4K0KC

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4k0kC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4k0kC02
4B3MC 4DR4C 4X65C 1XNRC 4LF5C 3J81D 4DV3C 4YY3C 4DV6C 4JI7C 4DR5C 4JI8C 4LF6C 4LFAC 1XNQC 1HR0C 4KHPC 3CJEA 5BR8C 4NOZA 1N32C 4LFCC 2UUBC 4JI6C 4DUZC 4X62C 1UKKA 4DV4C 1USPA 2DYJA 1QWIA 2UU9C 4DV1C 4LF8C 1N2FA 2UXBC 2ONFA 4B3SC 3R9WA 2PN2A 4K0KC 1HH2P 4NXMC 2EGTA 4GKJC 1J5EC 1MKYA 2D7VA 1FJGC 1IBKC 2UUAC 1XMOC 4DCVA 4DR1C 4B3RC 1N36C 1IBMC 4DR7C 2E7GA 3AF6A 1VLAA 3R9XA 3OTOC 1LQLA 1IBLC 4DCUA 1WH9A 1USPB 5IWAC 4NXNC 2ASBA 2KZFA 1NYEA 2HHHC 3J80D 4LF9C 4DV7C 3GKUA 3IEVA 2E8EA 4DR6C 1JOSA 2ZM6C 5A2QD 2JMPA 4DV5C 2E5LC 2PT7G 4JI0C 1N34C 4OX9C 4AQYC 4DCSA 4JI1C 1HNZC 4YHHC 4JV5C 1L2FA 2E8FA 5IT9D 3IEUA 2XR1A 4DR2C 4X64C 4DV0C 2E8CA 4JYAC 4XX2A 3I07A 5LMUC 1ZB8A 1K0RA 2CY1A 1PA4A 5FLXD 3AF5A 1HNXC 2UXCC 1ML8A 3JAMD 2VQFC 1N33C 2F4VC 1EGAA 1I94C 4X66C 2UXDC 4JI3C 2ATWA 4JI5C 2OPLB 4JI4C 2YCBA 3EERA 4BSZA 4LFBC 4MH4A 2UUCC 1KKGA 4LF7C 4MTNA 4JI2C 3T1HC 2CXCA 4B3TC 1XMQC 3T1YC 4GKKC 4LF4C 4DV2C 2HJGA 1ZB9A 4DCTA 4DUYC 1HNWC 3J7AD 2QL8A 1WF3A 2VQEC 4DR3C 2BJOA 3LUSA 2OPLA 5LMNC
chains in the Genus database with same CATH superfamily
1T5DX 3IPLA 1FLOA 3J81D 4L2ZA 4JI7C 4LFAC 1XNQC 4KHPC 1YGTA 4PROC 1HR0C 4G37A 1XRCA 4LFCC 5K85A 4EATA 4DUZC 4X62C 3DLPX 4BC9A 1LCIA 2DYJA 4DV1C 3LGXA 5BSVA 4ZLPA 2PN2A 2P2BA 4RLFA 4K0KC 1IB8A 3CW9A 1MKYA 4D56A 3G7SA 5K8FA 2D1SA 3E7WA 4KTVA 1LQLA 3OTOC 1IBLC 1USPB 5IWAC 2MM9A 1NYEA 3J80D 4LF9C 4DV7C 3UEBA 4RMNA 3A9VA 5A1IA 5BSWA 3GR0A 2JMPA 4DV5C 4OX9C 5KEIA 4ZJZA 3C5EA 4JV5C 1L2FA 4PUHA 3A9UA 2E8FA 1WCJA 4DG9A 2Y4OA 2D1QA 3I07A 5LMUC 2KZ0A 3L95X 3TDEA 3RG2A 1PA4A 2DHMA 1RG9A 3UX3A 3KXWA 3N54B 3JAMD 5CZVA 1NY8A 2F4VC 4BCAA 3TQIA 2UXDC 2ATWA 4JI5C 2V7BA 5AE3A 4R1LA 3IMLA 3EERA 4MH4A 5T8TA 3CQ2A 3L8CA 2D28C 2CU6A 3T1HC 2CXCA 4B3TC 3T1YC 5KYVA 4DCTA 4DUYC 1MXCA 2VQEC 3UZ0A 5H9UA 3LUSA 2OPLA 1YJ7A 3VNSA 3E7XA 3PBKA 4DR4C 4K0BA 4X65C 1MXBA 4DV3C 3H2TA 4YY3C 4DV6C 4DR5C 3EQ6A 3A4IA 3PESA 5KYTA 1UKKA 4DV4C 4IR7A 2UU9C 5ADZA 4IZ6A 3R9WA 4NXMC 2EGTA 4RVNA 4LE5A 1IBKC 3UOWA 4G36A 2E7GA 2D27A 1WH9A 4DG8A 5BSMA 2ZTBA 4NXNC 3DHVA 2M5HA 3FCEA 1MXAA 4GS5A 3GKUA 2Y4NA 3IEVA 4DR6C 1JOSA 2ZM6C 4FUTA 5A2QD 1P4EA 4D57A 1O92A 2P20A 2NCLA 3S82A 3FM7A 4WS9A 5BSTA 5IT9D 3IEUA 4JYAC 4FTFA 1ZB8A 1BA3A 1K0RA 2CY1A 4PZPA 2P2JA 3AF5A 5JRHA 3R44A 4OXIA 2VQFC 4X66C 4PUIA 1MDFA 2DPLA 4LF7C 2KDNA 3AY0A 1XMQC 4GKKC 3B7WA 2P2QA 1ZB9A 1HNWC 4TPSB 1AMUA 4I9GA 1WF3A 2PG1E 1M6XC 2YWCA 1XNRC 1O90A 4JI8C 4LF6C 4WV3A 4R0MA 4OYCA 1N32C 2UUBC 1O9TA 3SO4A 1TH5A 3NI2A 4GXRA 3LAXA 4LF8C 2Y27A 2UXBC 4B3SC 1HH2P 3CQ3A 2P2MA 1ULTA 2D1TA 3CW8X 3DAYA 3FCCA 4DCVA 2P02A 4B3RC 1N36C 3AF6A 3R9XA 1VLAA 4DCUA 4L4QA 2QVXX 1MDBA 3CQ1A 5A1GA 1XRBA 4D4GA 4RLQA 1VEHA 5CZXA 5A19A 1XHJA 2PT7G 4JI0C 4KTTA 4D4IA 4AQYC 3TUFA 4L7IA 1XDXA 1GPMA 2P2FA 1HNZC 4RM3A 5BUQA 1XRAA 1XS3A 2XR1A 3ETCA 1V26A 2QVZX 4NDNA 4XX2A 3LNVA 4RM2A 5AE1A 4GXQA 2WD9A 5E7QA 4RVOA 1N33C 1I94C 3VNRA 1P4EC 2YCBA 4LFBC 3LNOA 2BH1X 4U5YD 2PROA 2UUCC 1KKGA 1PU1A 4MTNA 2MMAB 3RV2A 1PG4A 2HJGA 4DV2C 3J7AD 3NYRA 1V25A 1UWDA 3N2QA 4G1IA 2BJOA 3GPCA 4B3MC 5BUSA 4LF5C 4BBYA 1QM4A 3I08A 3CJEA 5BR8C 4NOZA 4JI6C 2JNVA 2D1RA 2YX1A 1USPA 3O2EA 2Z51A 2MCQA 1QWIA 1N2FA 2ONFA 4HPVA 2ZZMA 2YWBA 4PHTA 3NYQA 5T8SA 4GKJC 1J5EC 2D7VA 3PROC 4BC7A 1P7LA 1PG3A 1FJGC 1M6XA 2UUAC 1XMOC 5BSRA 4DR1C 1IBMC 4DR7C 3A25A 4JM1A 5BURA 1RY2A 3NPDA 2WP0C 2ASBA 2KZFA 2HHHC 2QVYX 3GR1A 2E8EA 4FUQA 1FUGA 5AE2A 4PUGA 5GTDA 2E5LC 2VZEA 1N34C 2ZZNA 2QW0X 4DCSA 5IFIA 3VNQA 4JI1C 4YHHC 2OO4A 1O93A 3A26A 3K6RA 4DR2C 4ISBA 4X64C 4DV0C 2VSQA 2E8CA 4I9FA 2M5OA 2OBVA 5BSUA 5FLXD 5LCIA 1HNXC 2UXCC 3UX2A 1ML8A 4ODJA 1EGAA 4JI3C 2OPLB 4JI4C 4BSZA 1MD9A 1T5HX 5DV9A 4JI2C 2AYAA 3TR3A 1V60A 4LF4C 2E0GA 3ETOA 2QL8A 4R1MA 4DR3C 5LMNC
chains in the Genus database with same CATH topology
1T5DX 3IPLA 3J81D 4L2ZA 4JI7C 4LFAC 1XNQC 4KHPC 4PROC 1HR0C 4G37A 1XRCA 4LFCC 5K85A 4EATA 4DUZC 4X62C 3DLPX 4BC9A 1LCIA 2DYJA 4DV1C 3LGXA 5BSVA 4ZLPA 2PN2A 2P2BA 4RLFA 4K0KC 3CW9A 1MKYA 4D56A 3G7SA 5K8FA 2D1SA 3E7WA 4KTVA 1LQLA 1IBLC 3OTOC 1USPB 5IWAC 1NYEA 3J80D 4LF9C 4DV7C 4RMNA 3A9VA 5A1IA 5BSWA 3GR0A 2JMPA 4DV5C 4OX9C 5KEIA 4ZJZA 3C5EA 4JV5C 1L2FA 3A9UA 2E8FA 4DG9A 2Y4OA 2D1QA 3I07A 5LMUC 3L95X 3TDEA 3RG2A 1PA4A 1RG9A 3KXWA 3N54B 3JAMD 5CZVA 2F4VC 4BCAA 3TQIA 2UXDC 2ATWA 4JI5C 2V7BA 5AE3A 4R1LA 3IMLA 3EERA 4MH4A 5T8TA 3L8CA 2D28C 3T1HC 2CXCA 4B3TC 3T1YC 5KYVA 4DCTA 4DUYC 1MXCA 2VQEC 3UZ0A 5H9UA 3LUSA 2OPLA 1YJ7A 3VNSA 3E7XA 3PBKA 4DR4C 4K0BA 4X65C 1MXBA 4DV3C 3H2TA 4YY3C 4DV6C 4DR5C 3EQ6A 3A4IA 3PESA 5KYTA 1UKKA 4DV4C 4IR7A 2UU9C 5ADZA 4IZ6A 3R9WA 4NXMC 2EGTA 4RVNA 4LE5A 1IBKC 3UOWA 4G36A 2E7GA 2D27A 1WH9A 4DG8A 5BSMA 4NXNC 3DHVA 3FCEA 1MXAA 4GS5A 3GKUA 2Y4NA 3IEVA 4DR6C 1JOSA 2ZM6C 4FUTA 5A2QD 4D57A 1O92A 2P20A 3S82A 4WS9A 5BSTA 5IT9D 3IEUA 4JYAC 4FTFA 1ZB8A 1BA3A 1K0RA 2CY1A 4PZPA 2P2JA 3AF5A 5JRHA 3R44A 4OXIA 2VQFC 4X66C 1MDFA 2DPLA 4LF7C 1XMQC 4GKKC 3B7WA 2P2QA 1ZB9A 1HNWC 4TPSB 1AMUA 4I9GA 1WF3A 2YWCA 1XNRC 1O90A 4JI8C 4LF6C 4WV3A 4R0MA 4OYCA 1N32C 2UUBC 1O9TA 3SO4A 3NI2A 4GXRA 3LAXA 4LF8C 2Y27A 2UXBC 4B3SC 1HH2P 2P2MA 1ULTA 2D1TA 3CW8X 3DAYA 3FCCA 4DCVA 2P02A 4B3RC 1N36C 3AF6A 3R9XA 1VLAA 4DCUA 4L4QA 2QVXX 1MDBA 5A1GA 1XRBA 4D4GA 4RLQA 5CZXA 5A19A 2PT7G 4JI0C 4KTTA 4D4IA 4AQYC 3TUFA 4L7IA 1GPMA 2P2FA 1HNZC 4RM3A 5BUQA 1XRAA 2XR1A 3ETCA 1V26A 2QVZX 4NDNA 4XX2A 3LNVA 4RM2A 5AE1A 4GXQA 2WD9A 5E7QA 4RVOA 1N33C 1I94C 3VNRA 2YCBA 4LFBC 2BH1X 4U5YD 2PROA 2UUCC 1KKGA 4MTNA 3RV2A 1PG4A 2HJGA 4DV2C 3J7AD 3NYRA 1V25A 3N2QA 4G1IA 2BJOA 3GPCA 4B3MC 5BUSA 4LF5C 4BBYA 1QM4A 3I08A 3CJEA 5BR8C 4NOZA 4JI6C 2D1RA 1USPA 1QWIA 1N2FA 2ONFA 4HPVA 2YWBA 4PHTA 3NYQA 5T8SA 4GKJC 1J5EC 2D7VA 3PROC 4BC7A 1P7LA 1PG3A 1FJGC 2UUAC 1XMOC 5BSRA 4DR1C 1IBMC 4DR7C 4JM1A 5BURA 1RY2A 3NPDA 2WP0C 2ASBA 2KZFA 2HHHC 2QVYX 3GR1A 2E8EA 4FUQA 1FUGA 5AE2A 5GTDA 2E5LC 2VZEA 1N34C 2QW0X 4DCSA 5IFIA 3VNQA 4JI1C 4YHHC 2OO4A 1O93A 4DR2C 4ISBA 4X64C 4DV0C 2VSQA 2E8CA 4I9FA 2OBVA 5BSUA 5FLXD 1HNXC 2UXCC 1ML8A 4ODJA 1EGAA 4JI3C 2OPLB 4JI4C 4BSZA 1MD9A 1T5HX 5DV9A 4JI2C 2AYAA 4LF4C 2E0GA 3ETOA 2QL8A 4R1MA 4DR3C 5LMNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M C;  4DR4 C;  4X65 C;  1XNR C;  4LF5 C;  3J81 D;  4DV3 C;  4YY3 C;  4DV6 C;  4JI7 C;  4DR5 C;  4JI8 C;  4LF6 C;  4LFA C;  1XNQ C;  1HR0 C;  4KHP C;  3CJE A;  5BR8 C;  4NOZ A;  1N32 C;  4LFC C;  2UUB C;  4JI6 C;  4DUZ C;  4X62 C;  1UKK A;  4DV4 C;  1USP A;  2DYJ A;  1QWI A;  2UU9 C;  4DV1 C;  4LF8 C;  1N2F A;  2UXB C;  2ONF A;  4B3S C;  3R9W A;  2PN2 A;  4K0K C;  1HH2 P;  4NXM C;  2EGT A;  4GKJ C;  1J5E C;  1MKY A;  2D7V A;  1FJG C;  1IBK C;  2UUA C;  1XMO C;  4DCV A;  4DR1 C;  4B3R C;  1N36 C;  1IBM C;  4DR7 C;  2E7G A;  3AF6 A;  1VLA A;  3R9X A;  3OTO C;  1LQL A;  1IBL C;  4DCU A;  1WH9 A;  1USP B;  5IWA C;  4NXN C;  2ASB A;  2KZF A;  1NYE A;  2HHH C;  3J80 D;  4LF9 C;  4DV7 C;  3GKU A;  3IEV A;  2E8E A;  4DR6 C;  1JOS A;  2ZM6 C;  5A2Q D;  2JMP A;  4DV5 C;  2E5L C;  2PT7 G;  4JI0 C;  1N34 C;  4OX9 C;  4AQY C;  4DCS A;  4JI1 C;  1HNZ C;  4YHH C;  4JV5 C;  1L2F A;  2E8F A;  5IT9 D;  3IEU A;  2XR1 A;  4DR2 C;  4X64 C;  4DV0 C;  2E8C A;  4JYA C;  4XX2 A;  3I07 A;  5LMU C;  1ZB8 A;  1K0R A;  2CY1 A;  1PA4 A;  5FLX D;  3AF5 A;  1HNX C;  2UXC C;  1ML8 A;  3JAM D;  2VQF C;  1N33 C;  2F4V C;  1EGA A;  1I94 C;  4X66 C;  2UXD C;  4JI3 C;  2ATW A;  4JI5 C;  2OPL B;  4JI4 C;  2YCB A;  3EER A;  4BSZ A;  4LFB C;  4MH4 A;  2UUC C;  1KKG A;  4LF7 C;  4MTN A;  4JI2 C;  3T1H C;  2CXC A;  4B3T C;  1XMQ C;  3T1Y C;  4GKK C;  4LF4 C;  4DV2 C;  2HJG A;  1ZB9 A;  4DCT A;  4DUY C;  1HNW C;  3J7A D;  2QL8 A;  1WF3 A;  2VQE C;  4DR3 C;  2BJO A;  3LUS A;  2OPL A;  5LMN C; 
#chains in the Genus database with same CATH topology
 1T5D X;  3IPL A;  1FLO A;  3J81 D;  4L2Z A;  4JI7 C;  4LFA C;  1XNQ C;  4KHP C;  1YGT A;  4PRO C;  1HR0 C;  4G37 A;  1XRC A;  4LFC C;  5K85 A;  4EAT A;  4DUZ C;  4X62 C;  3DLP X;  4BC9 A;  1LCI A;  2DYJ A;  4DV1 C;  3LGX A;  5BSV A;  4ZLP A;  2PN2 A;  2P2B A;  4RLF A;  4K0K C;  1IB8 A;  3CW9 A;  1MKY A;  4D56 A;  3G7S A;  5K8F A;  2D1S A;  3E7W A;  4KTV A;  1LQL A;  3OTO C;  1IBL C;  1USP B;  5IWA C;  2MM9 A;  1NYE A;  3J80 D;  4LF9 C;  4DV7 C;  3UEB A;  4RMN A;  3A9V A;  5A1I A;  5BSW A;  3GR0 A;  2JMP A;  4DV5 C;  4OX9 C;  5KEI A;  4ZJZ A;  3C5E A;  4JV5 C;  1L2F A;  4PUH A;  3A9U A;  2E8F A;  1WCJ A;  4DG9 A;  2Y4O A;  2D1Q A;  3I07 A;  5LMU C;  2KZ0 A;  3L95 X;  3TDE A;  3RG2 A;  1PA4 A;  2DHM A;  1RG9 A;  3UX3 A;  3KXW A;  3N54 B;  3JAM D;  5CZV A;  1NY8 A;  2F4V C;  4BCA A;  3TQI A;  2UXD C;  2ATW A;  4JI5 C;  2V7B A;  5AE3 A;  4R1L A;  3IML A;  3EER A;  4MH4 A;  5T8T A;  3CQ2 A;  3L8C A;  2D28 C;  2CU6 A;  3T1H C;  2CXC A;  4B3T C;  3T1Y C;  5KYV A;  4DCT A;  4DUY C;  1MXC A;  2VQE C;  3UZ0 A;  5H9U A;  3LUS A;  2OPL A;  1YJ7 A;  3VNS A;  3E7X A;  3PBK A;  4DR4 C;  4K0B A;  4X65 C;  1MXB A;  4DV3 C;  3H2T A;  4YY3 C;  4DV6 C;  4DR5 C;  3EQ6 A;  3A4I A;  3PES A;  5KYT A;  1UKK A;  4DV4 C;  4IR7 A;  2UU9 C;  5ADZ A;  4IZ6 A;  3R9W A;  4NXM C;  2EGT A;  4RVN A;  4LE5 A;  1IBK C;  3UOW A;  4G36 A;  2E7G A;  2D27 A;  1WH9 A;  4DG8 A;  5BSM A;  2ZTB A;  4NXN C;  3DHV A;  2M5H A;  3FCE A;  1MXA A;  4GS5 A;  3GKU A;  2Y4N A;  3IEV A;  4DR6 C;  1JOS A;  2ZM6 C;  4FUT A;  5A2Q D;  1P4E A;  4D57 A;  1O92 A;  2P20 A;  2NCL A;  3S82 A;  3FM7 A;  4WS9 A;  5BST A;  5IT9 D;  3IEU A;  4JYA C;  4FTF A;  1ZB8 A;  1BA3 A;  1K0R A;  2CY1 A;  4PZP A;  2P2J A;  3AF5 A;  5JRH A;  3R44 A;  4OXI A;  2VQF C;  4X66 C;  4PUI A;  1MDF A;  2DPL A;  4LF7 C;  2KDN A;  3AY0 A;  1XMQ C;  4GKK C;  3B7W A;  2P2Q A;  1ZB9 A;  1HNW C;  4TPS B;  1AMU A;  4I9G A;  1WF3 A;  2PG1 E;  1M6X C;  2YWC A;  1XNR C;  1O90 A;  4JI8 C;  4LF6 C;  4WV3 A;  4R0M A;  4OYC A;  1N32 C;  2UUB C;  1O9T A;  3SO4 A;  1TH5 A;  3NI2 A;  4GXR A;  3LAX A;  4LF8 C;  2Y27 A;  2UXB C;  4B3S C;  1HH2 P;  3CQ3 A;  2P2M A;  1ULT A;  2D1T A;  3CW8 X;  3DAY A;  3FCC A;  4DCV A;  2P02 A;  4B3R C;  1N36 C;  3AF6 A;  3R9X A;  1VLA A;  4DCU A;  4L4Q A;  2QVX X;  1MDB A;  3CQ1 A;  5A1G A;  1XRB A;  4D4G A;  4RLQ A;  1VEH A;  5CZX A;  5A19 A;  1XHJ A;  2PT7 G;  4JI0 C;  4KTT A;  4D4I A;  4AQY C;  3TUF A;  4L7I A;  1XDX A;  1GPM A;  2P2F A;  1HNZ C;  4RM3 A;  5BUQ A;  1XRA A;  1XS3 A;  2XR1 A;  3ETC A;  1V26 A;  2QVZ X;  4NDN A;  4XX2 A;  3LNV A;  4RM2 A;  5AE1 A;  4GXQ A;  2WD9 A;  5E7Q A;  4RVO A;  1N33 C;  1I94 C;  3VNR A;  1P4E C;  2YCB A;  4LFB C;  3LNO A;  2BH1 X;  4U5Y D;  2PRO A;  2UUC C;  1KKG A;  1PU1 A;  4MTN A;  2MMA B;  3RV2 A;  1PG4 A;  2HJG A;  4DV2 C;  3J7A D;  3NYR A;  1V25 A;  1UWD A;  3N2Q A;  4G1I A;  2BJO A;  3GPC A;  4B3M C;  5BUS A;  4LF5 C;  4BBY A;  1QM4 A;  3I08 A;  3CJE A;  5BR8 C;  4NOZ A;  4JI6 C;  2JNV A;  2D1R A;  2YX1 A;  1USP A;  3O2E A;  2Z51 A;  2MCQ A;  1QWI A;  1N2F A;  2ONF A;  4HPV A;  2ZZM A;  2YWB A;  4PHT A;  3NYQ A;  5T8S A;  4GKJ C;  1J5E C;  2D7V A;  3PRO C;  4BC7 A;  1P7L A;  1PG3 A;  1FJG C;  1M6X A;  2UUA C;  1XMO C;  5BSR A;  4DR1 C;  1IBM C;  4DR7 C;  3A25 A;  4JM1 A;  5BUR A;  1RY2 A;  3NPD A;  2WP0 C;  2ASB A;  2KZF A;  2HHH C;  2QVY X;  3GR1 A;  2E8E A;  4FUQ A;  1FUG A;  5AE2 A;  4PUG A;  5GTD A;  2E5L C;  2VZE A;  1N34 C;  2ZZN A;  2QW0 X;  4DCS A;  5IFI A;  3VNQ A;  4JI1 C;  4YHH C;  2OO4 A;  1O93 A;  3A26 A;  3K6R A;  4DR2 C;  4ISB A;  4X64 C;  4DV0 C;  2VSQ A;  2E8C A;  4I9F A;  2M5O A;  2OBV A;  5BSU A;  5FLX D;  5LCI A;  1HNX C;  2UXC C;  3UX2 A;  1ML8 A;  4ODJ A;  1EGA A;  4JI3 C;  2OPL B;  4JI4 C;  4BSZ A;  1MD9 A;  1T5H X;  5DV9 A;  4JI2 C;  2AYA A;  3TR3 A;  1V60 A;  4LF4 C;  2E0G A;  3ETO A;  2QL8 A;  4R1M A;  4DR3 C;  5LMN C; 
#chains in the Genus database with same CATH homology
 1T5D X;  3IPL A;  3J81 D;  4L2Z A;  4JI7 C;  4LFA C;  1XNQ C;  4KHP C;  4PRO C;  1HR0 C;  4G37 A;  1XRC A;  4LFC C;  5K85 A;  4EAT A;  4DUZ C;  4X62 C;  3DLP X;  4BC9 A;  1LCI A;  2DYJ A;  4DV1 C;  3LGX A;  5BSV A;  4ZLP A;  2PN2 A;  2P2B A;  4RLF A;  4K0K C;  3CW9 A;  1MKY A;  4D56 A;  3G7S A;  5K8F A;  2D1S A;  3E7W A;  4KTV A;  1LQL A;  1IBL C;  3OTO C;  1USP B;  5IWA C;  1NYE A;  3J80 D;  4LF9 C;  4DV7 C;  4RMN A;  3A9V A;  5A1I A;  5BSW A;  3GR0 A;  2JMP A;  4DV5 C;  4OX9 C;  5KEI A;  4ZJZ A;  3C5E A;  4JV5 C;  1L2F A;  3A9U A;  2E8F A;  4DG9 A;  2Y4O A;  2D1Q A;  3I07 A;  5LMU C;  3L95 X;  3TDE A;  3RG2 A;  1PA4 A;  1RG9 A;  3KXW A;  3N54 B;  3JAM D;  5CZV A;  2F4V C;  4BCA A;  3TQI A;  2UXD C;  2ATW A;  4JI5 C;  2V7B A;  5AE3 A;  4R1L A;  3IML A;  3EER A;  4MH4 A;  5T8T A;  3L8C A;  2D28 C;  3T1H C;  2CXC A;  4B3T C;  3T1Y C;  5KYV A;  4DCT A;  4DUY C;  1MXC A;  2VQE C;  3UZ0 A;  5H9U A;  3LUS A;  2OPL A;  1YJ7 A;  3VNS A;  3E7X A;  3PBK A;  4DR4 C;  4K0B A;  4X65 C;  1MXB A;  4DV3 C;  3H2T A;  4YY3 C;  4DV6 C;  4DR5 C;  3EQ6 A;  3A4I A;  3PES A;  5KYT A;  1UKK A;  4DV4 C;  4IR7 A;  2UU9 C;  5ADZ A;  4IZ6 A;  3R9W A;  4NXM C;  2EGT A;  4RVN A;  4LE5 A;  1IBK C;  3UOW A;  4G36 A;  2E7G A;  2D27 A;  1WH9 A;  4DG8 A;  5BSM A;  4NXN C;  3DHV A;  3FCE A;  1MXA A;  4GS5 A;  3GKU A;  2Y4N A;  3IEV A;  4DR6 C;  1JOS A;  2ZM6 C;  4FUT A;  5A2Q D;  4D57 A;  1O92 A;  2P20 A;  3S82 A;  4WS9 A;  5BST A;  5IT9 D;  3IEU A;  4JYA C;  4FTF A;  1ZB8 A;  1BA3 A;  1K0R A;  2CY1 A;  4PZP A;  2P2J A;  3AF5 A;  5JRH A;  3R44 A;  4OXI A;  2VQF C;  4X66 C;  1MDF A;  2DPL A;  4LF7 C;  1XMQ C;  4GKK C;  3B7W A;  2P2Q A;  1ZB9 A;  1HNW C;  4TPS B;  1AMU A;  4I9G A;  1WF3 A;  2YWC A;  1XNR C;  1O90 A;  4JI8 C;  4LF6 C;  4WV3 A;  4R0M A;  4OYC A;  1N32 C;  2UUB C;  1O9T A;  3SO4 A;  3NI2 A;  4GXR A;  3LAX A;  4LF8 C;  2Y27 A;  2UXB C;  4B3S C;  1HH2 P;  2P2M A;  1ULT A;  2D1T A;  3CW8 X;  3DAY A;  3FCC A;  4DCV A;  2P02 A;  4B3R C;  1N36 C;  3AF6 A;  3R9X A;  1VLA A;  4DCU A;  4L4Q A;  2QVX X;  1MDB A;  5A1G A;  1XRB A;  4D4G A;  4RLQ A;  5CZX A;  5A19 A;  2PT7 G;  4JI0 C;  4KTT A;  4D4I A;  4AQY C;  3TUF A;  4L7I A;  1GPM A;  2P2F A;  1HNZ C;  4RM3 A;  5BUQ A;  1XRA A;  2XR1 A;  3ETC A;  1V26 A;  2QVZ X;  4NDN A;  4XX2 A;  3LNV A;  4RM2 A;  5AE1 A;  4GXQ A;  2WD9 A;  5E7Q A;  4RVO A;  1N33 C;  1I94 C;  3VNR A;  2YCB A;  4LFB C;  2BH1 X;  4U5Y D;  2PRO A;  2UUC C;  1KKG A;  4MTN A;  3RV2 A;  1PG4 A;  2HJG A;  4DV2 C;  3J7A D;  3NYR A;  1V25 A;  3N2Q A;  4G1I A;  2BJO A;  3GPC A;  4B3M C;  5BUS A;  4LF5 C;  4BBY A;  1QM4 A;  3I08 A;  3CJE A;  5BR8 C;  4NOZ A;  4JI6 C;  2D1R A;  1USP A;  1QWI A;  1N2F A;  2ONF A;  4HPV A;  2YWB A;  4PHT A;  3NYQ A;  5T8S A;  4GKJ C;  1J5E C;  2D7V A;  3PRO C;  4BC7 A;  1P7L A;  1PG3 A;  1FJG C;  2UUA C;  1XMO C;  5BSR A;  4DR1 C;  1IBM C;  4DR7 C;  4JM1 A;  5BUR A;  1RY2 A;  3NPD A;  2WP0 C;  2ASB A;  2KZF A;  2HHH C;  2QVY X;  3GR1 A;  2E8E A;  4FUQ A;  1FUG A;  5AE2 A;  5GTD A;  2E5L C;  2VZE A;  1N34 C;  2QW0 X;  4DCS A;  5IFI A;  3VNQ A;  4JI1 C;  4YHH C;  2OO4 A;  1O93 A;  4DR2 C;  4ISB A;  4X64 C;  4DV0 C;  2VSQ A;  2E8C A;  4I9F A;  2OBV A;  5BSU A;  5FLX D;  1HNX C;  2UXC C;  1ML8 A;  4ODJ A;  1EGA A;  4JI3 C;  2OPL B;  4JI4 C;  4BSZ A;  1MD9 A;  1T5H X;  5DV9 A;  4JI2 C;  2AYA A;  4LF4 C;  2E0G A;  3ETO A;  2QL8 A;  4R1M A;  4DR3 C;  5LMN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...