4X64C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4x64C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4x64C02
4MH4A 2PT7G 3JAMD 1MKYA 1UKKA 4AQYC 5FLXD 1IBKC 4B3RC 1K0RA 1IBLC 1IBMC 1LQLA 4DUYC 2E7GA 5IT9D 3GKUA 3LUSA 2UUAC 4JI0C 3IEVA 4B3SC 1HNZC 1PA4A 4DR1C 4B3MC 1HH2P 2VQFC 2OPLB 2DYJA 4DR5C 2D7VA 2PN2A 4X66C 2QL8A 1ZB8A 2E8FA 1XNRC 1N34C 2E5LC 1HNXC 3J81D 4BSZA 2UUBC 1ML8A 2BJOA 4JI1C 2HHHC 1J5EC 1HR0C 2HJGA 4JI2C 4DUZC 4JI6C 4NXMC 1QWIA 2OPLA 4LF7C 2ONFA 2ATWA 3R9XA 1N33C 1KKGA 1N2FA 2JMPA 3T1YC 4DV2C 1L2FA 4LF6C 5BR8C 4DV0C 4JV5C 2ZM6C 2KZFA 4X65C 3I07A 3OTOC 1EGAA 5LMNC 4DR6C 4LF8C 5A2QD 5LMUC 4JI8C 4YHHC 4MTNA 4DV4C 2UXCC 4JI4C 3EERA 2E8CA 4GKJC 4JI5C 2UUCC 4DV3C 4JYAC 2UXDC 1N32C 3CJEA 5IWAC 4X64C 2CXCA 1XMQC 4JI7C 4LFCC 4K0KC 4DV7C 1XMOC 4DR3C 4DV5C 3J80D 1JOSA 1N36C 4NXNC 4LF5C 4DCTA 2XR1A 4LF4C 1HNWC 4LFAC 3AF5A 1USPB 1FJGC 4LF9C 2YCBA 1WF3A 4X62C 4LFBC 2F4VC 1XNQC 4DR2C 2UU9C 4GKKC 4JI3C 3AF6A 4DV6C 4XX2A 1ZB9A 4DR4C 4DCVA 1NYEA 4DR7C 3J7AD 4KHPC 2CY1A 4YY3C 3T1HC 2UXBC 4DCSA 3R9WA 2EGTA 1I94C 4NOZA 1WH9A 2E8EA 4B3TC 4DCUA 4OX9C 3IEUA 2VQEC 1VLAA 2ASBA 1USPA 4DV1C
chains in the Genus database with same CATH superfamily
4RM2A 1ULTA 3JAMD 4FUQA 3SO4A 1IB8A 2MCQA 5KEIA 4B3RC 3CQ3A 1IBLC 1IBMC 1LQLA 4JI0C 4IZ6A 4G37A 5BUQA 1O9TA 3LAXA 4GXQA 4D4IA 2M5OA 2Y4OA 2VQFC 3CW9A 2OPLB 1PG3A 2D7VA 2QL8A 2Y27A 2E8FA 3A4IA 1ML8A 1QM4A 2HHHC 4RM3A 1HR0C 1P7LA 4JI2C 3A26A 3NI2A 3PESA 4DUZC 1O93A 5ADZA 2ONFA 4RVOA 2ATWA 3R9XA 4DV0C 5BSWA 3TDEA 1P4EC 2KZFA 5A19A 4X65C 5CZXA 4ZJZA 3OTOC 4DR6C 3VNRA 4RLQA 2QVZX 4ZLPA 3N54B 2E8CA 3A9UA 5A1IA 5BSUA 2UUCC 4JYAC 4PUGA 1PU1A 2P02A 4BCAA 4JI7C 1MDFA 2NCLA 4DR3C 4DV5C 1N36C 5K8FA 4DCTA 1HNWC 1LCIA 3N2QA 4LFAC 3AF5A 5KYTA 1FJGC 5KYVA 3S82A 4LF9C 2YCBA 2VZEA 4JM1A 3UX2A 5BSVA 1NY8A 2CU6A 3AF6A 5E7QA 4PHTA 4DV6C 1ZB9A 2MM9A 2D1RA 5BSRA 1NYEA 4KHPC 2CY1A 4YY3C 3PROC 1M6XC 1AMUA 3R9WA 2PROA 2P2QA 4FTFA 4DCUA 4OX9C 2DPLA 4NDNA 1FLOA 5A1GA 3VNSA 1USPA 4DV1C 1UKKA 2Y4NA 4FUTA 3FM7A 1IBKC 2QW0X 4R1MA 4PUHA 2P20A 3L95X 3GR1A 4DUYC 3LUSA 1XDXA 3IEVA 3NPDA 1BA3A 3L8CA 2Z51A 3ETCA 4B3MC 3G7SA 2PN2A 4X66C 5K85A 1ZB8A 4LE5A 5BURA 1T5DX 3J81D 3UOWA 2BJOA 4JI1C 1J5EC 2DHMA 3PBKA 5H9UA 3VNQA 1N2FA 2YWBA 2JMPA 1MXBA 1XRCA 4JV5C 2OO4A 2ZM6C 3A9VA 3UZ0A 1EGAA 5LMUC 4JI8C 4YHHC 4JI4C 3R44A 2P2MA 2D28C 3CJEA 4X64C 1XMOC 3I08A 5IFIA 4LF4C 4IR7A 5LCIA 2KZ0A 1O90A 2E0GA 1USPB 1WF3A 1XS3A 3FCCA 4X62C 2ZZMA 4DR2C 4GKKC 3LNOA 3IMLA 2P2JA 2KDNA 5BSMA 5DV9A 4DR7C 3J7AD 2WD9A 4G36A 2AYAA 4DCSA 4L4QA 2E8EA 4PUIA 4B3TC 4U5YD 5JRHA 2P2FA 2PT7G 1MKYA 4AQYC 5AE3A 5GTDA 3E7XA 1UWDA 4HPVA 5IT9D 5T8TA 2VSQA 2UUAC 4B3SC 1HNZC 4L2ZA 2YX1A 4DR1C 3O2EA 1YGTA 1GPMA 3RG2A 4G1IA 2DYJA 1MXCA 4DR5C 2JNVA 1XNRC 2D27A 1HNXC 1FUGA 2UUBC 3RV2A 4L7IA 3EQ6A 2HJGA 5CZVA 4JI6C 3LNVA 4NXMC 1N33C 1KKGA 3T1YC 3UX3A 4DV2C 1L2FA 4LF6C 5BR8C 1MD9A 3TR3A 3I07A 5LMNC 3CQ1A 4D4GA 4RLFA 4ODJA 4GKJC 1VEHA 4BBYA 4DV3C 2CXCA 5BSTA 1M6XA 4LFCC 4R1LA 2D1QA 3DLPX 1JOSA 4I9FA 4TPSB 4BC7A 1PG4A 2F4VC 1XNQC 2UU9C 3DHVA 1XRAA 1YJ7A 4DR4C 4DCVA 1V26A 4PROC 2BH1X 4R0MA 1V25A 3B7WA 3K6RA 2UXBC 3TQIA 2EGTA 4NOZA 1WH9A 2YWCA 1RY2A 2VQEC 1VLAA 2ASBA 1WCJA 4BC9A 1O92A 4MH4A 2V7BA 5FLXD 4DG9A 1K0RA 2WP0C 2E7GA 3GKUA 1MDBA 4KTVA 3C5EA 1PA4A 2D1TA 3KXWA 4DG8A 1HH2P 3UEBA 4WV3A 2ZTBA 3GR0A 1N34C 2E5LC 4D56A 4BSZA 1MXAA 1RG9A 1XHJA 4OXIA 4D57A 2ZZNA 4OYCA 4ISBA 4EATA 4GXRA 2QVXX 1QWIA 2OPLA 4RVNA 4LF7C 2OBVA 3FCEA 4KTTA 3E7WA 5T8SA 3NYQA 3TUFA 4LF8C 5A2QD 4MTNA 4DV4C 2UXCC 3LGXA 3EERA 3IPLA 4JI5C 1XRBA 4PZPA 5AE1A 2UXDC 1N32C 5IWAC 1XMQC 1T5HX 2D1SA 2QVYX 4K0KC 4RMNA 4DV7C 4GS5A 3J80D 1TH5A 3H2TA 3ETOA 4WS9A 4NXNC 3A25A 4LF5C 3AY0A 2XR1A 2MMAB 5BUSA 2M5HA 2P2BA 1V60A 3CW8X 4LFBC 4JI3C 3GPCA 4XX2A 4I9GA 3CQ2A 3DAYA 3NYRA 3T1HC 2PG1E 1I94C 5AE2A 1P4EA 4K0BA 3IEUA
chains in the Genus database with same CATH topology
4RM2A 1ULTA 3JAMD 4FUQA 3SO4A 5KEIA 4B3RC 1IBLC 1IBMC 1LQLA 4JI0C 4IZ6A 4G37A 5BUQA 1O9TA 3LAXA 4GXQA 4D4IA 2Y4OA 2VQFC 3CW9A 2OPLB 1PG3A 2D7VA 2QL8A 2Y27A 2E8FA 3A4IA 1ML8A 1QM4A 2HHHC 4RM3A 1HR0C 1P7LA 4JI2C 3NI2A 3PESA 4DUZC 1O93A 5ADZA 2ONFA 4RVOA 2ATWA 3R9XA 4DV0C 5BSWA 3TDEA 2KZFA 5A19A 4X65C 5CZXA 4ZJZA 3OTOC 4DR6C 3VNRA 4RLQA 2QVZX 4ZLPA 3N54B 2E8CA 3A9UA 5A1IA 5BSUA 2UUCC 4JYAC 2P02A 4BCAA 4JI7C 1MDFA 4DR3C 4DV5C 1N36C 5K8FA 4DCTA 1HNWC 1LCIA 3N2QA 4LFAC 3AF5A 5KYTA 1FJGC 5KYVA 3S82A 4LF9C 2YCBA 2VZEA 4JM1A 5BSVA 3AF6A 5E7QA 4PHTA 4DV6C 1ZB9A 2D1RA 5BSRA 1NYEA 4KHPC 2CY1A 4YY3C 3PROC 1AMUA 3R9WA 2PROA 2P2QA 4FTFA 4DCUA 4OX9C 2DPLA 4NDNA 5A1GA 3VNSA 1USPA 4DV1C 1UKKA 2Y4NA 4FUTA 1IBKC 2QW0X 4R1MA 2P20A 3L95X 3GR1A 4DUYC 3LUSA 3IEVA 3NPDA 1BA3A 3L8CA 3ETCA 4B3MC 3G7SA 2PN2A 4X66C 5K85A 1ZB8A 4LE5A 5BURA 1T5DX 3J81D 3UOWA 2BJOA 4JI1C 1J5EC 3PBKA 5H9UA 3VNQA 1N2FA 2YWBA 2JMPA 1MXBA 1XRCA 4JV5C 2OO4A 2ZM6C 3A9VA 3UZ0A 1EGAA 5LMUC 4JI8C 4YHHC 4JI4C 3R44A 2P2MA 2D28C 3CJEA 4X64C 1XMOC 3I08A 5IFIA 4LF4C 4IR7A 1O90A 2E0GA 1USPB 1WF3A 3FCCA 4X62C 4DR2C 4GKKC 3IMLA 2P2JA 5BSMA 5DV9A 4DR7C 3J7AD 2WD9A 4G36A 2AYAA 4DCSA 4L4QA 2E8EA 4B3TC 4U5YD 5JRHA 2P2FA 2PT7G 1MKYA 4AQYC 5AE3A 5GTDA 3E7XA 4HPVA 5IT9D 5T8TA 2VSQA 2UUAC 4B3SC 1HNZC 4L2ZA 4DR1C 1GPMA 3RG2A 4G1IA 2DYJA 1MXCA 4DR5C 1XNRC 2D27A 1HNXC 1FUGA 2UUBC 3RV2A 4L7IA 3EQ6A 2HJGA 5CZVA 4JI6C 3LNVA 4NXMC 1N33C 1KKGA 3T1YC 4DV2C 1L2FA 4LF6C 5BR8C 1MD9A 3I07A 5LMNC 4D4GA 4RLFA 4ODJA 4GKJC 4BBYA 4DV3C 2CXCA 5BSTA 4LFCC 4R1LA 2D1QA 3DLPX 1JOSA 4I9FA 4TPSB 4BC7A 1PG4A 2F4VC 1XNQC 2UU9C 3DHVA 1XRAA 1YJ7A 4DR4C 4DCVA 1V26A 4PROC 2BH1X 4R0MA 1V25A 3B7WA 2UXBC 3TQIA 2EGTA 4NOZA 1WH9A 2YWCA 1RY2A 2VQEC 1VLAA 2ASBA 4BC9A 1O92A 4MH4A 2V7BA 5FLXD 4DG9A 1K0RA 2WP0C 2E7GA 3GKUA 1MDBA 4KTVA 3C5EA 1PA4A 2D1TA 3KXWA 4DG8A 1HH2P 4WV3A 3GR0A 1N34C 2E5LC 4D56A 4BSZA 1MXAA 1RG9A 4OXIA 4D57A 4OYCA 4ISBA 4EATA 4GXRA 2QVXX 1QWIA 2OPLA 4RVNA 4LF7C 2OBVA 3FCEA 4KTTA 3E7WA 5T8SA 3NYQA 3TUFA 4LF8C 5A2QD 4MTNA 4DV4C 2UXCC 3LGXA 3EERA 3IPLA 4JI5C 1XRBA 4PZPA 5AE1A 2UXDC 1N32C 5IWAC 1XMQC 1T5HX 2D1SA 2QVYX 4K0KC 4RMNA 4DV7C 4GS5A 3J80D 3H2TA 3ETOA 4WS9A 4NXNC 4LF5C 2XR1A 5BUSA 2P2BA 3CW8X 4LFBC 4JI3C 3GPCA 4XX2A 4I9GA 3DAYA 3NYRA 3T1HC 1I94C 5AE2A 4K0BA 3IEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH4 A;  2PT7 G;  3JAM D;  1MKY A;  1UKK A;  4AQY C;  5FLX D;  1IBK C;  4B3R C;  1K0R A;  1IBL C;  1IBM C;  1LQL A;  4DUY C;  2E7G A;  5IT9 D;  3GKU A;  3LUS A;  2UUA C;  4JI0 C;  3IEV A;  4B3S C;  1HNZ C;  1PA4 A;  4DR1 C;  4B3M C;  1HH2 P;  2VQF C;  2OPL B;  2DYJ A;  4DR5 C;  2D7V A;  2PN2 A;  4X66 C;  2QL8 A;  1ZB8 A;  2E8F A;  1XNR C;  1N34 C;  2E5L C;  1HNX C;  3J81 D;  4BSZ A;  2UUB C;  1ML8 A;  2BJO A;  4JI1 C;  2HHH C;  1J5E C;  1HR0 C;  2HJG A;  4JI2 C;  4DUZ C;  4JI6 C;  4NXM C;  1QWI A;  2OPL A;  4LF7 C;  2ONF A;  2ATW A;  3R9X A;  1N33 C;  1KKG A;  1N2F A;  2JMP A;  3T1Y C;  4DV2 C;  1L2F A;  4LF6 C;  5BR8 C;  4DV0 C;  4JV5 C;  2ZM6 C;  2KZF A;  4X65 C;  3I07 A;  3OTO C;  1EGA A;  5LMN C;  4DR6 C;  4LF8 C;  5A2Q D;  5LMU C;  4JI8 C;  4YHH C;  4MTN A;  4DV4 C;  2UXC C;  4JI4 C;  3EER A;  2E8C A;  4GKJ C;  4JI5 C;  2UUC C;  4DV3 C;  4JYA C;  2UXD C;  1N32 C;  3CJE A;  5IWA C;  4X64 C;  2CXC A;  1XMQ C;  4JI7 C;  4LFC C;  4K0K C;  4DV7 C;  1XMO C;  4DR3 C;  4DV5 C;  3J80 D;  1JOS A;  1N36 C;  4NXN C;  4LF5 C;  4DCT A;  2XR1 A;  4LF4 C;  1HNW C;  4LFA C;  3AF5 A;  1USP B;  1FJG C;  4LF9 C;  2YCB A;  1WF3 A;  4X62 C;  4LFB C;  2F4V C;  1XNQ C;  4DR2 C;  2UU9 C;  4GKK C;  4JI3 C;  3AF6 A;  4DV6 C;  4XX2 A;  1ZB9 A;  4DR4 C;  4DCV A;  1NYE A;  4DR7 C;  3J7A D;  4KHP C;  2CY1 A;  4YY3 C;  3T1H C;  2UXB C;  4DCS A;  3R9W A;  2EGT A;  1I94 C;  4NOZ A;  1WH9 A;  2E8E A;  4B3T C;  4DCU A;  4OX9 C;  3IEU A;  2VQE C;  1VLA A;  2ASB A;  1USP A;  4DV1 C; 
#chains in the Genus database with same CATH topology
 4RM2 A;  1ULT A;  3JAM D;  4FUQ A;  3SO4 A;  1IB8 A;  2MCQ A;  5KEI A;  4B3R C;  3CQ3 A;  1IBL C;  1IBM C;  1LQL A;  4JI0 C;  4IZ6 A;  4G37 A;  5BUQ A;  1O9T A;  3LAX A;  4GXQ A;  4D4I A;  2M5O A;  2Y4O A;  2VQF C;  3CW9 A;  2OPL B;  1PG3 A;  2D7V A;  2QL8 A;  2Y27 A;  2E8F A;  3A4I A;  1ML8 A;  1QM4 A;  2HHH C;  4RM3 A;  1HR0 C;  1P7L A;  4JI2 C;  3A26 A;  3NI2 A;  3PES A;  4DUZ C;  1O93 A;  5ADZ A;  2ONF A;  4RVO A;  2ATW A;  3R9X A;  4DV0 C;  5BSW A;  3TDE A;  1P4E C;  2KZF A;  5A19 A;  4X65 C;  5CZX A;  4ZJZ A;  3OTO C;  4DR6 C;  3VNR A;  4RLQ A;  2QVZ X;  4ZLP A;  3N54 B;  2E8C A;  3A9U A;  5A1I A;  5BSU A;  2UUC C;  4JYA C;  4PUG A;  1PU1 A;  2P02 A;  4BCA A;  4JI7 C;  1MDF A;  2NCL A;  4DR3 C;  4DV5 C;  1N36 C;  5K8F A;  4DCT A;  1HNW C;  1LCI A;  3N2Q A;  4LFA C;  3AF5 A;  5KYT A;  1FJG C;  5KYV A;  3S82 A;  4LF9 C;  2YCB A;  2VZE A;  4JM1 A;  3UX2 A;  5BSV A;  1NY8 A;  2CU6 A;  3AF6 A;  5E7Q A;  4PHT A;  4DV6 C;  1ZB9 A;  2MM9 A;  2D1R A;  5BSR A;  1NYE A;  4KHP C;  2CY1 A;  4YY3 C;  3PRO C;  1M6X C;  1AMU A;  3R9W A;  2PRO A;  2P2Q A;  4FTF A;  4DCU A;  4OX9 C;  2DPL A;  4NDN A;  1FLO A;  5A1G A;  3VNS A;  1USP A;  4DV1 C;  1UKK A;  2Y4N A;  4FUT A;  3FM7 A;  1IBK C;  2QW0 X;  4R1M A;  4PUH A;  2P20 A;  3L95 X;  3GR1 A;  4DUY C;  3LUS A;  1XDX A;  3IEV A;  3NPD A;  1BA3 A;  3L8C A;  2Z51 A;  3ETC A;  4B3M C;  3G7S A;  2PN2 A;  4X66 C;  5K85 A;  1ZB8 A;  4LE5 A;  5BUR A;  1T5D X;  3J81 D;  3UOW A;  2BJO A;  4JI1 C;  1J5E C;  2DHM A;  3PBK A;  5H9U A;  3VNQ A;  1N2F A;  2YWB A;  2JMP A;  1MXB A;  1XRC A;  4JV5 C;  2OO4 A;  2ZM6 C;  3A9V A;  3UZ0 A;  1EGA A;  5LMU C;  4JI8 C;  4YHH C;  4JI4 C;  3R44 A;  2P2M A;  2D28 C;  3CJE A;  4X64 C;  1XMO C;  3I08 A;  5IFI A;  4LF4 C;  4IR7 A;  5LCI A;  2KZ0 A;  1O90 A;  2E0G A;  1USP B;  1WF3 A;  1XS3 A;  3FCC A;  4X62 C;  2ZZM A;  4DR2 C;  4GKK C;  3LNO A;  3IML A;  2P2J A;  2KDN A;  5BSM A;  5DV9 A;  4DR7 C;  3J7A D;  2WD9 A;  4G36 A;  2AYA A;  4DCS A;  4L4Q A;  2E8E A;  4PUI A;  4B3T C;  4U5Y D;  5JRH A;  2P2F A;  2PT7 G;  1MKY A;  4AQY C;  5AE3 A;  5GTD A;  3E7X A;  1UWD A;  4HPV A;  5IT9 D;  5T8T A;  2VSQ A;  2UUA C;  4B3S C;  1HNZ C;  4L2Z A;  2YX1 A;  4DR1 C;  3O2E A;  1YGT A;  1GPM A;  3RG2 A;  4G1I A;  2DYJ A;  1MXC A;  4DR5 C;  2JNV A;  1XNR C;  2D27 A;  1HNX C;  1FUG A;  2UUB C;  3RV2 A;  4L7I A;  3EQ6 A;  2HJG A;  5CZV A;  4JI6 C;  3LNV A;  4NXM C;  1N33 C;  1KKG A;  3T1Y C;  3UX3 A;  4DV2 C;  1L2F A;  4LF6 C;  5BR8 C;  1MD9 A;  3TR3 A;  3I07 A;  5LMN C;  3CQ1 A;  4D4G A;  4RLF A;  4ODJ A;  4GKJ C;  1VEH A;  4BBY A;  4DV3 C;  2CXC A;  5BST A;  1M6X A;  4LFC C;  4R1L A;  2D1Q A;  3DLP X;  1JOS A;  4I9F A;  4TPS B;  4BC7 A;  1PG4 A;  2F4V C;  1XNQ C;  2UU9 C;  3DHV A;  1XRA A;  1YJ7 A;  4DR4 C;  4DCV A;  1V26 A;  4PRO C;  2BH1 X;  4R0M A;  1V25 A;  3B7W A;  3K6R A;  2UXB C;  3TQI A;  2EGT A;  4NOZ A;  1WH9 A;  2YWC A;  1RY2 A;  2VQE C;  1VLA A;  2ASB A;  1WCJ A;  4BC9 A;  1O92 A;  4MH4 A;  2V7B A;  5FLX D;  4DG9 A;  1K0R A;  2WP0 C;  2E7G A;  3GKU A;  1MDB A;  4KTV A;  3C5E A;  1PA4 A;  2D1T A;  3KXW A;  4DG8 A;  1HH2 P;  3UEB A;  4WV3 A;  2ZTB A;  3GR0 A;  1N34 C;  2E5L C;  4D56 A;  4BSZ A;  1MXA A;  1RG9 A;  1XHJ A;  4OXI A;  4D57 A;  2ZZN A;  4OYC A;  4ISB A;  4EAT A;  4GXR A;  2QVX X;  1QWI A;  2OPL A;  4RVN A;  4LF7 C;  2OBV A;  3FCE A;  4KTT A;  3E7W A;  5T8S A;  3NYQ A;  3TUF A;  4LF8 C;  5A2Q D;  4MTN A;  4DV4 C;  2UXC C;  3LGX A;  3EER A;  3IPL A;  4JI5 C;  1XRB A;  4PZP A;  5AE1 A;  2UXD C;  1N32 C;  5IWA C;  1XMQ C;  1T5H X;  2D1S A;  2QVY X;  4K0K C;  4RMN A;  4DV7 C;  4GS5 A;  3J80 D;  1TH5 A;  3H2T A;  3ETO A;  4WS9 A;  4NXN C;  3A25 A;  4LF5 C;  3AY0 A;  2XR1 A;  2MMA B;  5BUS A;  2M5H A;  2P2B A;  1V60 A;  3CW8 X;  4LFB C;  4JI3 C;  3GPC A;  4XX2 A;  4I9G A;  3CQ2 A;  3DAY A;  3NYR A;  3T1H C;  2PG1 E;  1I94 C;  5AE2 A;  1P4E A;  4K0B A;  3IEU A; 
#chains in the Genus database with same CATH homology
 4RM2 A;  1ULT A;  3JAM D;  4FUQ A;  3SO4 A;  5KEI A;  4B3R C;  1IBL C;  1IBM C;  1LQL A;  4JI0 C;  4IZ6 A;  4G37 A;  5BUQ A;  1O9T A;  3LAX A;  4GXQ A;  4D4I A;  2Y4O A;  2VQF C;  3CW9 A;  2OPL B;  1PG3 A;  2D7V A;  2QL8 A;  2Y27 A;  2E8F A;  3A4I A;  1ML8 A;  1QM4 A;  2HHH C;  4RM3 A;  1HR0 C;  1P7L A;  4JI2 C;  3NI2 A;  3PES A;  4DUZ C;  1O93 A;  5ADZ A;  2ONF A;  4RVO A;  2ATW A;  3R9X A;  4DV0 C;  5BSW A;  3TDE A;  2KZF A;  5A19 A;  4X65 C;  5CZX A;  4ZJZ A;  3OTO C;  4DR6 C;  3VNR A;  4RLQ A;  2QVZ X;  4ZLP A;  3N54 B;  2E8C A;  3A9U A;  5A1I A;  5BSU A;  2UUC C;  4JYA C;  2P02 A;  4BCA A;  4JI7 C;  1MDF A;  4DR3 C;  4DV5 C;  1N36 C;  5K8F A;  4DCT A;  1HNW C;  1LCI A;  3N2Q A;  4LFA C;  3AF5 A;  5KYT A;  1FJG C;  5KYV A;  3S82 A;  4LF9 C;  2YCB A;  2VZE A;  4JM1 A;  5BSV A;  3AF6 A;  5E7Q A;  4PHT A;  4DV6 C;  1ZB9 A;  2D1R A;  5BSR A;  1NYE A;  4KHP C;  2CY1 A;  4YY3 C;  3PRO C;  1AMU A;  3R9W A;  2PRO A;  2P2Q A;  4FTF A;  4DCU A;  4OX9 C;  2DPL A;  4NDN A;  5A1G A;  3VNS A;  1USP A;  4DV1 C;  1UKK A;  2Y4N A;  4FUT A;  1IBK C;  2QW0 X;  4R1M A;  2P20 A;  3L95 X;  3GR1 A;  4DUY C;  3LUS A;  3IEV A;  3NPD A;  1BA3 A;  3L8C A;  3ETC A;  4B3M C;  3G7S A;  2PN2 A;  4X66 C;  5K85 A;  1ZB8 A;  4LE5 A;  5BUR A;  1T5D X;  3J81 D;  3UOW A;  2BJO A;  4JI1 C;  1J5E C;  3PBK A;  5H9U A;  3VNQ A;  1N2F A;  2YWB A;  2JMP A;  1MXB A;  1XRC A;  4JV5 C;  2OO4 A;  2ZM6 C;  3A9V A;  3UZ0 A;  1EGA A;  5LMU C;  4JI8 C;  4YHH C;  4JI4 C;  3R44 A;  2P2M A;  2D28 C;  3CJE A;  4X64 C;  1XMO C;  3I08 A;  5IFI A;  4LF4 C;  4IR7 A;  1O90 A;  2E0G A;  1USP B;  1WF3 A;  3FCC A;  4X62 C;  4DR2 C;  4GKK C;  3IML A;  2P2J A;  5BSM A;  5DV9 A;  4DR7 C;  3J7A D;  2WD9 A;  4G36 A;  2AYA A;  4DCS A;  4L4Q A;  2E8E A;  4B3T C;  4U5Y D;  5JRH A;  2P2F A;  2PT7 G;  1MKY A;  4AQY C;  5AE3 A;  5GTD A;  3E7X A;  4HPV A;  5IT9 D;  5T8T A;  2VSQ A;  2UUA C;  4B3S C;  1HNZ C;  4L2Z A;  4DR1 C;  1GPM A;  3RG2 A;  4G1I A;  2DYJ A;  1MXC A;  4DR5 C;  1XNR C;  2D27 A;  1HNX C;  1FUG A;  2UUB C;  3RV2 A;  4L7I A;  3EQ6 A;  2HJG A;  5CZV A;  4JI6 C;  3LNV A;  4NXM C;  1N33 C;  1KKG A;  3T1Y C;  4DV2 C;  1L2F A;  4LF6 C;  5BR8 C;  1MD9 A;  3I07 A;  5LMN C;  4D4G A;  4RLF A;  4ODJ A;  4GKJ C;  4BBY A;  4DV3 C;  2CXC A;  5BST A;  4LFC C;  4R1L A;  2D1Q A;  3DLP X;  1JOS A;  4I9F A;  4TPS B;  4BC7 A;  1PG4 A;  2F4V C;  1XNQ C;  2UU9 C;  3DHV A;  1XRA A;  1YJ7 A;  4DR4 C;  4DCV A;  1V26 A;  4PRO C;  2BH1 X;  4R0M A;  1V25 A;  3B7W A;  2UXB C;  3TQI A;  2EGT A;  4NOZ A;  1WH9 A;  2YWC A;  1RY2 A;  2VQE C;  1VLA A;  2ASB A;  4BC9 A;  1O92 A;  4MH4 A;  2V7B A;  5FLX D;  4DG9 A;  1K0R A;  2WP0 C;  2E7G A;  3GKU A;  1MDB A;  4KTV A;  3C5E A;  1PA4 A;  2D1T A;  3KXW A;  4DG8 A;  1HH2 P;  4WV3 A;  3GR0 A;  1N34 C;  2E5L C;  4D56 A;  4BSZ A;  1MXA A;  1RG9 A;  4OXI A;  4D57 A;  4OYC A;  4ISB A;  4EAT A;  4GXR A;  2QVX X;  1QWI A;  2OPL A;  4RVN A;  4LF7 C;  2OBV A;  3FCE A;  4KTT A;  3E7W A;  5T8S A;  3NYQ A;  3TUF A;  4LF8 C;  5A2Q D;  4MTN A;  4DV4 C;  2UXC C;  3LGX A;  3EER A;  3IPL A;  4JI5 C;  1XRB A;  4PZP A;  5AE1 A;  2UXD C;  1N32 C;  5IWA C;  1XMQ C;  1T5H X;  2D1S A;  2QVY X;  4K0K C;  4RMN A;  4DV7 C;  4GS5 A;  3J80 D;  3H2T A;  3ETO A;  4WS9 A;  4NXN C;  4LF5 C;  2XR1 A;  5BUS A;  2P2B A;  3CW8 X;  4LFB C;  4JI3 C;  3GPC A;  4XX2 A;  4I9G A;  3DAY A;  3NYR A;  3T1H C;  1I94 C;  5AE2 A;  4K0B A;  3IEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...