  4G37 A;  4HPV A;  2JMP A;  4JI8 C;  5BR8 C;  2V7B A;  4LE5 A;  3SO4 A;  4XX2 A;  3LGX A;  2ZZM A;  2D7V A;  4BC9 A;  3UOW A;  4D57 A;  3O2E A;  3C5E A;  4I9G A;  4JI0 C;  4OX9 C;  4PRO C;  5KEI A;  4YY3 C;  4R1L A;  4IZ6 A;  4JM1 A;  5GTD A;  4BSZ A;  2DHM A;  3UX2 A;  2D27 A;  2ATW A;  5IFI A;  1V26 A;  1XHJ A;  3PES A;  1UWD A;  1NYE A;  5FLX D;  2Y4O A;  3EER A;  3IML A;  1UKK A;  4B3M C;  4DV2 C;  1WH9 A;  3GPC A;  1P7L A;  5T8T A; 
#chains in the Genus database with same CATH homology
 4KTT A;  3L95 X;  4YHH C;  4G1I A;  4JYA C;  4MH4 A;  4RVN A;  1L2F A;  1MXC A;  4DV0 C;  4BBY A;  5IWA C;  2P2J A;  1T5D X;  4LFC C;  2E7G A;  2OPL A;  3RV2 A;  3I08 A;  1IBK C;  5A1G A;  3J7A D;  5CZX A;  2VZE A;  4LF7 C;  5BUS A;  4RM3 A;  1O93 A;  5LMU C;  4ZJZ A;  2CXC A;  2P2B A;  4DV3 C;  3A4I A;  2E8E A;  2WP0 C;  3GKU A;  1IBM C;  5A2Q D;  4DR3 C;  2UU9 C;  2Y27 A;  2YWC A;  4K0B A;  4X62 C;  2UXD C;  1LQL A;  3VNQ A;  4BCA A;  4JI5 C;  1HNW C;  2YCB A;  5BSM A;  1IBL C;  1RY2 A;  1YJ7 A;  5BSR A;  2QW0 X;  3GR0 A;  3A9V A;  4DCU A;  2UXC C;  3VNS A;  4D4I A;  3B7W A;  3J81 D;  5IT9 D;  4DR7 C;  1VLA A;  1GPM A;  4PHT A;  4LFB C;  5DV9 A;  3VNR A;  3JAM D;  3CW9 A;  2D28 C;  4LF9 C;  1HNZ C;  2AYA A;  2OPL B;  2UUC C;  5AE3 A;  4I9F A;  4KHP C;  5ADZ A;  2CY1 A;  4L2Z A;  4FTF A;  1MKY A;  4X65 C;  2YWB A;  4DV1 C;  3N2Q A;  5KYT A;  3T1H C;  1O9T A;  2ASB A;  3NI2 A;  3NPD A;  2VQF C;  1ULT A;  2PRO A;  4DCS A;  4DV5 C;  3AF5 A;  1MXB A;  4IR7 A;  3G7S A;  2ZM6 C;  2E8C A;  1ZB9 A;  3H2T A;  4AQY C;  3CW8 X;  1HR0 C;  4GXR A;  4TPS B;  4R1M A;  4R0M A;  4DR1 C;  4DV6 C;  3I07 A;  2QVX X;  3LAX A;  1PG4 A;  2PT7 G;  4U5Y D;  2DYJ A;  5AE2 A;  3A9U A;  4DR2 C;  2VQE C;  1EGA A;  3T1Y C;  4RVO A;  2QVY X;  3NYQ A;  2D1S A;  4DG8 A;  2HHH C;  4GKK C;  4LF8 C;  3KXW A;  3DHV A;  5H9U A;  4X66 C;  3IEV A;  1AMU A;  1ML8 A;  3N54 B;  3RG2 A;  1FJG C;  4OXI A;  4LF6 C;  5T8S A;  1FUG A;  5A1I A;  4NDN A;  4RM2 A;  3TQI A;  4DG9 A;  4B3T C;  1PG3 A;  2BJO A;  1N33 C;  5K85 A;  1MD9 A;  4GS5 A;  4JI6 C;  4OYC A;  2P02 A;  4DCT A;  4RLQ A;  2F4V C;  2VSQ A;  3IEU A;  4JI1 C;  4ZLP A;  4LFA C;  3TUF A;  1MXA A;  4K0K C;  3IPL A;  4L4Q A;  3CJE A;  1WF3 A;  5CZV A;  4BC7 A;  5A19 A;  5BST A;  2D1R A;  2EGT A;  2OO4 A;  4DV7 C;  4GKJ C;  4D4G A;  3DAY A;  2D1Q A;  4B3S C;  5AE1 A;  1I94 C;  1HH2 P;  3PRO C;  1ZB8 A;  2PN2 A;  1O90 A;  4NXM C;  1XRC A;  1T5H X;  5JRH A;  4WS9 A;  3TDE A;  5BUQ A;  2UXB C;  4DCV A;  1XMQ C;  4RLF A;  5K8F A;  1PA4 A;  2P2Q A;  4RMN A;  1N32 C;  3R9W A;  3ETC A;  3NYR A;  4D56 A;  1V25 A;  2QL8 A;  5BSW A;  2P2F A;  2E0G A;  1QWI A;  2P20 A;  4ISB A;  3L8C A;  2E8F A;  2WD9 A;  1O92 A;  4DV4 C;  4JV5 C;  4EAT A;  2Y4N A;  2ONF A;  1JOS A;  3UZ0 A;  5KYV A;  4JI2 C;  2E5L C;  2UUA C;  2P2M A;  4FUQ A;  4PZP A;  3J80 D;  4DR5 C;  1USP B;  3S82 A;  2QVZ X;  4DUY C;  4L7I A;  4LF5 C;  1XRB A;  4G36 A;  3FCE A;  3PBK A;  3E7W A;  4X64 C;  1USP A;  4MTN A;  4GXQ A;  4JI4 C;  2XR1 A;  3ETO A;  3FCC A;  1LCI A;  1N36 C;  2BH1 X;  1BA3 A;  4B3R C;  3LNV A;  3DLP X;  1XNQ C;  4NXN C;  1J5E C;  2D1T A;  4NOZ A;  2HJG A;  1XNR C;  4JI3 C;  1XRA A;  3AF6 A;  1MDF A;  1HNX C;  3OTO C;  5BUR A;  1K0R A;  1QM4 A;  5BSV A;  1XMO C;  1MDB A;  5BSU A;  4LF4 C;  4JI7 C;  4ODJ A;  2UUB C;  2OBV A;  4FUT A;  3LUS A;  3E7X A;  4KTV A;  5E7Q A;  1RG9 A;  1N34 C;  1KKG A;  3R44 A;  3GR1 A;  3EQ6 A;  3R9X A;  1N2F A;  4DR4 C;  2DPL A;  5LMN C;  4WV3 A;  4DUZ C;  4DR6 C;  2KZF A;  4G37 A;  4HPV A;  2JMP A;  4JI8 C;  5BR8 C;  2V7B A;  4LE5 A;  3SO4 A;  4XX2 A;  3LGX A;  2D7V A;  4BC9 A;  3UOW A;  4D57 A;  3C5E A;  4I9G A;  4JI0 C;  4OX9 C;  4PRO C;  5KEI A;  4YY3 C;  4R1L A;  4IZ6 A;  4JM1 A;  5GTD A;  4BSZ A;  2D27 A;  2ATW A;  5IFI A;  1V26 A;  3PES A;  1NYE A;  5FLX D;  2Y4O A;  3EER A;  3IML A;  1UKK A;  4B3M C;  4DV2 C;  1WH9 A;  3GPC A;  1P7L A;  5T8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...