4K0KC

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4k0kC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4k0kC02
2XR1A 3GKUA 1PA4A 1L2FA 3T1HC 4X66C 2E8CA 2OPLA 4X64C 1WH9A 4DV7C 4NXNC 4JI8C 4MH4A 2UUBC 4LF8C 4GKJC 2JMPA 4DR6C 4NXMC 5IWAC 1USPA 1XNQC 1HH2P 3LUSA 4DR3C 4K0KC 4X62C 4B3SC 2QL8A 5BR8C 3JAMD 2E8EA 4LF9C 2HHHC 2PT7G 3J80D 2UUCC 3AF6A 1J5EC 1QWIA 1UKKA 2CXCA 2E5LC 2UXDC 1WF3A 1EGAA 1ZB8A 1N36C 4LF5C 2OPLB 2KZFA 4DV0C 4JI1C 4LFCC 4JI5C 4KHPC 1I94C 4XX2A 2UU9C 4JI2C 4OX9C 3R9WA 1USPB 1HR0C 4X65C 4LF6C 4NOZA 4B3TC 1K0RA 2UUAC 3IEUA 4DR5C 1KKGA 1N33C 4LF4C 2E7GA 4JYAC 3T1YC 5FLXD 1ZB9A 4DV3C 4DR7C 4DUYC 4DV4C 2ZM6C 1HNZC 4DR4C 4JI3C 4DR1C 2DYJA 4GKKC 4JI6C 4LF7C 1XNRC 3IEVA 1NYEA 4DV2C 1XMOC 4MTNA 4JV5C 2VQFC 4JI7C 2VQEC 3R9XA 2EGTA 5A2QD 4JI4C 4YHHC 3J7AD 4LFBC 4DV1C 4DCTA 1VLAA 2D7VA 4BSZA 2ATWA 2BJOA 3CJEA 3OTOC 4B3RC 4DCSA 4YY3C 1N32C 2UXCC 1N2FA 3J81D 4DR2C 5IT9D 4JI0C 1HNXC 1N34C 4LFAC 4DCUA 1XMQC 2PN2A 1MKYA 4DCVA 4DUZC 2YCBA 1IBMC 3AF5A 2ONFA 4B3MC 1HNWC 4AQYC 1IBLC 3EERA 2CY1A 1JOSA 4DV6C 2F4VC 5LMNC 1FJGC 2E8FA 2ASBA 1LQLA 1IBKC 5LMUC 3I07A 2HJGA 1ML8A 2UXBC 4DV5C
chains in the Genus database with same CATH superfamily
1XRAA 1PA4A 2D1SA 5KYTA 2E8CA 1XDXA 4DG8A 4DV7C 4JI8C 2UUBC 4G37A 1IB8A 4I9FA 2MMAB 3CW8X 2YWBA 4X62C 2QL8A 5BR8C 3JAMD 4BCAA 2E8EA 3J80D 2QVZX 3E7WA 1J5EC 3CQ3A 2MCQA 2QW0X 5BSRA 3DHVA 2WP0C 1FUGA 1WF3A 3UZ0A 2Y4OA 3N2QA 3TDEA 2OPLB 4DV0C 3SO4A 1I94C 2UU9C 4G1IA 4RLFA 3LGXA 3EQ6A 3CQ1A 1USPB 1HR0C 5KEIA 4X65C 1BA3A 4NOZA 1K0RA 4PUIA 2UUAC 3L8CA 1N33C 2V7BA 5AE3A 4GXQA 3A9UA 3RG2A 1HNZC 4DV4C 2ZM6C 3DAYA 2DYJA 2D1TA 2WD9A 4D57A 3FCCA 4JI6C 1M6XC 5A19A 3J7AD 4LFBC 1PG3A 2ATWA 2BJOA 3ETOA 2P2JA 2UXCC 3J81D 3PESA 4DCVA 4EATA 3AF5A 1GPMA 4WS9A 4AQYC 1IBLC 2KZ0A 1JOSA 5BSMA 4FTFA 4DV6C 3KXWA 1LQLA 1IBKC 4TPSB 3I07A 2HJGA 4PROC 3FM7A 4KTTA 2P2BA 1MDFA 5BSUA 3GR1A 2XR1A 3A9VA 4IR7A 3T1HC 4X66C 5BSVA 2OPLA 4X64C 4MH4A 4GKJC 1UWDA 4NXMC 1USPA 1T5DX 1XNQC 1HH2P 3I08A 4PUGA 2UUCC 1WCJA 3VNSA 1O92A 1UKKA 3TR3A 3UOWA 4L2ZA 4K0BA 2CU6A 1N36C 2KZFA 2DHMA 4JI1C 4LFCC 4JI5C 1LCIA 1PU1A 4XX2A 3B7WA 1MXBA 3R9WA 4PHTA 1O9TA 4LF6C 4DR5C 3R44A 5GTDA 4LF4C 2QVXX 3UEBA 2YX1A 5FLXD 1ZB9A 5T8SA 3UX2A 3H2TA 4L4QA 4DR7C 3K6RA 1O93A 2PG1E 2M5HA 4RLQA 3L95X 3VNRA 4R0MA 5K8FA 4JV5C 2VQFC 2QVYX 4JI7C 5ADZA 4U5YD 2VQEC 4L7IA 4D4IA 1FLOA 5JRHA 3S82A 3E7XA 3OTOC 1MD9A 3CJEA 2MM9A 3LNVA 5BSTA 5A1IA 1N32C 4ZJZA 5E7QA 5H9UA 4JI0C 4ZLPA 4BBYA 1XMQC 3NI2A 1MKYA 4DUZC 1XRCA 4OYCA 3PBKA 4RVOA 1FJGC 2E8FA 1ML8A 3DLPX 2UXBC 3CQ2A 3O2EA 3GKUA 1RG9A 2Z51A 4BC7A 2ZTBA 1WH9A 2BH1X 4NXNC 5K85A 3A25A 4DR6C 2P2FA 5IWAC 3VNQA 2PROA 4PZPA 3LUSA 4DR3C 4K0KC 1P4EA 4B3SC 3AF6A 2OO4A 1QWIA 2E5LC 2ZZNA 5BSWA 1EGAA 5DV9A 4KHPC 2D28C 1T5HX 3GR0A 4WV3A 4LE5A 4B3TC 2D1RA 3IEUA 5CZXA 4HPVA 5T8TA 2M5OA 4DV3C 3TQIA 4DUYC 2KDNA 4JI3C 4DR4C 3IMLA 4LF7C 1XNRC 3AY0A 4DV2C 1M6XA 3G7SA 2DPLA 4JI4C 3UX3A 4D4GA 1O90A 1NY8A 4NDNA 1VLAA 1YGTA 4RMNA 1XRBA 2D7VA 2YWCA 1N2FA 1MDBA 1VEHA 5CZVA 4DR2C 5IT9D 5AE1A 1QM4A 2P20A 2JNVA 3CW9A 2VSQA 1XHJA 3A26A 4FUQA 2YCBA 1IBMC 2ONFA 4B3MC 1HNWC 3EERA 2P2QA 1V60A 5BURA 1AMUA 4OXIA 3NYRA 3NPDA 4DG9A 5IFIA 3PROC 1L2FA 3TUFA 1RY2A 2ZZMA 4R1MA 4LF8C 2OBVA 4IZ6A 2JMPA 2D1QA 3RV2A 4LF9C 4PUHA 2HHHC 2PT7G 1TH5A 3N54B 1P4EC 1V25A 2CXCA 2UXDC 5BUQA 1ZB8A 4LF5C 1PG4A 4JI2C 2NCLA 4OX9C 1MXCA 2E0GA 2VZEA 4FUTA 1KKGA 4RM2A 2E7GA 1MXAA 4R1LA 3ETCA 4JYAC 2P2MA 3T1YC 1ULTA 5BUSA 3FCEA 4DR1C 2Y4NA 1P7LA 4GKKC 4GXRA 2D27A 3A4IA 3IEVA 1NYEA 5LCIA 1XMOC 4MTNA 4RVNA 3IPLA 2EGTA 3R9XA 5A2QD 4ODJA 4YHHC 3C5EA 1V26A 4DV1C 4DCTA 5KYVA 4BSZA 5A1GA 4B3RC 4DCSA 4YY3C 4KTVA 1XS3A 4I9GA 4RM3A 1HNXC 1N34C 4LFAC 4DCUA 4JM1A 2PN2A 3LNOA 4ISBA 1YJ7A 4G36A 2P02A 4BC9A 2CY1A 3GPCA 2F4VC 5AE2A 5LMNC 2ASBA 5LMUC 4D56A 2Y27A 3NYQA 4GS5A 4DV5C 3LAXA 2AYAA
chains in the Genus database with same CATH topology
1XRAA 1PA4A 2D1SA 5KYTA 2E8CA 4DG8A 4DV7C 4JI8C 2UUBC 4G37A 4I9FA 3CW8X 2YWBA 4X62C 2QL8A 5BR8C 3JAMD 4BCAA 2E8EA 3J80D 2QVZX 3E7WA 1J5EC 2QW0X 5BSRA 3DHVA 2WP0C 1FUGA 1WF3A 3UZ0A 2Y4OA 3N2QA 3TDEA 2OPLB 4DV0C 3SO4A 1I94C 2UU9C 4G1IA 4RLFA 3LGXA 3EQ6A 1USPB 1HR0C 5KEIA 4X65C 1BA3A 4NOZA 1K0RA 2UUAC 3L8CA 1N33C 2V7BA 5AE3A 4GXQA 3A9UA 3RG2A 1HNZC 4DV4C 2ZM6C 3DAYA 2DYJA 2D1TA 2WD9A 4D57A 3FCCA 4JI6C 5A19A 3J7AD 4LFBC 1PG3A 2ATWA 2BJOA 3ETOA 2P2JA 2UXCC 3J81D 3PESA 4DCVA 4EATA 3AF5A 1GPMA 4WS9A 4AQYC 1IBLC 1JOSA 5BSMA 4FTFA 4DV6C 3KXWA 1LQLA 1IBKC 4TPSB 3I07A 2HJGA 4PROC 4KTTA 2P2BA 1MDFA 5BSUA 3GR1A 2XR1A 3A9VA 4IR7A 3T1HC 4X66C 5BSVA 2OPLA 4X64C 4MH4A 4GKJC 4NXMC 1USPA 1T5DX 1XNQC 1HH2P 3I08A 2UUCC 3VNSA 1O92A 1UKKA 3UOWA 4L2ZA 4K0BA 1N36C 2KZFA 4JI1C 4LFCC 4JI5C 1LCIA 4XX2A 3B7WA 1MXBA 3R9WA 4PHTA 1O9TA 4LF6C 4DR5C 3R44A 5GTDA 4LF4C 2QVXX 5FLXD 1ZB9A 5T8SA 3H2TA 4L4QA 4DR7C 1O93A 4RLQA 3L95X 3VNRA 4R0MA 5K8FA 4JV5C 2VQFC 2QVYX 4JI7C 5ADZA 4U5YD 2VQEC 4L7IA 4D4IA 5JRHA 3S82A 3E7XA 3OTOC 1MD9A 3CJEA 3LNVA 5BSTA 5A1IA 1N32C 4ZJZA 5E7QA 5H9UA 4JI0C 4ZLPA 4BBYA 1XMQC 3NI2A 1MKYA 4DUZC 1XRCA 4OYCA 3PBKA 4RVOA 1FJGC 2E8FA 1ML8A 3DLPX 2UXBC 3GKUA 1RG9A 4BC7A 1WH9A 2BH1X 4NXNC 5K85A 4DR6C 2P2FA 5IWAC 3VNQA 2PROA 4PZPA 3LUSA 4DR3C 4K0KC 4B3SC 3AF6A 2OO4A 1QWIA 2E5LC 5BSWA 1EGAA 5DV9A 4KHPC 2D28C 1T5HX 3GR0A 4WV3A 4LE5A 4B3TC 2D1RA 3IEUA 5CZXA 4HPVA 5T8TA 4DV3C 3TQIA 4DUYC 4DR4C 4JI3C 3IMLA 4LF7C 1XNRC 4DV2C 3G7SA 2DPLA 4JI4C 4D4GA 1O90A 4NDNA 1VLAA 4RMNA 1XRBA 2D7VA 2YWCA 1N2FA 1MDBA 5CZVA 5IT9D 4DR2C 5AE1A 1QM4A 2P20A 3CW9A 2VSQA 4FUQA 2YCBA 1IBMC 4B3MC 2ONFA 1HNWC 3EERA 2P2QA 5BURA 1AMUA 4OXIA 3NYRA 3NPDA 4DG9A 5IFIA 3PROC 1L2FA 3TUFA 1RY2A 4R1MA 4LF8C 2OBVA 4IZ6A 2JMPA 2D1QA 3RV2A 4LF9C 2HHHC 2PT7G 3N54B 1V25A 2CXCA 2UXDC 5BUQA 1ZB8A 4LF5C 1PG4A 4JI2C 4OX9C 1MXCA 2E0GA 2VZEA 4FUTA 1KKGA 4RM2A 2E7GA 1MXAA 4R1LA 3ETCA 4JYAC 2P2MA 3T1YC 1ULTA 5BUSA 3FCEA 4DR1C 2Y4NA 1P7LA 4GKKC 4GXRA 2D27A 3A4IA 3IEVA 1NYEA 1XMOC 4MTNA 4RVNA 3IPLA 2EGTA 3R9XA 5A2QD 4ODJA 4YHHC 3C5EA 1V26A 4DV1C 4DCTA 5KYVA 4BSZA 5A1GA 4B3RC 4DCSA 4YY3C 4KTVA 4I9GA 4RM3A 1HNXC 1N34C 4LFAC 4DCUA 4JM1A 2PN2A 4ISBA 1YJ7A 4G36A 2P02A 4BC9A 2CY1A 3GPCA 2F4VC 5AE2A 5LMNC 2ASBA 5LMUC 4D56A 2Y27A 3NYQA 4GS5A 4DV5C 3LAXA 2AYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  3GKU A;  1PA4 A;  1L2F A;  3T1H C;  4X66 C;  2E8C A;  2OPL A;  4X64 C;  1WH9 A;  4DV7 C;  4NXN C;  4JI8 C;  4MH4 A;  2UUB C;  4LF8 C;  4GKJ C;  2JMP A;  4DR6 C;  4NXM C;  5IWA C;  1USP A;  1XNQ C;  1HH2 P;  3LUS A;  4DR3 C;  4K0K C;  4X62 C;  4B3S C;  2QL8 A;  5BR8 C;  3JAM D;  2E8E A;  4LF9 C;  2HHH C;  2PT7 G;  3J80 D;  2UUC C;  3AF6 A;  1J5E C;  1QWI A;  1UKK A;  2CXC A;  2E5L C;  2UXD C;  1WF3 A;  1EGA A;  1ZB8 A;  1N36 C;  4LF5 C;  2OPL B;  2KZF A;  4DV0 C;  4JI1 C;  4LFC C;  4JI5 C;  4KHP C;  1I94 C;  4XX2 A;  2UU9 C;  4JI2 C;  4OX9 C;  3R9W A;  1USP B;  1HR0 C;  4X65 C;  4LF6 C;  4NOZ A;  4B3T C;  1K0R A;  2UUA C;  3IEU A;  4DR5 C;  1KKG A;  1N33 C;  4LF4 C;  2E7G A;  4JYA C;  3T1Y C;  5FLX D;  1ZB9 A;  4DV3 C;  4DR7 C;  4DUY C;  4DV4 C;  2ZM6 C;  1HNZ C;  4DR4 C;  4JI3 C;  4DR1 C;  2DYJ A;  4GKK C;  4JI6 C;  4LF7 C;  1XNR C;  3IEV A;  1NYE A;  4DV2 C;  1XMO C;  4MTN A;  4JV5 C;  2VQF C;  4JI7 C;  2VQE C;  3R9X A;  2EGT A;  5A2Q D;  4JI4 C;  4YHH C;  3J7A D;  4LFB C;  4DV1 C;  4DCT A;  1VLA A;  2D7V A;  4BSZ A;  2ATW A;  2BJO A;  3CJE A;  3OTO C;  4B3R C;  4DCS A;  4YY3 C;  1N32 C;  2UXC C;  1N2F A;  3J81 D;  4DR2 C;  5IT9 D;  4JI0 C;  1HNX C;  1N34 C;  4LFA C;  4DCU A;  1XMQ C;  2PN2 A;  1MKY A;  4DCV A;  4DUZ C;  2YCB A;  1IBM C;  3AF5 A;  2ONF A;  4B3M C;  1HNW C;  4AQY C;  1IBL C;  3EER A;  2CY1 A;  1JOS A;  4DV6 C;  2F4V C;  5LMN C;  1FJG C;  2E8F A;  2ASB A;  1LQL A;  1IBK C;  5LMU C;  3I07 A;  2HJG A;  1ML8 A;  2UXB C;  4DV5 C; 
#chains in the Genus database with same CATH topology
 1XRA A;  1PA4 A;  2D1S A;  5KYT A;  2E8C A;  1XDX A;  4DG8 A;  4DV7 C;  4JI8 C;  2UUB C;  4G37 A;  1IB8 A;  4I9F A;  2MMA B;  3CW8 X;  2YWB A;  4X62 C;  2QL8 A;  5BR8 C;  3JAM D;  4BCA A;  2E8E A;  3J80 D;  2QVZ X;  3E7W A;  1J5E C;  3CQ3 A;  2MCQ A;  2QW0 X;  5BSR A;  3DHV A;  2WP0 C;  1FUG A;  1WF3 A;  3UZ0 A;  2Y4O A;  3N2Q A;  3TDE A;  2OPL B;  4DV0 C;  3SO4 A;  1I94 C;  2UU9 C;  4G1I A;  4RLF A;  3LGX A;  3EQ6 A;  3CQ1 A;  1USP B;  1HR0 C;  5KEI A;  4X65 C;  1BA3 A;  4NOZ A;  1K0R A;  4PUI A;  2UUA C;  3L8C A;  1N33 C;  2V7B A;  5AE3 A;  4GXQ A;  3A9U A;  3RG2 A;  1HNZ C;  4DV4 C;  2ZM6 C;  3DAY A;  2DYJ A;  2D1T A;  2WD9 A;  4D57 A;  3FCC A;  4JI6 C;  1M6X C;  5A19 A;  3J7A D;  4LFB C;  1PG3 A;  2ATW A;  2BJO A;  3ETO A;  2P2J A;  2UXC C;  3J81 D;  3PES A;  4DCV A;  4EAT A;  3AF5 A;  1GPM A;  4WS9 A;  4AQY C;  1IBL C;  2KZ0 A;  1JOS A;  5BSM A;  4FTF A;  4DV6 C;  3KXW A;  1LQL A;  1IBK C;  4TPS B;  3I07 A;  2HJG A;  4PRO C;  3FM7 A;  4KTT A;  2P2B A;  1MDF A;  5BSU A;  3GR1 A;  2XR1 A;  3A9V A;  4IR7 A;  3T1H C;  4X66 C;  5BSV A;  2OPL A;  4X64 C;  4MH4 A;  4GKJ C;  1UWD A;  4NXM C;  1USP A;  1T5D X;  1XNQ C;  1HH2 P;  3I08 A;  4PUG A;  2UUC C;  1WCJ A;  3VNS A;  1O92 A;  1UKK A;  3TR3 A;  3UOW A;  4L2Z A;  4K0B A;  2CU6 A;  1N36 C;  2KZF A;  2DHM A;  4JI1 C;  4LFC C;  4JI5 C;  1LCI A;  1PU1 A;  4XX2 A;  3B7W A;  1MXB A;  3R9W A;  4PHT A;  1O9T A;  4LF6 C;  4DR5 C;  3R44 A;  5GTD A;  4LF4 C;  2QVX X;  3UEB A;  2YX1 A;  5FLX D;  1ZB9 A;  5T8S A;  3UX2 A;  3H2T A;  4L4Q A;  4DR7 C;  3K6R A;  1O93 A;  2PG1 E;  2M5H A;  4RLQ A;  3L95 X;  3VNR A;  4R0M A;  5K8F A;  4JV5 C;  2VQF C;  2QVY X;  4JI7 C;  5ADZ A;  4U5Y D;  2VQE C;  4L7I A;  4D4I A;  1FLO A;  5JRH A;  3S82 A;  3E7X A;  3OTO C;  1MD9 A;  3CJE A;  2MM9 A;  3LNV A;  5BST A;  5A1I A;  1N32 C;  4ZJZ A;  5E7Q A;  5H9U A;  4JI0 C;  4ZLP A;  4BBY A;  1XMQ C;  3NI2 A;  1MKY A;  4DUZ C;  1XRC A;  4OYC A;  3PBK A;  4RVO A;  1FJG C;  2E8F A;  1ML8 A;  3DLP X;  2UXB C;  3CQ2 A;  3O2E A;  3GKU A;  1RG9 A;  2Z51 A;  4BC7 A;  2ZTB A;  1WH9 A;  2BH1 X;  4NXN C;  5K85 A;  3A25 A;  4DR6 C;  2P2F A;  5IWA C;  3VNQ A;  2PRO A;  4PZP A;  3LUS A;  4DR3 C;  4K0K C;  1P4E A;  4B3S C;  3AF6 A;  2OO4 A;  1QWI A;  2E5L C;  2ZZN A;  5BSW A;  1EGA A;  5DV9 A;  4KHP C;  2D28 C;  1T5H X;  3GR0 A;  4WV3 A;  4LE5 A;  4B3T C;  2D1R A;  3IEU A;  5CZX A;  4HPV A;  5T8T A;  2M5O A;  4DV3 C;  3TQI A;  4DUY C;  2KDN A;  4JI3 C;  4DR4 C;  3IML A;  4LF7 C;  1XNR C;  3AY0 A;  4DV2 C;  1M6X A;  3G7S A;  2DPL A;  4JI4 C;  3UX3 A;  4D4G A;  1O90 A;  1NY8 A;  4NDN A;  1VLA A;  1YGT A;  4RMN A;  1XRB A;  2D7V A;  2YWC A;  1N2F A;  1MDB A;  1VEH A;  5CZV A;  4DR2 C;  5IT9 D;  5AE1 A;  1QM4 A;  2P20 A;  2JNV A;  3CW9 A;  2VSQ A;  1XHJ A;  3A26 A;  4FUQ A;  2YCB A;  1IBM C;  2ONF A;  4B3M C;  1HNW C;  3EER A;  2P2Q A;  1V60 A;  5BUR A;  1AMU A;  4OXI A;  3NYR A;  3NPD A;  4DG9 A;  5IFI A;  3PRO C;  1L2F A;  3TUF A;  1RY2 A;  2ZZM A;  4R1M A;  4LF8 C;  2OBV A;  4IZ6 A;  2JMP A;  2D1Q A;  3RV2 A;  4LF9 C;  4PUH A;  2HHH C;  2PT7 G;  1TH5 A;  3N54 B;  1P4E C;  1V25 A;  2CXC A;  2UXD C;  5BUQ A;  1ZB8 A;  4LF5 C;  1PG4 A;  4JI2 C;  2NCL A;  4OX9 C;  1MXC A;  2E0G A;  2VZE A;  4FUT A;  1KKG A;  4RM2 A;  2E7G A;  1MXA A;  4R1L A;  3ETC A;  4JYA C;  2P2M A;  3T1Y C;  1ULT A;  5BUS A;  3FCE A;  4DR1 C;  2Y4N A;  1P7L A;  4GKK C;  4GXR A;  2D27 A;  3A4I A;  3IEV A;  1NYE A;  5LCI A;  1XMO C;  4MTN A;  4RVN A;  3IPL A;  2EGT A;  3R9X A;  5A2Q D;  4ODJ A;  4YHH C;  3C5E A;  1V26 A;  4DV1 C;  4DCT A;  5KYV A;  4BSZ A;  5A1G A;  4B3R C;  4DCS A;  4YY3 C;  4KTV A;  1XS3 A;  4I9G A;  4RM3 A;  1HNX C;  1N34 C;  4LFA C;  4DCU A;  4JM1 A;  2PN2 A;  3LNO A;  4ISB A;  1YJ7 A;  4G36 A;  2P02 A;  4BC9 A;  2CY1 A;  3GPC A;  2F4V C;  5AE2 A;  5LMN C;  2ASB A;  5LMU C;  4D56 A;  2Y27 A;  3NYQ A;  4GS5 A;  4DV5 C;  3LAX A;  2AYA A; 
#chains in the Genus database with same CATH homology
 1XRA A;  1PA4 A;  2D1S A;  5KYT A;  2E8C A;  4DG8 A;  4DV7 C;  4JI8 C;  2UUB C;  4G37 A;  4I9F A;  3CW8 X;  2YWB A;  4X62 C;  2QL8 A;  5BR8 C;  3JAM D;  4BCA A;  2E8E A;  3J80 D;  2QVZ X;  3E7W A;  1J5E C;  2QW0 X;  5BSR A;  3DHV A;  2WP0 C;  1FUG A;  1WF3 A;  3UZ0 A;  2Y4O A;  3N2Q A;  3TDE A;  2OPL B;  4DV0 C;  3SO4 A;  1I94 C;  2UU9 C;  4G1I A;  4RLF A;  3LGX A;  3EQ6 A;  1USP B;  1HR0 C;  5KEI A;  4X65 C;  1BA3 A;  4NOZ A;  1K0R A;  2UUA C;  3L8C A;  1N33 C;  2V7B A;  5AE3 A;  4GXQ A;  3A9U A;  3RG2 A;  1HNZ C;  4DV4 C;  2ZM6 C;  3DAY A;  2DYJ A;  2D1T A;  2WD9 A;  4D57 A;  3FCC A;  4JI6 C;  5A19 A;  3J7A D;  4LFB C;  1PG3 A;  2ATW A;  2BJO A;  3ETO A;  2P2J A;  2UXC C;  3J81 D;  3PES A;  4DCV A;  4EAT A;  3AF5 A;  1GPM A;  4WS9 A;  4AQY C;  1IBL C;  1JOS A;  5BSM A;  4FTF A;  4DV6 C;  3KXW A;  1LQL A;  1IBK C;  4TPS B;  3I07 A;  2HJG A;  4PRO C;  4KTT A;  2P2B A;  1MDF A;  5BSU A;  3GR1 A;  2XR1 A;  3A9V A;  4IR7 A;  3T1H C;  4X66 C;  5BSV A;  2OPL A;  4X64 C;  4MH4 A;  4GKJ C;  4NXM C;  1USP A;  1T5D X;  1XNQ C;  1HH2 P;  3I08 A;  2UUC C;  3VNS A;  1O92 A;  1UKK A;  3UOW A;  4L2Z A;  4K0B A;  1N36 C;  2KZF A;  4JI1 C;  4LFC C;  4JI5 C;  1LCI A;  4XX2 A;  3B7W A;  1MXB A;  3R9W A;  4PHT A;  1O9T A;  4LF6 C;  4DR5 C;  3R44 A;  5GTD A;  4LF4 C;  2QVX X;  5FLX D;  1ZB9 A;  5T8S A;  3H2T A;  4L4Q A;  4DR7 C;  1O93 A;  4RLQ A;  3L95 X;  3VNR A;  4R0M A;  5K8F A;  4JV5 C;  2VQF C;  2QVY X;  4JI7 C;  5ADZ A;  4U5Y D;  2VQE C;  4L7I A;  4D4I A;  5JRH A;  3S82 A;  3E7X A;  3OTO C;  1MD9 A;  3CJE A;  3LNV A;  5BST A;  5A1I A;  1N32 C;  4ZJZ A;  5E7Q A;  5H9U A;  4JI0 C;  4ZLP A;  4BBY A;  1XMQ C;  3NI2 A;  1MKY A;  4DUZ C;  1XRC A;  4OYC A;  3PBK A;  4RVO A;  1FJG C;  2E8F A;  1ML8 A;  3DLP X;  2UXB C;  3GKU A;  1RG9 A;  4BC7 A;  1WH9 A;  2BH1 X;  4NXN C;  5K85 A;  4DR6 C;  2P2F A;  5IWA C;  3VNQ A;  2PRO A;  4PZP A;  3LUS A;  4DR3 C;  4K0K C;  4B3S C;  3AF6 A;  2OO4 A;  1QWI A;  2E5L C;  5BSW A;  1EGA A;  5DV9 A;  4KHP C;  2D28 C;  1T5H X;  3GR0 A;  4WV3 A;  4LE5 A;  4B3T C;  2D1R A;  3IEU A;  5CZX A;  4HPV A;  5T8T A;  4DV3 C;  3TQI A;  4DUY C;  4DR4 C;  4JI3 C;  3IML A;  4LF7 C;  1XNR C;  4DV2 C;  3G7S A;  2DPL A;  4JI4 C;  4D4G A;  1O90 A;  4NDN A;  1VLA A;  4RMN A;  1XRB A;  2D7V A;  2YWC A;  1N2F A;  1MDB A;  5CZV A;  5IT9 D;  4DR2 C;  5AE1 A;  1QM4 A;  2P20 A;  3CW9 A;  2VSQ A;  4FUQ A;  2YCB A;  1IBM C;  4B3M C;  2ONF A;  1HNW C;  3EER A;  2P2Q A;  5BUR A;  1AMU A;  4OXI A;  3NYR A;  3NPD A;  4DG9 A;  5IFI A;  3PRO C;  1L2F A;  3TUF A;  1RY2 A;  4R1M A;  4LF8 C;  2OBV A;  4IZ6 A;  2JMP A;  2D1Q A;  3RV2 A;  4LF9 C;  2HHH C;  2PT7 G;  3N54 B;  1V25 A;  2CXC A;  2UXD C;  5BUQ A;  1ZB8 A;  4LF5 C;  1PG4 A;  4JI2 C;  4OX9 C;  1MXC A;  2E0G A;  2VZE A;  4FUT A;  1KKG A;  4RM2 A;  2E7G A;  1MXA A;  4R1L A;  3ETC A;  4JYA C;  2P2M A;  3T1Y C;  1ULT A;  5BUS A;  3FCE A;  4DR1 C;  2Y4N A;  1P7L A;  4GKK C;  4GXR A;  2D27 A;  3A4I A;  3IEV A;  1NYE A;  1XMO C;  4MTN A;  4RVN A;  3IPL A;  2EGT A;  3R9X A;  5A2Q D;  4ODJ A;  4YHH C;  3C5E A;  1V26 A;  4DV1 C;  4DCT A;  5KYV A;  4BSZ A;  5A1G A;  4B3R C;  4DCS A;  4YY3 C;  4KTV A;  4I9G A;  4RM3 A;  1HNX C;  1N34 C;  4LFA C;  4DCU A;  4JM1 A;  2PN2 A;  4ISB A;  1YJ7 A;  4G36 A;  2P02 A;  4BC9 A;  2CY1 A;  3GPC A;  2F4V C;  5AE2 A;  5LMN C;  2ASB A;  5LMU C;  4D56 A;  2Y27 A;  3NYQ A;  4GS5 A;  4DV5 C;  3LAX A;  2AYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...