4X64C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x64C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x64C02
2D7VA 1HNZC 2E5LC 2PN2A 4DR7C 4GKJC 3AF5A 4LFBC 2F4VC 4X66C 4DCSA 1MKYA 4JI0C 4DUZC 4DR6C 4JI2C 2UUBC 4JI7C 4NOZA 4LF5C 2UXCC 5IWAC 4DR2C 4MTNA 4B3MC 4DCUA 3J80D 4DR1C 4DV7C 5LMUC 2OPLB 1XMQC 4B3SC 1HH2P 5IT9D 4X64C 4X65C 4JI6C 2CXCA 4GKKC 2UXBC 4X62C 1N2FA 1J5EC 1IBLC 4MH4A 4K0KC 4DV3C 1IBMC 2QL8A 1WH9A 4B3RC 4YHHC 3LUSA 2ONFA 4OX9C 3J7AD 2BJOA 2E8FA 3CJEA 4LF6C 5A2QD 4JI8C 1QWIA 4JI3C 4DV1C 1N32C 1XNRC 4NXNC 4LF8C 5LMNC 4DCVA 2CY1A 3JAMD 1XNQC 1ZB9A 2XR1A 4YY3C 1LQLA 2ATWA 1XMOC 4JYAC 2E7GA 2E8EA 3EERA 1K0RA 1L2FA 2PT7G 4XX2A 1I94C 4DUYC 2VQEC 4B3TC 2KZFA 4DR3C 2YCBA 1ZB8A 1EGAA 2OPLA 4DV2C 1KKGA 2JMPA 1PA4A 4KHPC 1UKKA 1USPB 4JI4C 4LF7C 3J81D 1HNXC 1NYEA 2UU9C 3I07A 1IBKC 4LF4C 4LF9C 4DR5C 1FJGC 3IEUA 2HJGA 1ML8A 4DCTA 1N36C 4JI5C 1WF3A 3GKUA 4LFCC 4DV5C 1USPA 3OTOC 3AF6A 3T1HC 4NXMC 4DV4C 1N33C 4JI1C 1HNWC 5FLXD 1JOSA 5BR8C 2UXDC 2UUCC 2UUAC 1VLAA 3R9WA 2EGTA 3IEVA 2ZM6C 2VQFC 1N34C 4DR4C 3T1YC 2E8CA 4DV6C 4JV5C 4BSZA 1HR0C 4LFAC 2HHHC 2ASBA 3R9XA 4DV0C 4AQYC 2DYJA
chains in the Genus database with same CATH superfamily
1HNZC 2E5LC 1GPMA 4DR7C 2P2JA 2ZZNA 4JI0C 4DR6C 4JI2C 4NOZA 1XRAA 2P2BA 3VNSA 4MTNA 4B3MC 1MD9A 4DCUA 3PROC 1PG3A 3J80D 4DR1C 4DV7C 5IFIA 1YGTA 5LMUC 3DLPX 3KXWA 5K85A 2D1SA 4X65C 3UZ0A 4OYCA 2CXCA 2QVXX 4X62C 2D1QA 4DV3C 5CZXA 4FUTA 2P2QA 3FCEA 3GR1A 2OBVA 2E8FA 2QVYX 5A2QD 4JI8C 4JI3C 1N32C 1LCIA 5BSVA 2CY1A 2AYAA 4KTTA 3JAMD 3NI2A 1ZB9A 2CU6A 4RVNA 4YY3C 2E8EA 3EERA 2PT7G 4XX2A 2YCBA 1EGAA 1KKGA 2JMPA 1PA4A 1YJ7A 4KHPC 1UKKA 4JI4C 1HNXC 4DR5C 3IEUA 1WF3A 4LFCC 5BUQA 3RG2A 4D56A 2OO4A 4G36A 5H9UA 4FTFA 2ZZMA 3DAYA 4KTVA 2PG1E 2WP0C 2ZM6C 2VQFC 1N34C 4DR4C 4RMNA 5T8SA 4DV6C 1M6XA 4LFAC 2HHHC 3GPCA 3I08A 3PESA 2D7VA 2PN2A 5BSTA 5K8FA 1VEHA 4D4IA 3CW8X 3A4IA 1MKYA 2Z51A 4LF5C 5IWAC 4PUHA 1PU1A 3A25A 4ZLPA 5LCIA 1XMQC 4B3SC 5IT9D 4DG8A 4GKKC 2DHMA 4ISBA 3UX3A 1J5EC 1IBLC 3E7XA 4K0KC 4PHTA 2QL8A 4YHHC 3VNQA 2ONFA 5KYTA 2BJOA 5ADZA 3CQ2A 5BSMA 4HPVA 3LAXA 2M5OA 1XNRC 1NY8A 4LF8C 4DCVA 4U5YD 1IB8A 1XNQC 1MXAA 4TPSB 4WS9A 5DV9A 1LQLA 5KYVA 2E0GA 4OXIA 2E7GA 1K0RA 4IR7A 4LE5A 2VQEC 4BC7A 2KZFA 2MCQA 5BSWA 2OPLA 2YWBA 4LF7C 1O9TA 5KEIA 3I07A 3TQIA 1P4EA 2UU9C 3CQ3A 4JI5C 3GKUA 4DV5C 1USPA 4NDNA 1O90A 1N33C 2M5HA 4JI1C 5AE2A 5FLXD 1JOSA 1XRBA 3TUFA 2UUCC 4R0MA 1ULTA 3R9WA 3LGXA 2P2FA 3IEVA 4D4GA 3N54B 4BCAA 4ZJZA 4ODJA 4PROC 3R9XA 4PUGA 4RM2A 3UOWA 4LFBC 1P4EC 2JNVA 1FUGA 2BH1X 2MMAB 4D57A 4X66C 2F4VC 2P02A 3FCCA 5BURA 2PROA 2KZ0A 4GXQA 2UXCC 4DR2C 4WV3A 3C5EA 4K0BA 3E7WA 2P2MA 5A19A 3L95X 2OPLB 4L4QA 3R44A 4EATA 1HH2P 1T5HX 4X64C 1MXBA 5BUSA 2UXBC 3FM7A 3ETOA 1UWDA 3LUSA 4OX9C 1T5DX 3J7AD 3UEBA 5JRHA 3SO4A 1O92A 4I9FA 4DV1C 1FLOA 2D27A 1BA3A 4GXRA 4NXNC 4PZPA 3IPLA 1V60A 4R1MA 2D1RA 3A9VA 1XMOC 4BBYA 4R1LA 3RV2A 1L2FA 3AY0A 3H2TA 4DUYC 2QW0X 4DR3C 4DV2C 3L8CA 2ZTBA 1USPB 2VSQA 2D28C 3J81D 1RG9A 1IBKC 4LF4C 1FJGC 2HJGA 4BC9A 1ML8A 4DCTA 1N36C 4G1IA 2YWCA 3PBKA 5A1GA 1MXCA 1WCJA 3A26A 5BSUA 3CW9A 5BR8C 2UXDC 3N2QA 4I9GA 4JV5C 1RY2A 4BSZA 2ASBA 2KDNA 4AQYC 2DYJA 3S82A 4DG9A 4RVOA 1M6XC 4GKJC 2DPLA 3AF5A 4RLQA 3NYRA 4DCSA 4DUZC 1AMUA 2UUBC 3NPDA 4JI7C 4L7IA 3LNOA 1MDBA 4IZ6A 5A1IA 3O2EA 2QVZX 4GS5A 5E7QA 2Y27A 2MM9A 4JI6C 1XS3A 1XRCA 2P20A 3B7WA 1N2FA 4FUQA 1XHJA 4MH4A 4L2ZA 1IBMC 1MDFA 1WH9A 3TR3A 4B3RC 2V7BA 1O93A 1QM4A 3CJEA 4LF6C 3GR0A 3CQ1A 4PUIA 1QWIA 5AE1A 3UX2A 5LMNC 4G37A 3IMLA 5CZVA 4RM3A 2XR1A 2NCLA 1V25A 2ATWA 3EQ6A 4JYAC 3TDEA 3NYQA 1I94C 3G7SA 3ETCA 4B3TC 1TH5A 4RLFA 4JM1A 1XDXA 1ZB8A 2Y4NA 2WD9A 1P7LA 1NYEA 4LF9C 3A9UA 1V26A 2D1TA 3K6RA 3VNRA 3OTOC 3AF6A 3T1HC 4NXMC 4DV4C 5GTDA 1PG4A 1HNWC 2YX1A 2UUAC 3LNVA 5AE3A 1VLAA 5BSRA 3DHVA 2EGTA 3T1YC 2E8CA 2VZEA 5T8TA 1HR0C 4DV0C 2Y4OA
chains in the Genus database with same CATH topology
1HNZC 2E5LC 1GPMA 4DR7C 2P2JA 4JI0C 4DR6C 4JI2C 4NOZA 1XRAA 2P2BA 3VNSA 4MTNA 4B3MC 1MD9A 4DCUA 3PROC 1PG3A 3J80D 4DR1C 4DV7C 5IFIA 5LMUC 3DLPX 3KXWA 5K85A 2D1SA 4X65C 3UZ0A 4OYCA 2CXCA 2QVXX 4X62C 2D1QA 4DV3C 5CZXA 4FUTA 2P2QA 3FCEA 3GR1A 2OBVA 2E8FA 2QVYX 5A2QD 4JI8C 4JI3C 1N32C 1LCIA 5BSVA 2CY1A 2AYAA 4KTTA 3JAMD 3NI2A 1ZB9A 4RVNA 4YY3C 2E8EA 3EERA 2PT7G 4XX2A 2YCBA 1EGAA 1KKGA 2JMPA 1PA4A 1YJ7A 4KHPC 1UKKA 4JI4C 1HNXC 4DR5C 3IEUA 1WF3A 4LFCC 5BUQA 3RG2A 4D56A 2OO4A 4G36A 5H9UA 4FTFA 3DAYA 4KTVA 2WP0C 2ZM6C 2VQFC 1N34C 4DR4C 4RMNA 5T8SA 4DV6C 4LFAC 2HHHC 3GPCA 3I08A 3PESA 2D7VA 2PN2A 5BSTA 5K8FA 4D4IA 3CW8X 3A4IA 1MKYA 4LF5C 5IWAC 4ZLPA 1XMQC 4B3SC 5IT9D 4DG8A 4GKKC 4ISBA 1J5EC 1IBLC 3E7XA 4K0KC 4PHTA 2QL8A 4YHHC 3VNQA 2ONFA 5KYTA 2BJOA 5ADZA 5BSMA 4HPVA 3LAXA 1XNRC 4LF8C 4DCVA 4U5YD 1XNQC 1MXAA 4TPSB 4WS9A 5DV9A 1LQLA 5KYVA 2E0GA 4OXIA 2E7GA 1K0RA 4IR7A 4LE5A 2VQEC 4BC7A 2KZFA 5BSWA 2OPLA 2YWBA 4LF7C 1O9TA 5KEIA 3I07A 3TQIA 2UU9C 4JI5C 3GKUA 4DV5C 1USPA 4NDNA 1O90A 1N33C 4JI1C 5AE2A 5FLXD 1JOSA 1XRBA 3TUFA 2UUCC 4R0MA 1ULTA 3R9WA 3LGXA 2P2FA 3IEVA 4D4GA 3N54B 4BCAA 4ZJZA 4ODJA 4PROC 3R9XA 4RM2A 3UOWA 4LFBC 1FUGA 2BH1X 4D57A 2F4VC 4X66C 2P02A 3FCCA 5BURA 2PROA 4GXQA 2UXCC 4DR2C 3C5EA 4K0BA 4WV3A 3E7WA 2P2MA 5A19A 3L95X 2OPLB 4L4QA 3R44A 4EATA 1HH2P 1T5HX 4X64C 1MXBA 5BUSA 2UXBC 3ETOA 3LUSA 4OX9C 1T5DX 3J7AD 3SO4A 5JRHA 1O92A 4I9FA 4DV1C 2D27A 1BA3A 4GXRA 4NXNC 4PZPA 3IPLA 4R1MA 2D1RA 3A9VA 1XMOC 4BBYA 4R1LA 3RV2A 1L2FA 3H2TA 4DUYC 2QW0X 4DR3C 4DV2C 3L8CA 1USPB 2VSQA 2D28C 3J81D 1RG9A 1IBKC 4LF4C 1FJGC 2HJGA 4BC9A 1ML8A 4DCTA 1N36C 4G1IA 2YWCA 3PBKA 5A1GA 1MXCA 5BSUA 3CW9A 5BR8C 2UXDC 3N2QA 4I9GA 4JV5C 1RY2A 4BSZA 2ASBA 4AQYC 2DYJA 3S82A 4DG9A 4RVOA 4GKJC 2DPLA 3AF5A 4RLQA 3NYRA 4DCSA 4DUZC 1AMUA 2UUBC 3NPDA 4JI7C 4L7IA 1MDBA 4IZ6A 5A1IA 2QVZX 4GS5A 5E7QA 2Y27A 4JI6C 1XRCA 2P20A 3B7WA 1N2FA 4FUQA 4MH4A 4L2ZA 1IBMC 1MDFA 1WH9A 4B3RC 2V7BA 1O93A 1QM4A 3CJEA 4LF6C 3GR0A 1QWIA 5AE1A 5LMNC 4G37A 3IMLA 5CZVA 4RM3A 2XR1A 1V25A 2ATWA 3EQ6A 4JYAC 3TDEA 3NYQA 1I94C 3G7SA 3ETCA 4B3TC 4RLFA 4JM1A 1ZB8A 2Y4NA 2WD9A 1P7LA 1NYEA 4LF9C 3A9UA 1V26A 2D1TA 3VNRA 3OTOC 3AF6A 3T1HC 4NXMC 4DV4C 5GTDA 1PG4A 1HNWC 2UUAC 3LNVA 5AE3A 1VLAA 5BSRA 3DHVA 2EGTA 3T1YC 2E8CA 2VZEA 5T8TA 1HR0C 4DV0C 2Y4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7V A;  1HNZ C;  2E5L C;  2PN2 A;  4DR7 C;  4GKJ C;  3AF5 A;  4LFB C;  2F4V C;  4X66 C;  4DCS A;  1MKY A;  4JI0 C;  4DUZ C;  4DR6 C;  4JI2 C;  2UUB C;  4JI7 C;  4NOZ A;  4LF5 C;  2UXC C;  5IWA C;  4DR2 C;  4MTN A;  4B3M C;  4DCU A;  3J80 D;  4DR1 C;  4DV7 C;  5LMU C;  2OPL B;  1XMQ C;  4B3S C;  1HH2 P;  5IT9 D;  4X64 C;  4X65 C;  4JI6 C;  2CXC A;  4GKK C;  2UXB C;  4X62 C;  1N2F A;  1J5E C;  1IBL C;  4MH4 A;  4K0K C;  4DV3 C;  1IBM C;  2QL8 A;  1WH9 A;  4B3R C;  4YHH C;  3LUS A;  2ONF A;  4OX9 C;  3J7A D;  2BJO A;  2E8F A;  3CJE A;  4LF6 C;  5A2Q D;  4JI8 C;  1QWI A;  4JI3 C;  4DV1 C;  1N32 C;  1XNR C;  4NXN C;  4LF8 C;  5LMN C;  4DCV A;  2CY1 A;  3JAM D;  1XNQ C;  1ZB9 A;  2XR1 A;  4YY3 C;  1LQL A;  2ATW A;  1XMO C;  4JYA C;  2E7G A;  2E8E A;  3EER A;  1K0R A;  1L2F A;  2PT7 G;  4XX2 A;  1I94 C;  4DUY C;  2VQE C;  4B3T C;  2KZF A;  4DR3 C;  2YCB A;  1ZB8 A;  1EGA A;  2OPL A;  4DV2 C;  1KKG A;  2JMP A;  1PA4 A;  4KHP C;  1UKK A;  1USP B;  4JI4 C;  4LF7 C;  3J81 D;  1HNX C;  1NYE A;  2UU9 C;  3I07 A;  1IBK C;  4LF4 C;  4LF9 C;  4DR5 C;  1FJG C;  3IEU A;  2HJG A;  1ML8 A;  4DCT A;  1N36 C;  4JI5 C;  1WF3 A;  3GKU A;  4LFC C;  4DV5 C;  1USP A;  3OTO C;  3AF6 A;  3T1H C;  4NXM C;  4DV4 C;  1N33 C;  4JI1 C;  1HNW C;  5FLX D;  1JOS A;  5BR8 C;  2UXD C;  2UUC C;  2UUA C;  1VLA A;  3R9W A;  2EGT A;  3IEV A;  2ZM6 C;  2VQF C;  1N34 C;  4DR4 C;  3T1Y C;  2E8C A;  4DV6 C;  4JV5 C;  4BSZ A;  1HR0 C;  4LFA C;  2HHH C;  2ASB A;  3R9X A;  4DV0 C;  4AQY C;  2DYJ A; 
#chains in the Genus database with same CATH topology
 1HNZ C;  2E5L C;  1GPM A;  4DR7 C;  2P2J A;  2ZZN A;  4JI0 C;  4DR6 C;  4JI2 C;  4NOZ A;  1XRA A;  2P2B A;  3VNS A;  4MTN A;  4B3M C;  1MD9 A;  4DCU A;  3PRO C;  1PG3 A;  3J80 D;  4DR1 C;  4DV7 C;  5IFI A;  1YGT A;  5LMU C;  3DLP X;  3KXW A;  5K85 A;  2D1S A;  4X65 C;  3UZ0 A;  4OYC A;  2CXC A;  2QVX X;  4X62 C;  2D1Q A;  4DV3 C;  5CZX A;  4FUT A;  2P2Q A;  3FCE A;  3GR1 A;  2OBV A;  2E8F A;  2QVY X;  5A2Q D;  4JI8 C;  4JI3 C;  1N32 C;  1LCI A;  5BSV A;  2CY1 A;  2AYA A;  4KTT A;  3JAM D;  3NI2 A;  1ZB9 A;  2CU6 A;  4RVN A;  4YY3 C;  2E8E A;  3EER A;  2PT7 G;  4XX2 A;  2YCB A;  1EGA A;  1KKG A;  2JMP A;  1PA4 A;  1YJ7 A;  4KHP C;  1UKK A;  4JI4 C;  1HNX C;  4DR5 C;  3IEU A;  1WF3 A;  4LFC C;  5BUQ A;  3RG2 A;  4D56 A;  2OO4 A;  4G36 A;  5H9U A;  4FTF A;  2ZZM A;  3DAY A;  4KTV A;  2PG1 E;  2WP0 C;  2ZM6 C;  2VQF C;  1N34 C;  4DR4 C;  4RMN A;  5T8S A;  4DV6 C;  1M6X A;  4LFA C;  2HHH C;  3GPC A;  3I08 A;  3PES A;  2D7V A;  2PN2 A;  5BST A;  5K8F A;  1VEH A;  4D4I A;  3CW8 X;  3A4I A;  1MKY A;  2Z51 A;  4LF5 C;  5IWA C;  4PUH A;  1PU1 A;  3A25 A;  4ZLP A;  5LCI A;  1XMQ C;  4B3S C;  5IT9 D;  4DG8 A;  4GKK C;  2DHM A;  4ISB A;  3UX3 A;  1J5E C;  1IBL C;  3E7X A;  4K0K C;  4PHT A;  2QL8 A;  4YHH C;  3VNQ A;  2ONF A;  5KYT A;  2BJO A;  5ADZ A;  3CQ2 A;  5BSM A;  4HPV A;  3LAX A;  2M5O A;  1XNR C;  1NY8 A;  4LF8 C;  4DCV A;  4U5Y D;  1IB8 A;  1XNQ C;  1MXA A;  4TPS B;  4WS9 A;  5DV9 A;  1LQL A;  5KYV A;  2E0G A;  4OXI A;  2E7G A;  1K0R A;  4IR7 A;  4LE5 A;  2VQE C;  4BC7 A;  2KZF A;  2MCQ A;  5BSW A;  2OPL A;  2YWB A;  4LF7 C;  1O9T A;  5KEI A;  3I07 A;  3TQI A;  1P4E A;  2UU9 C;  3CQ3 A;  4JI5 C;  3GKU A;  4DV5 C;  1USP A;  4NDN A;  1O90 A;  1N33 C;  2M5H A;  4JI1 C;  5AE2 A;  5FLX D;  1JOS A;  1XRB A;  3TUF A;  2UUC C;  4R0M A;  1ULT A;  3R9W A;  3LGX A;  2P2F A;  3IEV A;  4D4G A;  3N54 B;  4BCA A;  4ZJZ A;  4ODJ A;  4PRO C;  3R9X A;  4PUG A;  4RM2 A;  3UOW A;  4LFB C;  1P4E C;  2JNV A;  1FUG A;  2BH1 X;  2MMA B;  4D57 A;  4X66 C;  2F4V C;  2P02 A;  3FCC A;  5BUR A;  2PRO A;  2KZ0 A;  4GXQ A;  2UXC C;  4DR2 C;  4WV3 A;  3C5E A;  4K0B A;  3E7W A;  2P2M A;  5A19 A;  3L95 X;  2OPL B;  4L4Q A;  3R44 A;  4EAT A;  1HH2 P;  1T5H X;  4X64 C;  1MXB A;  5BUS A;  2UXB C;  3FM7 A;  3ETO A;  1UWD A;  3LUS A;  4OX9 C;  1T5D X;  3J7A D;  3UEB A;  5JRH A;  3SO4 A;  1O92 A;  4I9F A;  4DV1 C;  1FLO A;  2D27 A;  1BA3 A;  4GXR A;  4NXN C;  4PZP A;  3IPL A;  1V60 A;  4R1M A;  2D1R A;  3A9V A;  1XMO C;  4BBY A;  4R1L A;  3RV2 A;  1L2F A;  3AY0 A;  3H2T A;  4DUY C;  2QW0 X;  4DR3 C;  4DV2 C;  3L8C A;  2ZTB A;  1USP B;  2VSQ A;  2D28 C;  3J81 D;  1RG9 A;  1IBK C;  4LF4 C;  1FJG C;  2HJG A;  4BC9 A;  1ML8 A;  4DCT A;  1N36 C;  4G1I A;  2YWC A;  3PBK A;  5A1G A;  1MXC A;  1WCJ A;  3A26 A;  5BSU A;  3CW9 A;  5BR8 C;  2UXD C;  3N2Q A;  4I9G A;  4JV5 C;  1RY2 A;  4BSZ A;  2ASB A;  2KDN A;  4AQY C;  2DYJ A;  3S82 A;  4DG9 A;  4RVO A;  1M6X C;  4GKJ C;  2DPL A;  3AF5 A;  4RLQ A;  3NYR A;  4DCS A;  4DUZ C;  1AMU A;  2UUB C;  3NPD A;  4JI7 C;  4L7I A;  3LNO A;  1MDB A;  4IZ6 A;  5A1I A;  3O2E A;  2QVZ X;  4GS5 A;  5E7Q A;  2Y27 A;  2MM9 A;  4JI6 C;  1XS3 A;  1XRC A;  2P20 A;  3B7W A;  1N2F A;  4FUQ A;  1XHJ A;  4MH4 A;  4L2Z A;  1IBM C;  1MDF A;  1WH9 A;  3TR3 A;  4B3R C;  2V7B A;  1O93 A;  1QM4 A;  3CJE A;  4LF6 C;  3GR0 A;  3CQ1 A;  4PUI A;  1QWI A;  5AE1 A;  3UX2 A;  5LMN C;  4G37 A;  3IML A;  5CZV A;  4RM3 A;  2XR1 A;  2NCL A;  1V25 A;  2ATW A;  3EQ6 A;  4JYA C;  3TDE A;  3NYQ A;  1I94 C;  3G7S A;  3ETC A;  4B3T C;  1TH5 A;  4RLF A;  4JM1 A;  1XDX A;  1ZB8 A;  2Y4N A;  2WD9 A;  1P7L A;  1NYE A;  4LF9 C;  3A9U A;  1V26 A;  2D1T A;  3K6R A;  3VNR A;  3OTO C;  3AF6 A;  3T1H C;  4NXM C;  4DV4 C;  5GTD A;  1PG4 A;  1HNW C;  2YX1 A;  2UUA C;  3LNV A;  5AE3 A;  1VLA A;  5BSR A;  3DHV A;  2EGT A;  3T1Y C;  2E8C A;  2VZE A;  5T8T A;  1HR0 C;  4DV0 C;  2Y4O A; 
#chains in the Genus database with same CATH homology
 1HNZ C;  2E5L C;  1GPM A;  4DR7 C;  2P2J A;  4JI0 C;  4DR6 C;  4JI2 C;  4NOZ A;  1XRA A;  2P2B A;  3VNS A;  4MTN A;  4B3M C;  1MD9 A;  4DCU A;  3PRO C;  1PG3 A;  3J80 D;  4DR1 C;  4DV7 C;  5IFI A;  5LMU C;  3DLP X;  3KXW A;  5K85 A;  2D1S A;  4X65 C;  3UZ0 A;  4OYC A;  2CXC A;  2QVX X;  4X62 C;  2D1Q A;  4DV3 C;  5CZX A;  4FUT A;  2P2Q A;  3FCE A;  3GR1 A;  2OBV A;  2E8F A;  2QVY X;  5A2Q D;  4JI8 C;  4JI3 C;  1N32 C;  1LCI A;  5BSV A;  2CY1 A;  2AYA A;  4KTT A;  3JAM D;  3NI2 A;  1ZB9 A;  4RVN A;  4YY3 C;  2E8E A;  3EER A;  2PT7 G;  4XX2 A;  2YCB A;  1EGA A;  1KKG A;  2JMP A;  1PA4 A;  1YJ7 A;  4KHP C;  1UKK A;  4JI4 C;  1HNX C;  4DR5 C;  3IEU A;  1WF3 A;  4LFC C;  5BUQ A;  3RG2 A;  4D56 A;  2OO4 A;  4G36 A;  5H9U A;  4FTF A;  3DAY A;  4KTV A;  2WP0 C;  2ZM6 C;  2VQF C;  1N34 C;  4DR4 C;  4RMN A;  5T8S A;  4DV6 C;  4LFA C;  2HHH C;  3GPC A;  3I08 A;  3PES A;  2D7V A;  2PN2 A;  5BST A;  5K8F A;  4D4I A;  3CW8 X;  3A4I A;  1MKY A;  4LF5 C;  5IWA C;  4ZLP A;  1XMQ C;  4B3S C;  5IT9 D;  4DG8 A;  4GKK C;  4ISB A;  1J5E C;  1IBL C;  3E7X A;  4K0K C;  4PHT A;  2QL8 A;  4YHH C;  3VNQ A;  2ONF A;  5KYT A;  2BJO A;  5ADZ A;  5BSM A;  4HPV A;  3LAX A;  1XNR C;  4LF8 C;  4DCV A;  4U5Y D;  1XNQ C;  1MXA A;  4TPS B;  4WS9 A;  5DV9 A;  1LQL A;  5KYV A;  2E0G A;  4OXI A;  2E7G A;  1K0R A;  4IR7 A;  4LE5 A;  2VQE C;  4BC7 A;  2KZF A;  5BSW A;  2OPL A;  2YWB A;  4LF7 C;  1O9T A;  5KEI A;  3I07 A;  3TQI A;  2UU9 C;  4JI5 C;  3GKU A;  4DV5 C;  1USP A;  4NDN A;  1O90 A;  1N33 C;  4JI1 C;  5AE2 A;  5FLX D;  1JOS A;  1XRB A;  3TUF A;  2UUC C;  4R0M A;  1ULT A;  3R9W A;  3LGX A;  2P2F A;  3IEV A;  4D4G A;  3N54 B;  4BCA A;  4ZJZ A;  4ODJ A;  4PRO C;  3R9X A;  4RM2 A;  3UOW A;  4LFB C;  1FUG A;  2BH1 X;  4D57 A;  2F4V C;  4X66 C;  2P02 A;  3FCC A;  5BUR A;  2PRO A;  4GXQ A;  2UXC C;  4DR2 C;  3C5E A;  4K0B A;  4WV3 A;  3E7W A;  2P2M A;  5A19 A;  3L95 X;  2OPL B;  4L4Q A;  3R44 A;  4EAT A;  1HH2 P;  1T5H X;  4X64 C;  1MXB A;  5BUS A;  2UXB C;  3ETO A;  3LUS A;  4OX9 C;  1T5D X;  3J7A D;  3SO4 A;  5JRH A;  1O92 A;  4I9F A;  4DV1 C;  2D27 A;  1BA3 A;  4GXR A;  4NXN C;  4PZP A;  3IPL A;  4R1M A;  2D1R A;  3A9V A;  1XMO C;  4BBY A;  4R1L A;  3RV2 A;  1L2F A;  3H2T A;  4DUY C;  2QW0 X;  4DR3 C;  4DV2 C;  3L8C A;  1USP B;  2VSQ A;  2D28 C;  3J81 D;  1RG9 A;  1IBK C;  4LF4 C;  1FJG C;  2HJG A;  4BC9 A;  1ML8 A;  4DCT A;  1N36 C;  4G1I A;  2YWC A;  3PBK A;  5A1G A;  1MXC A;  5BSU A;  3CW9 A;  5BR8 C;  2UXD C;  3N2Q A;  4I9G A;  4JV5 C;  1RY2 A;  4BSZ A;  2ASB A;  4AQY C;  2DYJ A;  3S82 A;  4DG9 A;  4RVO A;  4GKJ C;  2DPL A;  3AF5 A;  4RLQ A;  3NYR A;  4DCS A;  4DUZ C;  1AMU A;  2UUB C;  3NPD A;  4JI7 C;  4L7I A;  1MDB A;  4IZ6 A;  5A1I A;  2QVZ X;  4GS5 A;  5E7Q A;  2Y27 A;  4JI6 C;  1XRC A;  2P20 A;  3B7W A;  1N2F A;  4FUQ A;  4MH4 A;  4L2Z A;  1IBM C;  1MDF A;  1WH9 A;  4B3R C;  2V7B A;  1O93 A;  1QM4 A;  3CJE A;  4LF6 C;  3GR0 A;  1QWI A;  5AE1 A;  5LMN C;  4G37 A;  3IML A;  5CZV A;  4RM3 A;  2XR1 A;  1V25 A;  2ATW A;  3EQ6 A;  4JYA C;  3TDE A;  3NYQ A;  1I94 C;  3G7S A;  3ETC A;  4B3T C;  4RLF A;  4JM1 A;  1ZB8 A;  2Y4N A;  2WD9 A;  1P7L A;  1NYE A;  4LF9 C;  3A9U A;  1V26 A;  2D1T A;  3VNR A;  3OTO C;  3AF6 A;  3T1H C;  4NXM C;  4DV4 C;  5GTD A;  1PG4 A;  1HNW C;  2UUA C;  3LNV A;  5AE3 A;  1VLA A;  5BSR A;  3DHV A;  2EGT A;  3T1Y C;  2E8C A;  2VZE A;  5T8T A;  1HR0 C;  4DV0 C;  2Y4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...