4X64C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x64C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x64C02
3AF5A 1VLAA 4DV7C 2UUBC 2UUCC 4JI1C 4DR3C 1XMOC 4DUZC 1N34C 1LQLA 1USPB 1WH9A 1HNXC 4DR1C 2UU9C 4DR5C 5BR8C 2PN2A 3IEUA 1ML8A 4DUYC 4NOZA 2KZFA 4MTNA 4DV0C 4LF4C 2PT7G 4X65C 1FJGC 4BSZA 4JI8C 4JI4C 4JI6C 3R9XA 4DR4C 3J80D 3EERA 4NXNC 2CY1A 2E8FA 4JV5C 4B3MC 4DR2C 4OX9C 1N33C 1N32C 4GKJC 2E5LC 4DR6C 5IWAC 5LMNC 1XMQC 1QWIA 3J81D 2VQEC 1J5EC 5FLXD 4JI0C 1PA4A 5IT9D 4X62C 1NYEA 2DYJA 4MH4A 1IBKC 4LFAC 1ZB9A 4JI2C 4DR7C 4DCUA 1L2FA 3J7AD 1I94C 3T1YC 2UXCC 4DV2C 4DV1C 3I07A 2OPLA 1JOSA 1IBLC 3LUSA 4B3TC 2BJOA 3IEVA 2UUAC 4DCVA 2JMPA 3AF6A 4LF8C 4LF9C 4DV6C 4JI5C 1ZB8A 2HHHC 1UKKA 4JYAC 2XR1A 4JI7C 2F4VC 4YHHC 3T1HC 3CJEA 4JI3C 1XNRC 2E7GA 4DCTA 4DV4C 4X66C 3JAMD 4LF6C 3R9WA 4LFCC 2HJGA 1N36C 1USPA 1EGAA 4KHPC 4NXMC 4DV3C 4XX2A 2UXDC 2E8CA 1IBMC 2EGTA 4DV5C 2CXCA 1K0RA 4X64C 4LFBC 2VQFC 1HNZC 4DCSA 1XNQC 2OPLB 3OTOC 1HNWC 2ASBA 1HH2P 1WF3A 5LMUC 2ONFA 2ATWA 4LF5C 4AQYC 2ZM6C 2QL8A 2D7VA 2E8EA 4YY3C 5A2QD 1N2FA 1MKYA 4LF7C 1KKGA 4K0KC 4GKKC 1HR0C 2YCBA 4B3RC 4B3SC 2UXBC 3GKUA
chains in the Genus database with same CATH superfamily
3EQ6A 2UUBC 2QW0X 4KTVA 5K8FA 2P2JA 4NOZA 2KZFA 3SO4A 1VEHA 1XRAA 4JI4C 5H9UA 5BSRA 4DR4C 5KYVA 4OX9C 4R1LA 4WS9A 4RLQA 2E5LC 3DLPX 4OYCA 4FUTA 2CU6A 1YJ7A 4G37A 1XMQC 4K0BA 2VQEC 4MH4A 4LFAC 4JI2C 1P4EC 4DCUA 3UX2A 1L2FA 1I94C 4DV2C 3N2QA 1IB8A 1XDXA 3O2EA 4PUHA 4PUGA 1O93A 2JMPA 2M5HA 5KEIA 4LF8C 2M5OA 1ZB8A 5ADZA 5BURA 2HHHC 3I08A 4YHHC 2P02A 2V7BA 3CJEA 1XNRC 1MD9A 4JM1A 2E7GA 1LCIA 2DHMA 3UX3A 1M6XA 3R9WA 1USPA 3CW9A 3B7WA 4DG8A 4R0MA 5CZXA 2E8CA 3TUFA 3ETOA 2YX1A 5CZVA 2MCQA 3PESA 2D1SA 1XNQC 3UEBA 3OTOC 4GXRA 4BCAA 3RG2A 3H2TA 4ODJA 2E8EA 5A2QD 5IFIA 4K0KC 2D1QA 4GKKC 1HR0C 2YCBA 4B3RC 3GKUA 2D1TA 4KTTA 3UZ0A 2QVYX 2UUCC 4JI1C 4DR3C 1XMOC 3GR0A 1N34C 3E7XA 1XHJA 1P7LA 3VNSA 3L8CA 5BR8C 2PN2A 1ML8A 1MDFA 4ISBA 4DV0C 4X65C 1FJGC 2KDNA 3R9XA 4HPVA 2CY1A 4EATA 2D1RA 4JV5C 2NCLA 3IPLA 3VNQA 4GKJC 4ZJZA 4DR6C 2P20A 3C5EA 1QWIA 5FLXD 4JI0C 5KYTA 1NYEA 4X62C 1IBKC 5BUQA 4DR7C 3DHVA 1AMUA 1V60A 2P2QA 4BC7A 3T1YC 2UXCC 4DV1C 3I07A 2OPLA 3LAXA 2D28C 4D4GA 3A25A 3IEVA 4R1MA 4G1IA 4JYAC 2XR1A 2F4VC 4FUQA 2JNVA 3T1HC 4JI3C 5E7QA 3TR3A 2OO4A 3JAMD 4LF6C 5AE2A 3CQ3A 3NYRA 1N36C 5BSUA 4B3SC 3NPDA 2UXDC 1IBMC 3A26A 1K0RA 4X64C 3KXWA 3VNRA 1FLOA 4LFBC 2VQFC 4DCSA 3E7WA 3L95X 1HH2P 1WF3A 4GXQA 2BH1X 2YWBA 3NYQA 5AE3A 3ETCA 2DPLA 3R44A 4YY3C 4L2ZA 5BUSA 5K85A 1MXCA 2VZEA 4RVNA 3AF5A 3TDEA 4RM3A 1VLAA 4DV7C 2MMAB 1MXAA 1O90A 1ULTA 3A9VA 1USPB 1WH9A 1HNXC 3IEUA 4DUYC 3FCCA 4MTNA 2PT7G 4RM2A 4DG9A 4JI8C 4D4IA 1YGTA 3J80D 3EERA 4NXNC 2E8FA 3A4IA 4B3MC 4DR2C 1N33C 2Z51A 3LGXA 4WV3A 5BSWA 4L4QA 5IWAC 5LMNC 1J5EC 3CW8X 3G7SA 1V25A 1ZB9A 1PU1A 1O92A 4PZPA 2PG1E 4PROC 2MM9A 2Y27A 1IBLC 4B3TC 2BJOA 1MDBA 3FM7A 2Y4NA 4FTFA 4LF9C 4PHTA 4PUIA 2P2BA 1UKKA 3RV2A 5A19A 4JI7C 2KZ0A 2D27A 3CQ2A 1P4EA 1TH5A 5A1GA 1GPMA 4DCTA 1PG4A 4DV4C 4X66C 3PROC 2HJGA 3GR1A 1PG3A 4RMNA 4NXMC 3DAYA 3A9UA 2CXCA 2QVZX 3CQ1A 3LNOA 4RVOA 5BSTA 3UOWA 4D57A 2OPLB 1O9TA 5JRHA 2ASBA 2VSQA 3NI2A 2ONFA 2OBVA 1MXBA 2ATWA 4LF5C 4BBYA 4L7IA 3S82A 2ZTBA 1QM4A 4LF7C 3PBKA 3TQIA 4LF4C 1UWDA 1WCJA 2PROA 2ZZMA 4DUZC 1LQLA 2P2MA 2Y4OA 4DR1C 2UU9C 4DR5C 4IZ6A 2WP0C 4G36A 1V26A 4BSZA 4LE5A 1XRCA 4JI6C 1NY8A 1N32C 5T8SA 3N54B 1T5DX 4GS5A 3IMLA 3FCEA 1T5HX 4NDNA 1FUGA 3LNVA 5BSVA 3J81D 1PA4A 5IT9D 2DYJA 5A1IA 4RLFA 3J7AD 1BA3A 3K6RA 4D56A 1JOSA 3LUSA 2UUAC 3GPCA 2E0GA 4BC9A 4DCVA 3AF6A 5BSMA 4DV6C 4JI5C 5DV9A 2ZZNA 5GTDA 4ZLPA 2P2FA 1XRBA 4I9FA 4LFCC 2YWCA 1M6XC 2AYAA 1EGAA 4KHPC 4DV3C 4XX2A 2EGTA 4DV5C 4I9GA 2WD9A 1HNZC 4IR7A 5T8TA 4U5YD 4TPSB 1HNWC 4OXIA 5LMUC 3AY0A 1XS3A 5LCIA 4AQYC 1RY2A 2ZM6C 2QL8A 2D7VA 1N2FA 1MKYA 5AE1A 1KKGA 1RG9A 2QVXX 2UXBC
chains in the Genus database with same CATH topology
3EQ6A 2UUBC 2QW0X 4KTVA 5K8FA 2P2JA 4NOZA 2KZFA 3SO4A 1XRAA 4JI4C 5H9UA 5BSRA 4DR4C 5KYVA 4OX9C 4R1LA 4WS9A 4RLQA 2E5LC 3DLPX 4OYCA 4FUTA 1YJ7A 4G37A 1XMQC 4K0BA 2VQEC 4MH4A 4LFAC 4JI2C 4DCUA 1L2FA 1I94C 4DV2C 3N2QA 1O93A 2JMPA 5KEIA 4LF8C 1ZB8A 5ADZA 5BURA 2HHHC 3I08A 4YHHC 2P02A 2V7BA 3CJEA 1XNRC 1MD9A 4JM1A 2E7GA 1LCIA 3R9WA 1USPA 3CW9A 3B7WA 4DG8A 4R0MA 5CZXA 2E8CA 3TUFA 3ETOA 5CZVA 3PESA 2D1SA 1XNQC 3OTOC 4GXRA 4BCAA 3RG2A 3H2TA 4ODJA 2E8EA 5A2QD 5IFIA 4K0KC 2D1QA 4GKKC 1HR0C 2YCBA 4B3RC 3GKUA 2D1TA 4KTTA 3UZ0A 2QVYX 2UUCC 4JI1C 4DR3C 1XMOC 3GR0A 1N34C 3E7XA 1P7LA 3VNSA 3L8CA 5BR8C 2PN2A 1ML8A 1MDFA 4ISBA 4DV0C 4X65C 1FJGC 3R9XA 4HPVA 2CY1A 4EATA 2D1RA 4JV5C 3IPLA 3VNQA 4GKJC 4ZJZA 4DR6C 2P20A 3C5EA 1QWIA 5FLXD 4JI0C 5KYTA 1NYEA 4X62C 1IBKC 5BUQA 4DR7C 3DHVA 1AMUA 2P2QA 4BC7A 3T1YC 2UXCC 4DV1C 3I07A 2OPLA 3LAXA 2D28C 4D4GA 3IEVA 4R1MA 4G1IA 4JYAC 2XR1A 2F4VC 4FUQA 3T1HC 4JI3C 5E7QA 2OO4A 3JAMD 4LF6C 5AE2A 1N36C 3NYRA 5BSUA 4B3SC 3NPDA 2UXDC 1IBMC 1K0RA 4X64C 3KXWA 3VNRA 4LFBC 2VQFC 4DCSA 3E7WA 3L95X 1HH2P 1WF3A 4GXQA 2BH1X 2YWBA 3NYQA 5AE3A 3ETCA 2DPLA 3R44A 4YY3C 4L2ZA 5BUSA 5K85A 1MXCA 2VZEA 4RVNA 3AF5A 3TDEA 4RM3A 1VLAA 4DV7C 1MXAA 1O90A 1ULTA 3A9VA 1USPB 1WH9A 1HNXC 3IEUA 4DUYC 3FCCA 4MTNA 2PT7G 4RM2A 4DG9A 4JI8C 4D4IA 3J80D 3EERA 4NXNC 2E8FA 3A4IA 4B3MC 4DR2C 1N33C 3LGXA 4WV3A 5BSWA 4L4QA 5IWAC 5LMNC 1J5EC 3CW8X 3G7SA 1V25A 1ZB9A 1O92A 4PZPA 4PROC 2Y27A 1IBLC 4B3TC 2BJOA 1MDBA 2Y4NA 4FTFA 4LF9C 4PHTA 2P2BA 1UKKA 3RV2A 5A19A 4JI7C 2D27A 5A1GA 1GPMA 4DCTA 1PG4A 4DV4C 4X66C 3PROC 2HJGA 3GR1A 1PG3A 4RMNA 4NXMC 3DAYA 3A9UA 2CXCA 2QVZX 4RVOA 5BSTA 3UOWA 4D57A 2OPLB 1O9TA 5JRHA 2ASBA 2VSQA 3NI2A 2ONFA 2OBVA 1MXBA 2ATWA 4LF5C 4BBYA 4L7IA 3S82A 1QM4A 4LF7C 3PBKA 3TQIA 4LF4C 2PROA 4DUZC 1LQLA 2P2MA 2Y4OA 4DR1C 2UU9C 4DR5C 4IZ6A 2WP0C 4G36A 1V26A 4BSZA 4LE5A 1XRCA 4JI6C 1N32C 5T8SA 3N54B 1T5DX 4GS5A 3IMLA 3FCEA 1T5HX 4NDNA 1FUGA 3LNVA 5BSVA 3J81D 1PA4A 5IT9D 2DYJA 5A1IA 4RLFA 3J7AD 1BA3A 4D56A 1JOSA 3LUSA 2UUAC 3GPCA 2E0GA 4BC9A 4DCVA 3AF6A 5BSMA 4DV6C 4JI5C 5DV9A 5GTDA 4ZLPA 2P2FA 1XRBA 4I9FA 4LFCC 2YWCA 2AYAA 1EGAA 4KHPC 4DV3C 4XX2A 2EGTA 4DV5C 4I9GA 2WD9A 1HNZC 4IR7A 5T8TA 4U5YD 4TPSB 1HNWC 5LMUC 4OXIA 4AQYC 1RY2A 2ZM6C 2QL8A 2D7VA 1N2FA 1MKYA 5AE1A 1KKGA 1RG9A 2QVXX 2UXBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF5 A;  1VLA A;  4DV7 C;  2UUB C;  2UUC C;  4JI1 C;  4DR3 C;  1XMO C;  4DUZ C;  1N34 C;  1LQL A;  1USP B;  1WH9 A;  1HNX C;  4DR1 C;  2UU9 C;  4DR5 C;  5BR8 C;  2PN2 A;  3IEU A;  1ML8 A;  4DUY C;  4NOZ A;  2KZF A;  4MTN A;  4DV0 C;  4LF4 C;  2PT7 G;  4X65 C;  1FJG C;  4BSZ A;  4JI8 C;  4JI4 C;  4JI6 C;  3R9X A;  4DR4 C;  3J80 D;  3EER A;  4NXN C;  2CY1 A;  2E8F A;  4JV5 C;  4B3M C;  4DR2 C;  4OX9 C;  1N33 C;  1N32 C;  4GKJ C;  2E5L C;  4DR6 C;  5IWA C;  5LMN C;  1XMQ C;  1QWI A;  3J81 D;  2VQE C;  1J5E C;  5FLX D;  4JI0 C;  1PA4 A;  5IT9 D;  4X62 C;  1NYE A;  2DYJ A;  4MH4 A;  1IBK C;  4LFA C;  1ZB9 A;  4JI2 C;  4DR7 C;  4DCU A;  1L2F A;  3J7A D;  1I94 C;  3T1Y C;  2UXC C;  4DV2 C;  4DV1 C;  3I07 A;  2OPL A;  1JOS A;  1IBL C;  3LUS A;  4B3T C;  2BJO A;  3IEV A;  2UUA C;  4DCV A;  2JMP A;  3AF6 A;  4LF8 C;  4LF9 C;  4DV6 C;  4JI5 C;  1ZB8 A;  2HHH C;  1UKK A;  4JYA C;  2XR1 A;  4JI7 C;  2F4V C;  4YHH C;  3T1H C;  3CJE A;  4JI3 C;  1XNR C;  2E7G A;  4DCT A;  4DV4 C;  4X66 C;  3JAM D;  4LF6 C;  3R9W A;  4LFC C;  2HJG A;  1N36 C;  1USP A;  1EGA A;  4KHP C;  4NXM C;  4DV3 C;  4XX2 A;  2UXD C;  2E8C A;  1IBM C;  2EGT A;  4DV5 C;  2CXC A;  1K0R A;  4X64 C;  4LFB C;  2VQF C;  1HNZ C;  4DCS A;  1XNQ C;  2OPL B;  3OTO C;  1HNW C;  2ASB A;  1HH2 P;  1WF3 A;  5LMU C;  2ONF A;  2ATW A;  4LF5 C;  4AQY C;  2ZM6 C;  2QL8 A;  2D7V A;  2E8E A;  4YY3 C;  5A2Q D;  1N2F A;  1MKY A;  4LF7 C;  1KKG A;  4K0K C;  4GKK C;  1HR0 C;  2YCB A;  4B3R C;  4B3S C;  2UXB C;  3GKU A; 
#chains in the Genus database with same CATH topology
 3EQ6 A;  2UUB C;  2QW0 X;  4KTV A;  5K8F A;  2P2J A;  4NOZ A;  2KZF A;  3SO4 A;  1VEH A;  1XRA A;  4JI4 C;  5H9U A;  5BSR A;  4DR4 C;  5KYV A;  4OX9 C;  4R1L A;  4WS9 A;  4RLQ A;  2E5L C;  3DLP X;  4OYC A;  4FUT A;  2CU6 A;  1YJ7 A;  4G37 A;  1XMQ C;  4K0B A;  2VQE C;  4MH4 A;  4LFA C;  4JI2 C;  1P4E C;  4DCU A;  3UX2 A;  1L2F A;  1I94 C;  4DV2 C;  3N2Q A;  1IB8 A;  1XDX A;  3O2E A;  4PUH A;  4PUG A;  1O93 A;  2JMP A;  2M5H A;  5KEI A;  4LF8 C;  2M5O A;  1ZB8 A;  5ADZ A;  5BUR A;  2HHH C;  3I08 A;  4YHH C;  2P02 A;  2V7B A;  3CJE A;  1XNR C;  1MD9 A;  4JM1 A;  2E7G A;  1LCI A;  2DHM A;  3UX3 A;  1M6X A;  3R9W A;  1USP A;  3CW9 A;  3B7W A;  4DG8 A;  4R0M A;  5CZX A;  2E8C A;  3TUF A;  3ETO A;  2YX1 A;  5CZV A;  2MCQ A;  3PES A;  2D1S A;  1XNQ C;  3UEB A;  3OTO C;  4GXR A;  4BCA A;  3RG2 A;  3H2T A;  4ODJ A;  2E8E A;  5A2Q D;  5IFI A;  4K0K C;  2D1Q A;  4GKK C;  1HR0 C;  2YCB A;  4B3R C;  3GKU A;  2D1T A;  4KTT A;  3UZ0 A;  2QVY X;  2UUC C;  4JI1 C;  4DR3 C;  1XMO C;  3GR0 A;  1N34 C;  3E7X A;  1XHJ A;  1P7L A;  3VNS A;  3L8C A;  5BR8 C;  2PN2 A;  1ML8 A;  1MDF A;  4ISB A;  4DV0 C;  4X65 C;  1FJG C;  2KDN A;  3R9X A;  4HPV A;  2CY1 A;  4EAT A;  2D1R A;  4JV5 C;  2NCL A;  3IPL A;  3VNQ A;  4GKJ C;  4ZJZ A;  4DR6 C;  2P20 A;  3C5E A;  1QWI A;  5FLX D;  4JI0 C;  5KYT A;  1NYE A;  4X62 C;  1IBK C;  5BUQ A;  4DR7 C;  3DHV A;  1AMU A;  1V60 A;  2P2Q A;  4BC7 A;  3T1Y C;  2UXC C;  4DV1 C;  3I07 A;  2OPL A;  3LAX A;  2D28 C;  4D4G A;  3A25 A;  3IEV A;  4R1M A;  4G1I A;  4JYA C;  2XR1 A;  2F4V C;  4FUQ A;  2JNV A;  3T1H C;  4JI3 C;  5E7Q A;  3TR3 A;  2OO4 A;  3JAM D;  4LF6 C;  5AE2 A;  3CQ3 A;  3NYR A;  1N36 C;  5BSU A;  4B3S C;  3NPD A;  2UXD C;  1IBM C;  3A26 A;  1K0R A;  4X64 C;  3KXW A;  3VNR A;  1FLO A;  4LFB C;  2VQF C;  4DCS A;  3E7W A;  3L95 X;  1HH2 P;  1WF3 A;  4GXQ A;  2BH1 X;  2YWB A;  3NYQ A;  5AE3 A;  3ETC A;  2DPL A;  3R44 A;  4YY3 C;  4L2Z A;  5BUS A;  5K85 A;  1MXC A;  2VZE A;  4RVN A;  3AF5 A;  3TDE A;  4RM3 A;  1VLA A;  4DV7 C;  2MMA B;  1MXA A;  1O90 A;  1ULT A;  3A9V A;  1USP B;  1WH9 A;  1HNX C;  3IEU A;  4DUY C;  3FCC A;  4MTN A;  2PT7 G;  4RM2 A;  4DG9 A;  4JI8 C;  4D4I A;  1YGT A;  3J80 D;  3EER A;  4NXN C;  2E8F A;  3A4I A;  4B3M C;  4DR2 C;  1N33 C;  2Z51 A;  3LGX A;  4WV3 A;  5BSW A;  4L4Q A;  5IWA C;  5LMN C;  1J5E C;  3CW8 X;  3G7S A;  1V25 A;  1ZB9 A;  1PU1 A;  1O92 A;  4PZP A;  2PG1 E;  4PRO C;  2MM9 A;  2Y27 A;  1IBL C;  4B3T C;  2BJO A;  1MDB A;  3FM7 A;  2Y4N A;  4FTF A;  4LF9 C;  4PHT A;  4PUI A;  2P2B A;  1UKK A;  3RV2 A;  5A19 A;  4JI7 C;  2KZ0 A;  2D27 A;  3CQ2 A;  1P4E A;  1TH5 A;  5A1G A;  1GPM A;  4DCT A;  1PG4 A;  4DV4 C;  4X66 C;  3PRO C;  2HJG A;  3GR1 A;  1PG3 A;  4RMN A;  4NXM C;  3DAY A;  3A9U A;  2CXC A;  2QVZ X;  3CQ1 A;  3LNO A;  4RVO A;  5BST A;  3UOW A;  4D57 A;  2OPL B;  1O9T A;  5JRH A;  2ASB A;  2VSQ A;  3NI2 A;  2ONF A;  2OBV A;  1MXB A;  2ATW A;  4LF5 C;  4BBY A;  4L7I A;  3S82 A;  2ZTB A;  1QM4 A;  4LF7 C;  3PBK A;  3TQI A;  4LF4 C;  1UWD A;  1WCJ A;  2PRO A;  2ZZM A;  4DUZ C;  1LQL A;  2P2M A;  2Y4O A;  4DR1 C;  2UU9 C;  4DR5 C;  4IZ6 A;  2WP0 C;  4G36 A;  1V26 A;  4BSZ A;  4LE5 A;  1XRC A;  4JI6 C;  1NY8 A;  1N32 C;  5T8S A;  3N54 B;  1T5D X;  4GS5 A;  3IML A;  3FCE A;  1T5H X;  4NDN A;  1FUG A;  3LNV A;  5BSV A;  3J81 D;  1PA4 A;  5IT9 D;  2DYJ A;  5A1I A;  4RLF A;  3J7A D;  1BA3 A;  3K6R A;  4D56 A;  1JOS A;  3LUS A;  2UUA C;  3GPC A;  2E0G A;  4BC9 A;  4DCV A;  3AF6 A;  5BSM A;  4DV6 C;  4JI5 C;  5DV9 A;  2ZZN A;  5GTD A;  4ZLP A;  2P2F A;  1XRB A;  4I9F A;  4LFC C;  2YWC A;  1M6X C;  2AYA A;  1EGA A;  4KHP C;  4DV3 C;  4XX2 A;  2EGT A;  4DV5 C;  4I9G A;  2WD9 A;  1HNZ C;  4IR7 A;  5T8T A;  4U5Y D;  4TPS B;  1HNW C;  4OXI A;  5LMU C;  3AY0 A;  1XS3 A;  5LCI A;  4AQY C;  1RY2 A;  2ZM6 C;  2QL8 A;  2D7V A;  1N2F A;  1MKY A;  5AE1 A;  1KKG A;  1RG9 A;  2QVX X;  2UXB C; 
#chains in the Genus database with same CATH homology
 3EQ6 A;  2UUB C;  2QW0 X;  4KTV A;  5K8F A;  2P2J A;  4NOZ A;  2KZF A;  3SO4 A;  1XRA A;  4JI4 C;  5H9U A;  5BSR A;  4DR4 C;  5KYV A;  4OX9 C;  4R1L A;  4WS9 A;  4RLQ A;  2E5L C;  3DLP X;  4OYC A;  4FUT A;  1YJ7 A;  4G37 A;  1XMQ C;  4K0B A;  2VQE C;  4MH4 A;  4LFA C;  4JI2 C;  4DCU A;  1L2F A;  1I94 C;  4DV2 C;  3N2Q A;  1O93 A;  2JMP A;  5KEI A;  4LF8 C;  1ZB8 A;  5ADZ A;  5BUR A;  2HHH C;  3I08 A;  4YHH C;  2P02 A;  2V7B A;  3CJE A;  1XNR C;  1MD9 A;  4JM1 A;  2E7G A;  1LCI A;  3R9W A;  1USP A;  3CW9 A;  3B7W A;  4DG8 A;  4R0M A;  5CZX A;  2E8C A;  3TUF A;  3ETO A;  5CZV A;  3PES A;  2D1S A;  1XNQ C;  3OTO C;  4GXR A;  4BCA A;  3RG2 A;  3H2T A;  4ODJ A;  2E8E A;  5A2Q D;  5IFI A;  4K0K C;  2D1Q A;  4GKK C;  1HR0 C;  2YCB A;  4B3R C;  3GKU A;  2D1T A;  4KTT A;  3UZ0 A;  2QVY X;  2UUC C;  4JI1 C;  4DR3 C;  1XMO C;  3GR0 A;  1N34 C;  3E7X A;  1P7L A;  3VNS A;  3L8C A;  5BR8 C;  2PN2 A;  1ML8 A;  1MDF A;  4ISB A;  4DV0 C;  4X65 C;  1FJG C;  3R9X A;  4HPV A;  2CY1 A;  4EAT A;  2D1R A;  4JV5 C;  3IPL A;  3VNQ A;  4GKJ C;  4ZJZ A;  4DR6 C;  2P20 A;  3C5E A;  1QWI A;  5FLX D;  4JI0 C;  5KYT A;  1NYE A;  4X62 C;  1IBK C;  5BUQ A;  4DR7 C;  3DHV A;  1AMU A;  2P2Q A;  4BC7 A;  3T1Y C;  2UXC C;  4DV1 C;  3I07 A;  2OPL A;  3LAX A;  2D28 C;  4D4G A;  3IEV A;  4R1M A;  4G1I A;  4JYA C;  2XR1 A;  2F4V C;  4FUQ A;  3T1H C;  4JI3 C;  5E7Q A;  2OO4 A;  3JAM D;  4LF6 C;  5AE2 A;  1N36 C;  3NYR A;  5BSU A;  4B3S C;  3NPD A;  2UXD C;  1IBM C;  1K0R A;  4X64 C;  3KXW A;  3VNR A;  4LFB C;  2VQF C;  4DCS A;  3E7W A;  3L95 X;  1HH2 P;  1WF3 A;  4GXQ A;  2BH1 X;  2YWB A;  3NYQ A;  5AE3 A;  3ETC A;  2DPL A;  3R44 A;  4YY3 C;  4L2Z A;  5BUS A;  5K85 A;  1MXC A;  2VZE A;  4RVN A;  3AF5 A;  3TDE A;  4RM3 A;  1VLA A;  4DV7 C;  1MXA A;  1O90 A;  1ULT A;  3A9V A;  1USP B;  1WH9 A;  1HNX C;  3IEU A;  4DUY C;  3FCC A;  4MTN A;  2PT7 G;  4RM2 A;  4DG9 A;  4JI8 C;  4D4I A;  3J80 D;  3EER A;  4NXN C;  2E8F A;  3A4I A;  4B3M C;  4DR2 C;  1N33 C;  3LGX A;  4WV3 A;  5BSW A;  4L4Q A;  5IWA C;  5LMN C;  1J5E C;  3CW8 X;  3G7S A;  1V25 A;  1ZB9 A;  1O92 A;  4PZP A;  4PRO C;  2Y27 A;  1IBL C;  4B3T C;  2BJO A;  1MDB A;  2Y4N A;  4FTF A;  4LF9 C;  4PHT A;  2P2B A;  1UKK A;  3RV2 A;  5A19 A;  4JI7 C;  2D27 A;  5A1G A;  1GPM A;  4DCT A;  1PG4 A;  4DV4 C;  4X66 C;  3PRO C;  2HJG A;  3GR1 A;  1PG3 A;  4RMN A;  4NXM C;  3DAY A;  3A9U A;  2CXC A;  2QVZ X;  4RVO A;  5BST A;  3UOW A;  4D57 A;  2OPL B;  1O9T A;  5JRH A;  2ASB A;  2VSQ A;  3NI2 A;  2ONF A;  2OBV A;  1MXB A;  2ATW A;  4LF5 C;  4BBY A;  4L7I A;  3S82 A;  1QM4 A;  4LF7 C;  3PBK A;  3TQI A;  4LF4 C;  2PRO A;  4DUZ C;  1LQL A;  2P2M A;  2Y4O A;  4DR1 C;  2UU9 C;  4DR5 C;  4IZ6 A;  2WP0 C;  4G36 A;  1V26 A;  4BSZ A;  4LE5 A;  1XRC A;  4JI6 C;  1N32 C;  5T8S A;  3N54 B;  1T5D X;  4GS5 A;  3IML A;  3FCE A;  1T5H X;  4NDN A;  1FUG A;  3LNV A;  5BSV A;  3J81 D;  1PA4 A;  5IT9 D;  2DYJ A;  5A1I A;  4RLF A;  3J7A D;  1BA3 A;  4D56 A;  1JOS A;  3LUS A;  2UUA C;  3GPC A;  2E0G A;  4BC9 A;  4DCV A;  3AF6 A;  5BSM A;  4DV6 C;  4JI5 C;  5DV9 A;  5GTD A;  4ZLP A;  2P2F A;  1XRB A;  4I9F A;  4LFC C;  2YWC A;  2AYA A;  1EGA A;  4KHP C;  4DV3 C;  4XX2 A;  2EGT A;  4DV5 C;  4I9G A;  2WD9 A;  1HNZ C;  4IR7 A;  5T8T A;  4U5Y D;  4TPS B;  1HNW C;  5LMU C;  4OXI A;  4AQY C;  1RY2 A;  2ZM6 C;  2QL8 A;  2D7V A;  1N2F A;  1MKY A;  5AE1 A;  1KKG A;  1RG9 A;  2QVX X;  2UXB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...