4K0KC

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4k0kC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4k0kC02
2CY1A 2ATWA 2UXCC 4DUYC 2E8CA 4DCUA 4DCVA 4DCTA 4JI6C 1N32C 1XNQC 4JI4C 2KZFA 2OPLB 4YHHC 1IBKC 4NOZA 1WF3A 1HNXC 2UUAC 1QWIA 2ONFA 4MH4A 2UXBC 1I94C 2JMPA 4JI2C 4LF8C 1N36C 4B3RC 1USPA 1PA4A 4JI1C 4GKJC 4LFAC 2HJGA 4JI5C 3J80D 1JOSA 4LF6C 4NXMC 2CXCA 2VQEC 4DV6C 4B3TC 4LFBC 2EGTA 4DV1C 4DV7C 3OTOC 5BR8C 2YCBA 4DR5C 5LMNC 4JI3C 2E8FA 1WH9A 4JI0C 1HR0C 4XX2A 4DR1C 2BJOA 2ASBA 2E7GA 2ZM6C 4NXNC 4JI8C 4JYAC 4MTNA 3AF6A 3IEVA 1NYEA 2E8EA 3EERA 4LF9C 4DV5C 4LF5C 1KKGA 4DUZC 1N34C 5LMUC 4X65C 2OPLA 1IBMC 1UKKA 3J7AD 1MKYA 1FJGC 1VLAA 2UXDC 1J5EC 1EGAA 2D7VA 1XNRC 4BSZA 3AF5A 4OX9C 2F4VC 2UUBC 2QL8A 4GKKC 1ML8A 1ZB8A 1XMOC 3CJEA 2UU9C 4X62C 3JAMD 3J81D 3T1HC 4YY3C 1N2FA 4X64C 1USPB 1HH2P 4KHPC 3GKUA 1LQLA 1IBLC 4DR4C 2PT7G 4B3MC 1K0RA 5IWAC 1N33C 4DV3C 4LF7C 4DV4C 2VQFC 5A2QD 1L2FA 4DR3C 3I07A 4JV5C 4DR7C 3LUSA 3T1YC 4K0KC 4LFCC 2DYJA 3IEUA 2UUCC 4B3SC 4DR6C 5IT9D 1HNZC 4JI7C 2HHHC 1HNWC 3R9WA 2PN2A 4X66C 4DCSA 1XMQC 4AQYC 2XR1A 4LF4C 3R9XA 5FLXD 2E5LC 4DV0C 1ZB9A 4DV2C 4DR2C
chains in the Genus database with same CATH superfamily
4DCUA 4JI6C 3LGXA 4G1IA 1XNQC 1HNXC 4I9FA 2P2JA 1FUGA 1VEHA 5GTDA 1I94C 1N36C 1PA4A 5BSRA 5BSWA 2KZ0A 1MD9A 4GKJC 4LFAC 4D4IA 3PESA 5BSVA 1YGTA 4B3TC 4PUHA 2EGTA 5E7QA 4D57A 5BR8C 4K0BA 2Y4NA 5T8TA 3VNSA 3E7WA 1PU1A 4OXIA 3A26A 3FCCA 2BH1X 3AF6A 4RVOA 1IB8A 1O9TA 3UEBA 2NCLA 3EERA 4DV5C 4LF5C 1V26A 2OPLA 1O92A 2M5HA 4RM2A 3AF5A 1XS3A 2F4VC 4RMNA 3L8CA 1AMUA 2UUBC 4OYCA 2QVXX 5KYVA 3DHVA 3LNVA 3DAYA 3J81D 1P7LA 3CQ3A 1PG3A 1N2FA 3GKUA 3A9VA 3GPCA 2P2MA 4D56A 1L2FA 3LNOA 3B7WA 3LUSA 3KXWA 2QW0X 2YWCA 3IEUA 4IZ6A 4DR6C 1MDBA 5IT9D 2HHHC 1BA3A 2PN2A 3RG2A 4DCSA 1XMQC 1XRCA 2XR1A 4LF4C 4DV0C 2CY1A 4BC9A 4PUGA 2D27A 4JI4C 2OPLB 4L4QA 4YHHC 1IBKC 4NOZA 2Z51A 3TQIA 4WV3A 5K8FA 1XDXA 1NY8A 4L2ZA 3UZ0A 4JI1C 3O2EA 3IMLA 3VNQA 3C5EA 4RM3A 4LF6C 2CXCA 4DV6C 1MDFA 3NYRA 1FLOA 4DV7C 3OTOC 2P02A 5T8SA 5BURA 4JI3C 1XRBA 2QVZX 4JI0C 1HR0C 4XX2A 2V7BA 4PZPA 2VZEA 2BJOA 2P2QA 3AY0A 2ASBA 2E7GA 1V25A 3H2TA 1T5DX 3NYQA 2E0GA 3ETOA 1WCJA 2QVYX 5A1GA 1O90A 4PHTA 4R0MA 3RV2A 1V60A 3J7AD 1MKYA 4GXQA 3NI2A 2VSQA 3CQ1A 4OX9C 3K6RA 2QL8A 1ULTA 5KYTA 2AYAA 5BSTA 1RY2A 3CJEA 5JRHA 2UU9C 3G7SA 3JAMD 2ZZNA 3T1HC 2KDNA 4YY3C 1HH2P 4KHPC 4DR4C 4R1MA 4B3MC 5IWAC 5CZVA 4DV3C 5IFIA 2ZZMA 5DV9A 5BUSA 4U5YD 4ODJA 4JV5C 1MXBA 4GS5A 4DG8A 4RLFA 2DYJA 3A25A 2UUCC 3R9WA 3E7XA 4FTFA 3R9XA 1LCIA 1QM4A 3R44A 3TUFA 2E8CA 4DCVA 2KZFA 1WF3A 1QWIA 2JNVA 3A4IA 3PROC 3UX2A 3N54B 4JI5C 1JOSA 2D1SA 1GPMA 1P4EA 4NDNA 4ZLPA 4DR5C 5LMNC 3EQ6A 1WH9A 2WD9A 5LCIA 1T5HX 5H9UA 4HPVA 4JI8C 1MXAA 4MTNA 2ZTBA 3S82A 3N2QA 1NYEA 2E8EA 2YX1A 1O93A 3I08A 4G36A 3L95X 5LMUC 1UKKA 2UXDC 1J5EC 1EGAA 2D7VA 2MM9A 4BSZA 3TR3A 1RG9A 2D1TA 2DHMA 4JM1A 1ML8A 1ZB8A 4PUIA 1M6XA 3IPLA 3CQ2A 3CW8X 4X64C 1YJ7A 3CW9A 1IBLC 2P2BA 1N33C 1XRAA 4LF7C 2OO4A 4DV4C 4ISBA 5A2QD 4DR3C 5AE3A 3I07A 4PROC 4RLQA 3TDEA 4DR7C 3T1YC 4K0KC 5AE2A 4B3SC 5A19A 2PG1E 2YWBA 4EATA 4AQYC 3PBKA 2P20A 1XHJA 3A9UA 4DR2C 2ATWA 2UXCC 4DUYC 4DCTA 2WP0C 4BBYA 1N32C 2UUAC 3UX3A 1TH5A 5A1IA 4BCAA 2ONFA 4MH4A 2UXBC 4JI2C 2JMPA 4LF8C 4B3RC 1USPA 5ADZA 2HJGA 3J80D 2M5OA 2Y27A 4LE5A 1P4EC 2CU6A 4NXMC 4ZJZA 2VQEC 4WS9A 4DG9A 4LFBC 3ETCA 3DLPX 4DV1C 5K85A 2YCBA 2DPLA 3VNRA 2E8FA 3FM7A 4R1LA 3NPDA 4DR1C 5CZXA 2ZM6C 4NXNC 4JYAC 4KTTA 3FCEA 3IEVA 2P2FA 4FUTA 4LF9C 4RVNA 5BUQA 1KKGA 4DUZC 1N34C 3UOWA 4X65C 1IBMC 2PROA 4L7IA 1FJGC 1VLAA 1PG4A 1XNRC 2D1RA 1M6XC 4GKKC 1MXCA 2D1QA 3SO4A 1UWDA 1XMOC 2Y4OA 2MCQA 4X62C 4I9GA 4KTVA 1USPB 2D28C 2MMAB 5BSUA 3GR1A 1LQLA 4IR7A 2PT7G 1K0RA 5BSMA 2VQFC 4GXRA 5KEIA 3GR0A 4BC7A 4G37A 4FUQA 4LFCC 5AE1A 4D4GA 1HNZC 4JI7C 3LAXA 4TPSB 1HNWC 4X66C 5FLXD 2E5LC 1ZB9A 2OBVA 4DV2C
chains in the Genus database with same CATH topology
4DCUA 4JI6C 3LGXA 4G1IA 1XNQC 1HNXC 4I9FA 2P2JA 1FUGA 5GTDA 1I94C 1N36C 1PA4A 5BSRA 5BSWA 1MD9A 4GKJC 4LFAC 4D4IA 3PESA 5BSVA 4B3TC 2EGTA 5E7QA 4D57A 5BR8C 4K0BA 2Y4NA 5T8TA 3VNSA 3E7WA 4OXIA 3FCCA 2BH1X 3AF6A 4RVOA 1O9TA 3EERA 4DV5C 4LF5C 1V26A 2OPLA 1O92A 4RM2A 3AF5A 2F4VC 4RMNA 3L8CA 1AMUA 2UUBC 4OYCA 2QVXX 5KYVA 3DHVA 3LNVA 3DAYA 3J81D 1P7LA 1PG3A 1N2FA 3GKUA 3A9VA 3GPCA 2P2MA 4D56A 1L2FA 3B7WA 3LUSA 3KXWA 2QW0X 2YWCA 3IEUA 4IZ6A 4DR6C 1MDBA 5IT9D 2HHHC 1BA3A 2PN2A 1XMQC 3RG2A 4DCSA 1XRCA 2XR1A 4LF4C 4DV0C 2CY1A 4BC9A 2D27A 4JI4C 2OPLB 4L4QA 4YHHC 1IBKC 4NOZA 3TQIA 4WV3A 5K8FA 4L2ZA 3UZ0A 4JI1C 3IMLA 3VNQA 3C5EA 4RM3A 4LF6C 2CXCA 4DV6C 1MDFA 3NYRA 4DV7C 3OTOC 2P02A 5T8SA 5BURA 4JI3C 1XRBA 2QVZX 4JI0C 1HR0C 4XX2A 2V7BA 4PZPA 2VZEA 2BJOA 2P2QA 2ASBA 2E7GA 1V25A 3H2TA 1T5DX 3NYQA 2E0GA 3ETOA 2QVYX 5A1GA 1O90A 4PHTA 4R0MA 3RV2A 3J7AD 1MKYA 4GXQA 3NI2A 2VSQA 4OX9C 2QL8A 1ULTA 5KYTA 2AYAA 5BSTA 1RY2A 3CJEA 5JRHA 2UU9C 3G7SA 3JAMD 3T1HC 4YY3C 1HH2P 4KHPC 4DR4C 4R1MA 4B3MC 5IWAC 5CZVA 4DV3C 5IFIA 5DV9A 5BUSA 4U5YD 4ODJA 4JV5C 1MXBA 4GS5A 4DG8A 4RLFA 2DYJA 2UUCC 3R9WA 3E7XA 4FTFA 3R9XA 1LCIA 1QM4A 3R44A 3TUFA 2E8CA 4DCVA 2KZFA 1WF3A 1QWIA 3A4IA 3PROC 3N54B 4JI5C 1JOSA 2D1SA 1GPMA 4NDNA 4ZLPA 4DR5C 5LMNC 3EQ6A 1WH9A 2WD9A 1T5HX 5H9UA 4HPVA 4JI8C 1MXAA 4MTNA 3S82A 3N2QA 1NYEA 2E8EA 1O93A 3I08A 4G36A 3L95X 5LMUC 1UKKA 2UXDC 1J5EC 1EGAA 2D7VA 4BSZA 1RG9A 2D1TA 4JM1A 1ML8A 1ZB8A 3IPLA 3CW8X 4X64C 1YJ7A 3CW9A 1IBLC 2P2BA 1N33C 1XRAA 4LF7C 2OO4A 4DV4C 4ISBA 5A2QD 4DR3C 5AE3A 3I07A 4PROC 4RLQA 3TDEA 4DR7C 3T1YC 4K0KC 5AE2A 4B3SC 5A19A 2YWBA 4EATA 4AQYC 3PBKA 2P20A 3A9UA 4DR2C 2ATWA 2UXCC 4DUYC 4DCTA 2WP0C 4BBYA 1N32C 2UUAC 5A1IA 4BCAA 2ONFA 4MH4A 2UXBC 4JI2C 2JMPA 4LF8C 4B3RC 1USPA 5ADZA 2HJGA 3J80D 2Y27A 4LE5A 4NXMC 4ZJZA 2VQEC 4WS9A 4DG9A 4LFBC 3ETCA 3DLPX 4DV1C 5K85A 2YCBA 2DPLA 3VNRA 2E8FA 4R1LA 3NPDA 4DR1C 5CZXA 2ZM6C 4NXNC 4JYAC 4KTTA 3FCEA 3IEVA 2P2FA 4FUTA 4LF9C 4RVNA 5BUQA 1KKGA 4DUZC 1N34C 3UOWA 4X65C 1IBMC 2PROA 4L7IA 1FJGC 1VLAA 1PG4A 1XNRC 2D1RA 4GKKC 1MXCA 2D1QA 3SO4A 1XMOC 2Y4OA 4X62C 4I9GA 4KTVA 1USPB 2D28C 5BSUA 3GR1A 1LQLA 4IR7A 2PT7G 1K0RA 5BSMA 2VQFC 4GXRA 5KEIA 3GR0A 4BC7A 4G37A 4FUQA 4LFCC 5AE1A 4D4GA 1HNZC 4JI7C 3LAXA 4TPSB 1HNWC 4X66C 5FLXD 2E5LC 1ZB9A 2OBVA 4DV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  2ATW A;  2UXC C;  4DUY C;  2E8C A;  4DCU A;  4DCV A;  4DCT A;  4JI6 C;  1N32 C;  1XNQ C;  4JI4 C;  2KZF A;  2OPL B;  4YHH C;  1IBK C;  4NOZ A;  1WF3 A;  1HNX C;  2UUA C;  1QWI A;  2ONF A;  4MH4 A;  2UXB C;  1I94 C;  2JMP A;  4JI2 C;  4LF8 C;  1N36 C;  4B3R C;  1USP A;  1PA4 A;  4JI1 C;  4GKJ C;  4LFA C;  2HJG A;  4JI5 C;  3J80 D;  1JOS A;  4LF6 C;  4NXM C;  2CXC A;  2VQE C;  4DV6 C;  4B3T C;  4LFB C;  2EGT A;  4DV1 C;  4DV7 C;  3OTO C;  5BR8 C;  2YCB A;  4DR5 C;  5LMN C;  4JI3 C;  2E8F A;  1WH9 A;  4JI0 C;  1HR0 C;  4XX2 A;  4DR1 C;  2BJO A;  2ASB A;  2E7G A;  2ZM6 C;  4NXN C;  4JI8 C;  4JYA C;  4MTN A;  3AF6 A;  3IEV A;  1NYE A;  2E8E A;  3EER A;  4LF9 C;  4DV5 C;  4LF5 C;  1KKG A;  4DUZ C;  1N34 C;  5LMU C;  4X65 C;  2OPL A;  1IBM C;  1UKK A;  3J7A D;  1MKY A;  1FJG C;  1VLA A;  2UXD C;  1J5E C;  1EGA A;  2D7V A;  1XNR C;  4BSZ A;  3AF5 A;  4OX9 C;  2F4V C;  2UUB C;  2QL8 A;  4GKK C;  1ML8 A;  1ZB8 A;  1XMO C;  3CJE A;  2UU9 C;  4X62 C;  3JAM D;  3J81 D;  3T1H C;  4YY3 C;  1N2F A;  4X64 C;  1USP B;  1HH2 P;  4KHP C;  3GKU A;  1LQL A;  1IBL C;  4DR4 C;  2PT7 G;  4B3M C;  1K0R A;  5IWA C;  1N33 C;  4DV3 C;  4LF7 C;  4DV4 C;  2VQF C;  5A2Q D;  1L2F A;  4DR3 C;  3I07 A;  4JV5 C;  4DR7 C;  3LUS A;  3T1Y C;  4K0K C;  4LFC C;  2DYJ A;  3IEU A;  2UUC C;  4B3S C;  4DR6 C;  5IT9 D;  1HNZ C;  4JI7 C;  2HHH C;  1HNW C;  3R9W A;  2PN2 A;  4X66 C;  4DCS A;  1XMQ C;  4AQY C;  2XR1 A;  4LF4 C;  3R9X A;  5FLX D;  2E5L C;  4DV0 C;  1ZB9 A;  4DV2 C;  4DR2 C; 
#chains in the Genus database with same CATH topology
 4DCU A;  4JI6 C;  3LGX A;  4G1I A;  1XNQ C;  1HNX C;  4I9F A;  2P2J A;  1FUG A;  1VEH A;  5GTD A;  1I94 C;  1N36 C;  1PA4 A;  5BSR A;  5BSW A;  2KZ0 A;  1MD9 A;  4GKJ C;  4LFA C;  4D4I A;  3PES A;  5BSV A;  1YGT A;  4B3T C;  4PUH A;  2EGT A;  5E7Q A;  4D57 A;  5BR8 C;  4K0B A;  2Y4N A;  5T8T A;  3VNS A;  3E7W A;  1PU1 A;  4OXI A;  3A26 A;  3FCC A;  2BH1 X;  3AF6 A;  4RVO A;  1IB8 A;  1O9T A;  3UEB A;  2NCL A;  3EER A;  4DV5 C;  4LF5 C;  1V26 A;  2OPL A;  1O92 A;  2M5H A;  4RM2 A;  3AF5 A;  1XS3 A;  2F4V C;  4RMN A;  3L8C A;  1AMU A;  2UUB C;  4OYC A;  2QVX X;  5KYV A;  3DHV A;  3LNV A;  3DAY A;  3J81 D;  1P7L A;  3CQ3 A;  1PG3 A;  1N2F A;  3GKU A;  3A9V A;  3GPC A;  2P2M A;  4D56 A;  1L2F A;  3LNO A;  3B7W A;  3LUS A;  3KXW A;  2QW0 X;  2YWC A;  3IEU A;  4IZ6 A;  4DR6 C;  1MDB A;  5IT9 D;  2HHH C;  1BA3 A;  2PN2 A;  3RG2 A;  4DCS A;  1XMQ C;  1XRC A;  2XR1 A;  4LF4 C;  4DV0 C;  2CY1 A;  4BC9 A;  4PUG A;  2D27 A;  4JI4 C;  2OPL B;  4L4Q A;  4YHH C;  1IBK C;  4NOZ A;  2Z51 A;  3TQI A;  4WV3 A;  5K8F A;  1XDX A;  1NY8 A;  4L2Z A;  3UZ0 A;  4JI1 C;  3O2E A;  3IML A;  3VNQ A;  3C5E A;  4RM3 A;  4LF6 C;  2CXC A;  4DV6 C;  1MDF A;  3NYR A;  1FLO A;  4DV7 C;  3OTO C;  2P02 A;  5T8S A;  5BUR A;  4JI3 C;  1XRB A;  2QVZ X;  4JI0 C;  1HR0 C;  4XX2 A;  2V7B A;  4PZP A;  2VZE A;  2BJO A;  2P2Q A;  3AY0 A;  2ASB A;  2E7G A;  1V25 A;  3H2T A;  1T5D X;  3NYQ A;  2E0G A;  3ETO A;  1WCJ A;  2QVY X;  5A1G A;  1O90 A;  4PHT A;  4R0M A;  3RV2 A;  1V60 A;  3J7A D;  1MKY A;  4GXQ A;  3NI2 A;  2VSQ A;  3CQ1 A;  4OX9 C;  3K6R A;  2QL8 A;  1ULT A;  5KYT A;  2AYA A;  5BST A;  1RY2 A;  3CJE A;  5JRH A;  2UU9 C;  3G7S A;  3JAM D;  2ZZN A;  3T1H C;  2KDN A;  4YY3 C;  1HH2 P;  4KHP C;  4DR4 C;  4R1M A;  4B3M C;  5IWA C;  5CZV A;  4DV3 C;  5IFI A;  2ZZM A;  5DV9 A;  5BUS A;  4U5Y D;  4ODJ A;  4JV5 C;  1MXB A;  4GS5 A;  4DG8 A;  4RLF A;  2DYJ A;  3A25 A;  2UUC C;  3R9W A;  3E7X A;  4FTF A;  3R9X A;  1LCI A;  1QM4 A;  3R44 A;  3TUF A;  2E8C A;  4DCV A;  2KZF A;  1WF3 A;  1QWI A;  2JNV A;  3A4I A;  3PRO C;  3UX2 A;  3N54 B;  4JI5 C;  1JOS A;  2D1S A;  1GPM A;  1P4E A;  4NDN A;  4ZLP A;  4DR5 C;  5LMN C;  3EQ6 A;  1WH9 A;  2WD9 A;  5LCI A;  1T5H X;  5H9U A;  4HPV A;  4JI8 C;  1MXA A;  4MTN A;  2ZTB A;  3S82 A;  3N2Q A;  1NYE A;  2E8E A;  2YX1 A;  1O93 A;  3I08 A;  4G36 A;  3L95 X;  5LMU C;  1UKK A;  2UXD C;  1J5E C;  1EGA A;  2D7V A;  2MM9 A;  4BSZ A;  3TR3 A;  1RG9 A;  2D1T A;  2DHM A;  4JM1 A;  1ML8 A;  1ZB8 A;  4PUI A;  1M6X A;  3IPL A;  3CQ2 A;  3CW8 X;  4X64 C;  1YJ7 A;  3CW9 A;  1IBL C;  2P2B A;  1N33 C;  1XRA A;  4LF7 C;  2OO4 A;  4DV4 C;  4ISB A;  5A2Q D;  4DR3 C;  5AE3 A;  3I07 A;  4PRO C;  4RLQ A;  3TDE A;  4DR7 C;  3T1Y C;  4K0K C;  5AE2 A;  4B3S C;  5A19 A;  2PG1 E;  2YWB A;  4EAT A;  4AQY C;  3PBK A;  2P20 A;  1XHJ A;  3A9U A;  4DR2 C;  2ATW A;  2UXC C;  4DUY C;  4DCT A;  2WP0 C;  4BBY A;  1N32 C;  2UUA C;  3UX3 A;  1TH5 A;  5A1I A;  4BCA A;  2ONF A;  4MH4 A;  2UXB C;  4JI2 C;  2JMP A;  4LF8 C;  4B3R C;  1USP A;  5ADZ A;  2HJG A;  3J80 D;  2M5O A;  2Y27 A;  4LE5 A;  1P4E C;  2CU6 A;  4NXM C;  4ZJZ A;  2VQE C;  4WS9 A;  4DG9 A;  4LFB C;  3ETC A;  3DLP X;  4DV1 C;  5K85 A;  2YCB A;  2DPL A;  3VNR A;  2E8F A;  3FM7 A;  4R1L A;  3NPD A;  4DR1 C;  5CZX A;  2ZM6 C;  4NXN C;  4JYA C;  4KTT A;  3FCE A;  3IEV A;  2P2F A;  4FUT A;  4LF9 C;  4RVN A;  5BUQ A;  1KKG A;  4DUZ C;  1N34 C;  3UOW A;  4X65 C;  1IBM C;  2PRO A;  4L7I A;  1FJG C;  1VLA A;  1PG4 A;  1XNR C;  2D1R A;  1M6X C;  4GKK C;  1MXC A;  2D1Q A;  3SO4 A;  1UWD A;  1XMO C;  2Y4O A;  2MCQ A;  4X62 C;  4I9G A;  4KTV A;  1USP B;  2D28 C;  2MMA B;  5BSU A;  3GR1 A;  1LQL A;  4IR7 A;  2PT7 G;  1K0R A;  5BSM A;  2VQF C;  4GXR A;  5KEI A;  3GR0 A;  4BC7 A;  4G37 A;  4FUQ A;  4LFC C;  5AE1 A;  4D4G A;  1HNZ C;  4JI7 C;  3LAX A;  4TPS B;  1HNW C;  4X66 C;  5FLX D;  2E5L C;  1ZB9 A;  2OBV A;  4DV2 C; 
#chains in the Genus database with same CATH homology
 4DCU A;  4JI6 C;  3LGX A;  4G1I A;  1XNQ C;  1HNX C;  4I9F A;  2P2J A;  1FUG A;  5GTD A;  1I94 C;  1N36 C;  1PA4 A;  5BSR A;  5BSW A;  1MD9 A;  4GKJ C;  4LFA C;  4D4I A;  3PES A;  5BSV A;  4B3T C;  2EGT A;  5E7Q A;  4D57 A;  5BR8 C;  4K0B A;  2Y4N A;  5T8T A;  3VNS A;  3E7W A;  4OXI A;  3FCC A;  2BH1 X;  3AF6 A;  4RVO A;  1O9T A;  3EER A;  4DV5 C;  4LF5 C;  1V26 A;  2OPL A;  1O92 A;  4RM2 A;  3AF5 A;  2F4V C;  4RMN A;  3L8C A;  1AMU A;  2UUB C;  4OYC A;  2QVX X;  5KYV A;  3DHV A;  3LNV A;  3DAY A;  3J81 D;  1P7L A;  1PG3 A;  1N2F A;  3GKU A;  3A9V A;  3GPC A;  2P2M A;  4D56 A;  1L2F A;  3B7W A;  3LUS A;  3KXW A;  2QW0 X;  2YWC A;  3IEU A;  4IZ6 A;  4DR6 C;  1MDB A;  5IT9 D;  2HHH C;  1BA3 A;  2PN2 A;  1XMQ C;  3RG2 A;  4DCS A;  1XRC A;  2XR1 A;  4LF4 C;  4DV0 C;  2CY1 A;  4BC9 A;  2D27 A;  4JI4 C;  2OPL B;  4L4Q A;  4YHH C;  1IBK C;  4NOZ A;  3TQI A;  4WV3 A;  5K8F A;  4L2Z A;  3UZ0 A;  4JI1 C;  3IML A;  3VNQ A;  3C5E A;  4RM3 A;  4LF6 C;  2CXC A;  4DV6 C;  1MDF A;  3NYR A;  4DV7 C;  3OTO C;  2P02 A;  5T8S A;  5BUR A;  4JI3 C;  1XRB A;  2QVZ X;  4JI0 C;  1HR0 C;  4XX2 A;  2V7B A;  4PZP A;  2VZE A;  2BJO A;  2P2Q A;  2ASB A;  2E7G A;  1V25 A;  3H2T A;  1T5D X;  3NYQ A;  2E0G A;  3ETO A;  2QVY X;  5A1G A;  1O90 A;  4PHT A;  4R0M A;  3RV2 A;  3J7A D;  1MKY A;  4GXQ A;  3NI2 A;  2VSQ A;  4OX9 C;  2QL8 A;  1ULT A;  5KYT A;  2AYA A;  5BST A;  1RY2 A;  3CJE A;  5JRH A;  2UU9 C;  3G7S A;  3JAM D;  3T1H C;  4YY3 C;  1HH2 P;  4KHP C;  4DR4 C;  4R1M A;  4B3M C;  5IWA C;  5CZV A;  4DV3 C;  5IFI A;  5DV9 A;  5BUS A;  4U5Y D;  4ODJ A;  4JV5 C;  1MXB A;  4GS5 A;  4DG8 A;  4RLF A;  2DYJ A;  2UUC C;  3R9W A;  3E7X A;  4FTF A;  3R9X A;  1LCI A;  1QM4 A;  3R44 A;  3TUF A;  2E8C A;  4DCV A;  2KZF A;  1WF3 A;  1QWI A;  3A4I A;  3PRO C;  3N54 B;  4JI5 C;  1JOS A;  2D1S A;  1GPM A;  4NDN A;  4ZLP A;  4DR5 C;  5LMN C;  3EQ6 A;  1WH9 A;  2WD9 A;  1T5H X;  5H9U A;  4HPV A;  4JI8 C;  1MXA A;  4MTN A;  3S82 A;  3N2Q A;  1NYE A;  2E8E A;  1O93 A;  3I08 A;  4G36 A;  3L95 X;  5LMU C;  1UKK A;  2UXD C;  1J5E C;  1EGA A;  2D7V A;  4BSZ A;  1RG9 A;  2D1T A;  4JM1 A;  1ML8 A;  1ZB8 A;  3IPL A;  3CW8 X;  4X64 C;  1YJ7 A;  3CW9 A;  1IBL C;  2P2B A;  1N33 C;  1XRA A;  4LF7 C;  2OO4 A;  4DV4 C;  4ISB A;  5A2Q D;  4DR3 C;  5AE3 A;  3I07 A;  4PRO C;  4RLQ A;  3TDE A;  4DR7 C;  3T1Y C;  4K0K C;  5AE2 A;  4B3S C;  5A19 A;  2YWB A;  4EAT A;  4AQY C;  3PBK A;  2P20 A;  3A9U A;  4DR2 C;  2ATW A;  2UXC C;  4DUY C;  4DCT A;  2WP0 C;  4BBY A;  1N32 C;  2UUA C;  5A1I A;  4BCA A;  2ONF A;  4MH4 A;  2UXB C;  4JI2 C;  2JMP A;  4LF8 C;  4B3R C;  1USP A;  5ADZ A;  2HJG A;  3J80 D;  2Y27 A;  4LE5 A;  4NXM C;  4ZJZ A;  2VQE C;  4WS9 A;  4DG9 A;  4LFB C;  3ETC A;  3DLP X;  4DV1 C;  5K85 A;  2YCB A;  2DPL A;  3VNR A;  2E8F A;  4R1L A;  3NPD A;  4DR1 C;  5CZX A;  2ZM6 C;  4NXN C;  4JYA C;  4KTT A;  3FCE A;  3IEV A;  2P2F A;  4FUT A;  4LF9 C;  4RVN A;  5BUQ A;  1KKG A;  4DUZ C;  1N34 C;  3UOW A;  4X65 C;  1IBM C;  2PRO A;  4L7I A;  1FJG C;  1VLA A;  1PG4 A;  1XNR C;  2D1R A;  4GKK C;  1MXC A;  2D1Q A;  3SO4 A;  1XMO C;  2Y4O A;  4X62 C;  4I9G A;  4KTV A;  1USP B;  2D28 C;  5BSU A;  3GR1 A;  1LQL A;  4IR7 A;  2PT7 G;  1K0R A;  5BSM A;  2VQF C;  4GXR A;  5KEI A;  3GR0 A;  4BC7 A;  4G37 A;  4FUQ A;  4LFC C;  5AE1 A;  4D4G A;  1HNZ C;  4JI7 C;  3LAX A;  4TPS B;  1HNW C;  4X66 C;  5FLX D;  2E5L C;  1ZB9 A;  2OBV A;  4DV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...