4K0KC

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4k0kC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4k0kC02
4LFCC 2KZFA 3AF5A 1PA4A 1FJGC 4BSZA 1XNQC 1IBKC 2ONFA 4X65C 2ASBA 2E8EA 1NYEA 4NOZA 3R9WA 2E8FA 4LFBC 1UKKA 4LF7C 3R9XA 1IBMC 3JAMD 4DV7C 3EERA 3CJEA 4JI8C 5FLXD 2E7GA 2F4VC 4XX2A 1L2FA 3IEVA 2D7VA 2OPLA 4DV1C 4DR6C 4GKJC 1LQLA 2YCBA 1HNZC 1XNRC 4LF8C 1USPB 1N2FA 5IT9D 1K0RA 2OPLB 5LMNC 1QWIA 4LFAC 4X64C 1N33C 2VQEC 2PT7G 3IEUA 1JOSA 4JI3C 4DR1C 4B3SC 4K0KC 1J5EC 4JI0C 4JI7C 4DV0C 4LF9C 4DV3C 5IWAC 1N36C 1EGAA 1VLAA 4JI2C 4DCTA 4YY3C 2E5LC 1WH9A 1HH2P 2BJOA 4X62C 5LMUC 4JI5C 4DR7C 4B3RC 2DYJA 2CXCA 4DR2C 4KHPC 4JV5C 4JI4C 4JI6C 4DCVA 1XMQC 1IBLC 2UU9C 3AF6A 4DR3C 1N34C 2UUBC 3LUSA 1XMOC 3J81D 4DR4C 3I07A 4DR5C 4DUYC 1ZB8A 4JI1C 4LF4C 4DV4C 1WF3A 5BR8C 2PN2A 4YHHC 2HHHC 2ATWA 4DV6C 4X66C 4LF5C 1KKGA 2UXCC 4LF6C 4B3TC 4AQYC 1I94C 4GKKC 4DCUA 3J80D 2JMPA 1MKYA 3J7AD 5A2QD 2UXDC 4DV2C 2XR1A 2UUCC 4NXMC 4DV5C 4MTNA 2VQFC 2E8CA 4OX9C 3GKUA 3T1HC 1HR0C 2EGTA 4JYAC 4DUZC 2UXBC 1ML8A 2UUAC 1USPA 2HJGA 1HNWC 1HNXC 3T1YC 2QL8A 4DCSA 1ZB9A 4MH4A 3OTOC 4B3MC 4NXNC 1N32C 2CY1A 2ZM6C
chains in the Genus database with same CATH superfamily
5AE3A 3AF5A 3UX2A 2PROA 4BSZA 1XNQC 4U5YD 2ONFA 3R9WA 4RM2A 4LF7C 1O93A 3JAMD 3EERA 2BH1X 3PROC 4G1IA 4XX2A 4FUQA 4DR6C 3NYQA 3TUFA 4D4GA 4L7IA 3E7XA 2OPLB 3UOWA 1QWIA 1IB8A 3RG2A 5AE2A 4BBYA 4BCAA 1JOSA 5A19A 4FUTA 3I08A 4K0KC 2NCLA 1VEHA 4DV0C 3DLPX 2E5LC 2D1SA 4HPVA 5BSRA 2Y27A 5AE1A 2CXCA 5BUSA 4PROC 2ZZMA 4FTFA 4RVOA 2P2MA 3UZ0A 1N34C 2UUBC 3LUSA 3O2EA 4L2ZA 3I07A 4JI1C 3GPCA 3SO4A 4DV4C 1WF3A 5H9UA 4TPSB 4X66C 4GS5A 2UXCC 4B3TC 4AQYC 4GKKC 4DCUA 5A2QD 2UXDC 5K8FA 3VNRA 2XR1A 2VQFC 3LGXA 4OX9C 2Y4NA 2P2BA 1HR0C 5LCIA 4G36A 4BC9A 4RLFA 3A4IA 1USPA 2WD9A 3T1YC 5IFIA 3LAXA 4PUHA 2AYAA 3TQIA 4DCSA 1XS3A 1V60A 2P2QA 2ZM6C 4LFCC 2KZFA 3CQ3A 1UWDA 1O9TA 5GTDA 1FLOA 4IR7A 3UX3A 4NDNA 3E7WA 4ZJZA 5T8TA 4L4QA 4ODJA 3CJEA 1P4EA 2F4VC 2OPLA 2Z51A 4DV1C 4RMNA 2YCBA 1HNZC 5BSWA 4LE5A 4LF8C 1USPB 5BSMA 1MXCA 3G7SA 1N2FA 5LMNC 1AMUA 2D1RA 1XHJA 2VQEC 3IEUA 4PUGA 1NY8A 1ULTA 4DR1C 1J5EC 4JI0C 4LF9C 4DG9A 4JI5C 1HH2P 2BJOA 5LMUC 4DR7C 4B3RC 1MXBA 2DYJA 4DR2C 4KHPC 1XRAA 3A25A 3H2TA 1P7LA 4RVNA 2QW0X 1IBLC 2UU9C 4DR3C 4IZ6A 4D57A 3KXWA 1XMOC 4WS9A 3J81D 4DR4C 4DG8A 1ZB8A 2MCQA 5A1GA 2YWBA 2QVXX 4EATA 3S82A 3NYRA 1MDBA 3FM7A 4D56A 4YHHC 3AY0A 3UEBA 4LF5C 1I94C 3C5EA 1M6XA 3J80D 3J7AD 3CW8X 4OYCA 4DV5C 3CQ2A 2E8CA 3A9VA 2D28C 5BSVA 1ML8A 1LCIA 2UUAC 3ETCA 1PG3A 4ISBA 4G37A 4D4IA 1PU1A 3OTOC 1N32C 2YX1A 2E0GA 1YGTA 2DPLA 3GR1A 1PA4A 2MM9A 1IBKC 3K6RA 1NYEA 2E8FA 4LFBC 1UKKA 3L8CA 1YJ7A 3R9XA 2QVYX 3NI2A 4DV7C 4R0MA 4JI8C 5FLXD 1L2FA 2D7VA 4GKJC 1T5HX 3VNQA 1O92A 3PESA 4X64C 2VSQA 4I9FA 2PT7G 4B3SC 2VZEA 4JI7C 5IWAC 4BC7A 1N36C 1EGAA 3L95X 5K85A 1VLAA 4JI2C 4YY3C 2KZ0A 4GXQA 4R1MA 2P02A 4JM1A 2ZTBA 4JI6C 4DCVA 2QVZX 3RV2A 1WCJA 1XRBA 5BSUA 2Y4OA 2PG1E 4DUYC 5KYVA 2P20A 2D1QA 4LF4C 2DHMA 4RLQA 2PN2A 4PZPA 4DV6C 1KKGA 4KTVA 4KTTA 4I9GA 2JMPA 1MKYA 2V7BA 3N2QA 2UUCC 1RY2A 3DAYA 4MTNA 3CQ1A 1QM4A 3T1HC 2EGTA 2UXBC 4DUZC 3VNSA 3A9UA 4R1LA 2D1TA 2M5OA 1P4EC 3PBKA 1ZB9A 4B3MC 2CY1A 5CZVA 1O90A 5JRHA 1FJGC 5BUQA 3EQ6A 1TH5A 3TDEA 4OXIA 4X65C 2ASBA 2E8EA 3ETOA 4NOZA 3FCEA 5ADZA 1IBMC 2E7GA 3IEVA 1XDXA 3A26A 1LQLA 1XNRC 2M5HA 5A1IA 5T8SA 5IT9D 1K0RA 3N54B 3TR3A 4LFAC 1BA3A 5DV9A 1N33C 4JI3C 1PG4A 4GXRA 2YWCA 3R44A 4DV3C 1MD9A 4DCTA 3FCCA 1WH9A 4X62C 3NPDA 2WP0C 1MDFA 3IPLA 2P2FA 2JNVA 4JV5C 4JI4C 5KEIA 1M6XC 1XMQC 2MMAB 4ZLPA 3AF6A 1RG9A 3CW9A 5BSTA 4PUIA 4DR5C 5BURA 3LNVA 5BR8C 5CZXA 2HHHC 1XRCA 2OO4A 4RM3A 2KDNA 4LF6C 5E7QA 1GPMA 4PHTA 1MXAA 4K0BA 2P2JA 4DV2C 5KYTA 4NXMC 3GKUA 2ZZNA 3DHVA 4JYAC 3LNOA 2HJGA 3B7WA 1HNWC 3IMLA 1HNXC 2OBVA 2CU6A 1FUGA 2QL8A 4MH4A 4NXNC 2D27A 1V26A 1V25A 1T5DX 3GR0A 4WV3A 2ATWA
chains in the Genus database with same CATH topology
5AE3A 3AF5A 2PROA 4BSZA 1XNQC 4U5YD 2ONFA 3R9WA 4RM2A 4LF7C 1O93A 3JAMD 3EERA 2BH1X 3PROC 4G1IA 4XX2A 4FUQA 4DR6C 3NYQA 3TUFA 4D4GA 4L7IA 3E7XA 2OPLB 3UOWA 1QWIA 3RG2A 5AE2A 4BBYA 4BCAA 1JOSA 5A19A 4FUTA 3I08A 4K0KC 4DV0C 3DLPX 2E5LC 2D1SA 4HPVA 5BSRA 2Y27A 5AE1A 2CXCA 5BUSA 4PROC 4FTFA 4RVOA 2P2MA 3UZ0A 1N34C 2UUBC 3LUSA 4L2ZA 3I07A 4JI1C 3GPCA 3SO4A 4DV4C 1WF3A 5H9UA 4TPSB 4X66C 4GS5A 2UXCC 4B3TC 4AQYC 4GKKC 4DCUA 5A2QD 2UXDC 5K8FA 3VNRA 2XR1A 2VQFC 3LGXA 4OX9C 2Y4NA 2P2BA 1HR0C 4G36A 4BC9A 4RLFA 3A4IA 1USPA 2WD9A 3T1YC 5IFIA 3LAXA 2AYAA 3TQIA 4DCSA 2P2QA 2ZM6C 4LFCC 2KZFA 1O9TA 5GTDA 4IR7A 4NDNA 3E7WA 4ZJZA 5T8TA 4L4QA 4ODJA 3CJEA 2F4VC 2OPLA 4DV1C 4RMNA 2YCBA 1HNZC 5BSWA 4LE5A 4LF8C 1USPB 5BSMA 1MXCA 3G7SA 1N2FA 5LMNC 1AMUA 2D1RA 2VQEC 3IEUA 4DR1C 1ULTA 1J5EC 4JI0C 4LF9C 4DG9A 4JI5C 1HH2P 2BJOA 5LMUC 4DR7C 4B3RC 1MXBA 2DYJA 4DR2C 4KHPC 1XRAA 3H2TA 1P7LA 4RVNA 2QW0X 1IBLC 2UU9C 4DR3C 4IZ6A 4D57A 3KXWA 1XMOC 4WS9A 3J81D 4DR4C 4DG8A 1ZB8A 5A1GA 2YWBA 2QVXX 4EATA 3S82A 3NYRA 1MDBA 4D56A 4YHHC 4LF5C 1I94C 3C5EA 3J80D 3J7AD 3CW8X 4OYCA 4DV5C 2E8CA 3A9VA 2D28C 5BSVA 1ML8A 1LCIA 2UUAC 3ETCA 1PG3A 4ISBA 4G37A 4D4IA 3OTOC 1N32C 2E0GA 2DPLA 3GR1A 1PA4A 1IBKC 1NYEA 2E8FA 4LFBC 1UKKA 3L8CA 1YJ7A 3R9XA 2QVYX 3NI2A 4DV7C 4R0MA 4JI8C 5FLXD 1L2FA 2D7VA 4GKJC 1T5HX 3VNQA 1O92A 3PESA 4X64C 2VSQA 4I9FA 2PT7G 4B3SC 2VZEA 4JI7C 5IWAC 4BC7A 1N36C 1EGAA 3L95X 5K85A 1VLAA 4JI2C 4YY3C 4GXQA 4R1MA 2P02A 4JM1A 4JI6C 4DCVA 2QVZX 3RV2A 1XRBA 5BSUA 2Y4OA 4DUYC 5KYVA 2P20A 2D1QA 4LF4C 4RLQA 2PN2A 4PZPA 4DV6C 1KKGA 4KTVA 4KTTA 4I9GA 2JMPA 1MKYA 2V7BA 3N2QA 2UUCC 1RY2A 3DAYA 4MTNA 1QM4A 3T1HC 2EGTA 2UXBC 4DUZC 3VNSA 3A9UA 4R1LA 2D1TA 3PBKA 1ZB9A 4B3MC 2CY1A 5CZVA 1O90A 5JRHA 1FJGC 5BUQA 3EQ6A 3TDEA 4OXIA 4X65C 2ASBA 2E8EA 3ETOA 4NOZA 3FCEA 5ADZA 1IBMC 2E7GA 3IEVA 1LQLA 1XNRC 5A1IA 5T8SA 5IT9D 1K0RA 3N54B 4LFAC 1BA3A 5DV9A 1N33C 4JI3C 1PG4A 4GXRA 2YWCA 3R44A 4DV3C 1MD9A 4DCTA 3FCCA 1WH9A 4X62C 3NPDA 2WP0C 1MDFA 3IPLA 2P2FA 4JV5C 4JI4C 5KEIA 1XMQC 4ZLPA 3AF6A 1RG9A 3CW9A 5BSTA 4DR5C 5BURA 3LNVA 5BR8C 5CZXA 2HHHC 1XRCA 2OO4A 4RM3A 4LF6C 5E7QA 1GPMA 4PHTA 1MXAA 4K0BA 2P2JA 4DV2C 5KYTA 4NXMC 3GKUA 3DHVA 4JYAC 2HJGA 3B7WA 1HNWC 3IMLA 1HNXC 2OBVA 1FUGA 2QL8A 4MH4A 4NXNC 2D27A 1V26A 1V25A 1T5DX 3GR0A 4WV3A 2ATWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC C;  2KZF A;  3AF5 A;  1PA4 A;  1FJG C;  4BSZ A;  1XNQ C;  1IBK C;  2ONF A;  4X65 C;  2ASB A;  2E8E A;  1NYE A;  4NOZ A;  3R9W A;  2E8F A;  4LFB C;  1UKK A;  4LF7 C;  3R9X A;  1IBM C;  3JAM D;  4DV7 C;  3EER A;  3CJE A;  4JI8 C;  5FLX D;  2E7G A;  2F4V C;  4XX2 A;  1L2F A;  3IEV A;  2D7V A;  2OPL A;  4DV1 C;  4DR6 C;  4GKJ C;  1LQL A;  2YCB A;  1HNZ C;  1XNR C;  4LF8 C;  1USP B;  1N2F A;  5IT9 D;  1K0R A;  2OPL B;  5LMN C;  1QWI A;  4LFA C;  4X64 C;  1N33 C;  2VQE C;  2PT7 G;  3IEU A;  1JOS A;  4JI3 C;  4DR1 C;  4B3S C;  4K0K C;  1J5E C;  4JI0 C;  4JI7 C;  4DV0 C;  4LF9 C;  4DV3 C;  5IWA C;  1N36 C;  1EGA A;  1VLA A;  4JI2 C;  4DCT A;  4YY3 C;  2E5L C;  1WH9 A;  1HH2 P;  2BJO A;  4X62 C;  5LMU C;  4JI5 C;  4DR7 C;  4B3R C;  2DYJ A;  2CXC A;  4DR2 C;  4KHP C;  4JV5 C;  4JI4 C;  4JI6 C;  4DCV A;  1XMQ C;  1IBL C;  2UU9 C;  3AF6 A;  4DR3 C;  1N34 C;  2UUB C;  3LUS A;  1XMO C;  3J81 D;  4DR4 C;  3I07 A;  4DR5 C;  4DUY C;  1ZB8 A;  4JI1 C;  4LF4 C;  4DV4 C;  1WF3 A;  5BR8 C;  2PN2 A;  4YHH C;  2HHH C;  2ATW A;  4DV6 C;  4X66 C;  4LF5 C;  1KKG A;  2UXC C;  4LF6 C;  4B3T C;  4AQY C;  1I94 C;  4GKK C;  4DCU A;  3J80 D;  2JMP A;  1MKY A;  3J7A D;  5A2Q D;  2UXD C;  4DV2 C;  2XR1 A;  2UUC C;  4NXM C;  4DV5 C;  4MTN A;  2VQF C;  2E8C A;  4OX9 C;  3GKU A;  3T1H C;  1HR0 C;  2EGT A;  4JYA C;  4DUZ C;  2UXB C;  1ML8 A;  2UUA C;  1USP A;  2HJG A;  1HNW C;  1HNX C;  3T1Y C;  2QL8 A;  4DCS A;  1ZB9 A;  4MH4 A;  3OTO C;  4B3M C;  4NXN C;  1N32 C;  2CY1 A;  2ZM6 C; 
#chains in the Genus database with same CATH topology
 5AE3 A;  3AF5 A;  3UX2 A;  2PRO A;  4BSZ A;  1XNQ C;  4U5Y D;  2ONF A;  3R9W A;  4RM2 A;  4LF7 C;  1O93 A;  3JAM D;  3EER A;  2BH1 X;  3PRO C;  4G1I A;  4XX2 A;  4FUQ A;  4DR6 C;  3NYQ A;  3TUF A;  4D4G A;  4L7I A;  3E7X A;  2OPL B;  3UOW A;  1QWI A;  1IB8 A;  3RG2 A;  5AE2 A;  4BBY A;  4BCA A;  1JOS A;  5A19 A;  4FUT A;  3I08 A;  4K0K C;  2NCL A;  1VEH A;  4DV0 C;  3DLP X;  2E5L C;  2D1S A;  4HPV A;  5BSR A;  2Y27 A;  5AE1 A;  2CXC A;  5BUS A;  4PRO C;  2ZZM A;  4FTF A;  4RVO A;  2P2M A;  3UZ0 A;  1N34 C;  2UUB C;  3LUS A;  3O2E A;  4L2Z A;  3I07 A;  4JI1 C;  3GPC A;  3SO4 A;  4DV4 C;  1WF3 A;  5H9U A;  4TPS B;  4X66 C;  4GS5 A;  2UXC C;  4B3T C;  4AQY C;  4GKK C;  4DCU A;  5A2Q D;  2UXD C;  5K8F A;  3VNR A;  2XR1 A;  2VQF C;  3LGX A;  4OX9 C;  2Y4N A;  2P2B A;  1HR0 C;  5LCI A;  4G36 A;  4BC9 A;  4RLF A;  3A4I A;  1USP A;  2WD9 A;  3T1Y C;  5IFI A;  3LAX A;  4PUH A;  2AYA A;  3TQI A;  4DCS A;  1XS3 A;  1V60 A;  2P2Q A;  2ZM6 C;  4LFC C;  2KZF A;  3CQ3 A;  1UWD A;  1O9T A;  5GTD A;  1FLO A;  4IR7 A;  3UX3 A;  4NDN A;  3E7W A;  4ZJZ A;  5T8T A;  4L4Q A;  4ODJ A;  3CJE A;  1P4E A;  2F4V C;  2OPL A;  2Z51 A;  4DV1 C;  4RMN A;  2YCB A;  1HNZ C;  5BSW A;  4LE5 A;  4LF8 C;  1USP B;  5BSM A;  1MXC A;  3G7S A;  1N2F A;  5LMN C;  1AMU A;  2D1R A;  1XHJ A;  2VQE C;  3IEU A;  4PUG A;  1NY8 A;  1ULT A;  4DR1 C;  1J5E C;  4JI0 C;  4LF9 C;  4DG9 A;  4JI5 C;  1HH2 P;  2BJO A;  5LMU C;  4DR7 C;  4B3R C;  1MXB A;  2DYJ A;  4DR2 C;  4KHP C;  1XRA A;  3A25 A;  3H2T A;  1P7L A;  4RVN A;  2QW0 X;  1IBL C;  2UU9 C;  4DR3 C;  4IZ6 A;  4D57 A;  3KXW A;  1XMO C;  4WS9 A;  3J81 D;  4DR4 C;  4DG8 A;  1ZB8 A;  2MCQ A;  5A1G A;  2YWB A;  2QVX X;  4EAT A;  3S82 A;  3NYR A;  1MDB A;  3FM7 A;  4D56 A;  4YHH C;  3AY0 A;  3UEB A;  4LF5 C;  1I94 C;  3C5E A;  1M6X A;  3J80 D;  3J7A D;  3CW8 X;  4OYC A;  4DV5 C;  3CQ2 A;  2E8C A;  3A9V A;  2D28 C;  5BSV A;  1ML8 A;  1LCI A;  2UUA C;  3ETC A;  1PG3 A;  4ISB A;  4G37 A;  4D4I A;  1PU1 A;  3OTO C;  1N32 C;  2YX1 A;  2E0G A;  1YGT A;  2DPL A;  3GR1 A;  1PA4 A;  2MM9 A;  1IBK C;  3K6R A;  1NYE A;  2E8F A;  4LFB C;  1UKK A;  3L8C A;  1YJ7 A;  3R9X A;  2QVY X;  3NI2 A;  4DV7 C;  4R0M A;  4JI8 C;  5FLX D;  1L2F A;  2D7V A;  4GKJ C;  1T5H X;  3VNQ A;  1O92 A;  3PES A;  4X64 C;  2VSQ A;  4I9F A;  2PT7 G;  4B3S C;  2VZE A;  4JI7 C;  5IWA C;  4BC7 A;  1N36 C;  1EGA A;  3L95 X;  5K85 A;  1VLA A;  4JI2 C;  4YY3 C;  2KZ0 A;  4GXQ A;  4R1M A;  2P02 A;  4JM1 A;  2ZTB A;  4JI6 C;  4DCV A;  2QVZ X;  3RV2 A;  1WCJ A;  1XRB A;  5BSU A;  2Y4O A;  2PG1 E;  4DUY C;  5KYV A;  2P20 A;  2D1Q A;  4LF4 C;  2DHM A;  4RLQ A;  2PN2 A;  4PZP A;  4DV6 C;  1KKG A;  4KTV A;  4KTT A;  4I9G A;  2JMP A;  1MKY A;  2V7B A;  3N2Q A;  2UUC C;  1RY2 A;  3DAY A;  4MTN A;  3CQ1 A;  1QM4 A;  3T1H C;  2EGT A;  2UXB C;  4DUZ C;  3VNS A;  3A9U A;  4R1L A;  2D1T A;  2M5O A;  1P4E C;  3PBK A;  1ZB9 A;  4B3M C;  2CY1 A;  5CZV A;  1O90 A;  5JRH A;  1FJG C;  5BUQ A;  3EQ6 A;  1TH5 A;  3TDE A;  4OXI A;  4X65 C;  2ASB A;  2E8E A;  3ETO A;  4NOZ A;  3FCE A;  5ADZ A;  1IBM C;  2E7G A;  3IEV A;  1XDX A;  3A26 A;  1LQL A;  1XNR C;  2M5H A;  5A1I A;  5T8S A;  5IT9 D;  1K0R A;  3N54 B;  3TR3 A;  4LFA C;  1BA3 A;  5DV9 A;  1N33 C;  4JI3 C;  1PG4 A;  4GXR A;  2YWC A;  3R44 A;  4DV3 C;  1MD9 A;  4DCT A;  3FCC A;  1WH9 A;  4X62 C;  3NPD A;  2WP0 C;  1MDF A;  3IPL A;  2P2F A;  2JNV A;  4JV5 C;  4JI4 C;  5KEI A;  1M6X C;  1XMQ C;  2MMA B;  4ZLP A;  3AF6 A;  1RG9 A;  3CW9 A;  5BST A;  4PUI A;  4DR5 C;  5BUR A;  3LNV A;  5BR8 C;  5CZX A;  2HHH C;  1XRC A;  2OO4 A;  4RM3 A;  2KDN A;  4LF6 C;  5E7Q A;  1GPM A;  4PHT A;  1MXA A;  4K0B A;  2P2J A;  4DV2 C;  5KYT A;  4NXM C;  3GKU A;  2ZZN A;  3DHV A;  4JYA C;  3LNO A;  2HJG A;  3B7W A;  1HNW C;  3IML A;  1HNX C;  2OBV A;  2CU6 A;  1FUG A;  2QL8 A;  4MH4 A;  4NXN C;  2D27 A;  1V26 A;  1V25 A;  1T5D X;  3GR0 A;  4WV3 A;  2ATW A; 
#chains in the Genus database with same CATH homology
 5AE3 A;  3AF5 A;  2PRO A;  4BSZ A;  1XNQ C;  4U5Y D;  2ONF A;  3R9W A;  4RM2 A;  4LF7 C;  1O93 A;  3JAM D;  3EER A;  2BH1 X;  3PRO C;  4G1I A;  4XX2 A;  4FUQ A;  4DR6 C;  3NYQ A;  3TUF A;  4D4G A;  4L7I A;  3E7X A;  2OPL B;  3UOW A;  1QWI A;  3RG2 A;  5AE2 A;  4BBY A;  4BCA A;  1JOS A;  5A19 A;  4FUT A;  3I08 A;  4K0K C;  4DV0 C;  3DLP X;  2E5L C;  2D1S A;  4HPV A;  5BSR A;  2Y27 A;  5AE1 A;  2CXC A;  5BUS A;  4PRO C;  4FTF A;  4RVO A;  2P2M A;  3UZ0 A;  1N34 C;  2UUB C;  3LUS A;  4L2Z A;  3I07 A;  4JI1 C;  3GPC A;  3SO4 A;  4DV4 C;  1WF3 A;  5H9U A;  4TPS B;  4X66 C;  4GS5 A;  2UXC C;  4B3T C;  4AQY C;  4GKK C;  4DCU A;  5A2Q D;  2UXD C;  5K8F A;  3VNR A;  2XR1 A;  2VQF C;  3LGX A;  4OX9 C;  2Y4N A;  2P2B A;  1HR0 C;  4G36 A;  4BC9 A;  4RLF A;  3A4I A;  1USP A;  2WD9 A;  3T1Y C;  5IFI A;  3LAX A;  2AYA A;  3TQI A;  4DCS A;  2P2Q A;  2ZM6 C;  4LFC C;  2KZF A;  1O9T A;  5GTD A;  4IR7 A;  4NDN A;  3E7W A;  4ZJZ A;  5T8T A;  4L4Q A;  4ODJ A;  3CJE A;  2F4V C;  2OPL A;  4DV1 C;  4RMN A;  2YCB A;  1HNZ C;  5BSW A;  4LE5 A;  4LF8 C;  1USP B;  5BSM A;  1MXC A;  3G7S A;  1N2F A;  5LMN C;  1AMU A;  2D1R A;  2VQE C;  3IEU A;  4DR1 C;  1ULT A;  1J5E C;  4JI0 C;  4LF9 C;  4DG9 A;  4JI5 C;  1HH2 P;  2BJO A;  5LMU C;  4DR7 C;  4B3R C;  1MXB A;  2DYJ A;  4DR2 C;  4KHP C;  1XRA A;  3H2T A;  1P7L A;  4RVN A;  2QW0 X;  1IBL C;  2UU9 C;  4DR3 C;  4IZ6 A;  4D57 A;  3KXW A;  1XMO C;  4WS9 A;  3J81 D;  4DR4 C;  4DG8 A;  1ZB8 A;  5A1G A;  2YWB A;  2QVX X;  4EAT A;  3S82 A;  3NYR A;  1MDB A;  4D56 A;  4YHH C;  4LF5 C;  1I94 C;  3C5E A;  3J80 D;  3J7A D;  3CW8 X;  4OYC A;  4DV5 C;  2E8C A;  3A9V A;  2D28 C;  5BSV A;  1ML8 A;  1LCI A;  2UUA C;  3ETC A;  1PG3 A;  4ISB A;  4G37 A;  4D4I A;  3OTO C;  1N32 C;  2E0G A;  2DPL A;  3GR1 A;  1PA4 A;  1IBK C;  1NYE A;  2E8F A;  4LFB C;  1UKK A;  3L8C A;  1YJ7 A;  3R9X A;  2QVY X;  3NI2 A;  4DV7 C;  4R0M A;  4JI8 C;  5FLX D;  1L2F A;  2D7V A;  4GKJ C;  1T5H X;  3VNQ A;  1O92 A;  3PES A;  4X64 C;  2VSQ A;  4I9F A;  2PT7 G;  4B3S C;  2VZE A;  4JI7 C;  5IWA C;  4BC7 A;  1N36 C;  1EGA A;  3L95 X;  5K85 A;  1VLA A;  4JI2 C;  4YY3 C;  4GXQ A;  4R1M A;  2P02 A;  4JM1 A;  4JI6 C;  4DCV A;  2QVZ X;  3RV2 A;  1XRB A;  5BSU A;  2Y4O A;  4DUY C;  5KYV A;  2P20 A;  2D1Q A;  4LF4 C;  4RLQ A;  2PN2 A;  4PZP A;  4DV6 C;  1KKG A;  4KTV A;  4KTT A;  4I9G A;  2JMP A;  1MKY A;  2V7B A;  3N2Q A;  2UUC C;  1RY2 A;  3DAY A;  4MTN A;  1QM4 A;  3T1H C;  2EGT A;  2UXB C;  4DUZ C;  3VNS A;  3A9U A;  4R1L A;  2D1T A;  3PBK A;  1ZB9 A;  4B3M C;  2CY1 A;  5CZV A;  1O90 A;  5JRH A;  1FJG C;  5BUQ A;  3EQ6 A;  3TDE A;  4OXI A;  4X65 C;  2ASB A;  2E8E A;  3ETO A;  4NOZ A;  3FCE A;  5ADZ A;  1IBM C;  2E7G A;  3IEV A;  1LQL A;  1XNR C;  5A1I A;  5T8S A;  5IT9 D;  1K0R A;  3N54 B;  4LFA C;  1BA3 A;  5DV9 A;  1N33 C;  4JI3 C;  1PG4 A;  4GXR A;  2YWC A;  3R44 A;  4DV3 C;  1MD9 A;  4DCT A;  3FCC A;  1WH9 A;  4X62 C;  3NPD A;  2WP0 C;  1MDF A;  3IPL A;  2P2F A;  4JV5 C;  4JI4 C;  5KEI A;  1XMQ C;  4ZLP A;  3AF6 A;  1RG9 A;  3CW9 A;  5BST A;  4DR5 C;  5BUR A;  3LNV A;  5BR8 C;  5CZX A;  2HHH C;  1XRC A;  2OO4 A;  4RM3 A;  4LF6 C;  5E7Q A;  1GPM A;  4PHT A;  1MXA A;  4K0B A;  2P2J A;  4DV2 C;  5KYT A;  4NXM C;  3GKU A;  3DHV A;  4JYA C;  2HJG A;  3B7W A;  1HNW C;  3IML A;  1HNX C;  2OBV A;  1FUG A;  2QL8 A;  4MH4 A;  4NXN C;  2D27 A;  1V26 A;  1V25 A;  1T5D X;  3GR0 A;  4WV3 A;  2ATW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...