1N32C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n32C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n32C02
5BR8C 2BJOA 4YHHC 4LF6C 1HNWC 1N33C 1ZB8A 1K0RA 2ATWA 4JI3C 5A2QD 4B3MC 4NXNC 4DV2C 4X66C 4LFAC 4JV5C 1N36C 4MTNA 2ZM6C 1HR0C 2E5LC 3IEUA 4LF7C 2OPLA 4DV4C 2OPLB 1VLAA 2PT7G 3T1YC 1ML8A 3AF5A 2E8CA 1ZB9A 1USPB 4DV1C 3JAMD 3GKUA 3T1HC 2E7GA 2CY1A 1N34C 1EGAA 4LF5C 1IBLC 1NYEA 4DUYC 2E8EA 2VQFC 5LMUC 2UU9C 4LFBC 1QWIA 4DV7C 4NOZA 5IT9D 4X64C 4B3RC 2UUBC 1XNQC 4JI7C 4LFCC 3CJEA 2UXCC 1WF3A 1JOSA 2HHHC 2JMPA 3OTOC 1UKKA 3I07A 4DV0C 2D7VA 4DV3C 4DR2C 1I94C 4LF9C 4JI4C 4JI8C 4DR4C 4DR7C 1MKYA 4DR1C 1FJGC 3R9XA 4GKKC 4OX9C 3J7AD 4B3TC 2XR1A 4JI1C 1L2FA 1WH9A 2F4VC 4DCVA 4DV5C 2HJGA 2PN2A 4JI2C 4DV6C 4MH4A 1XMQC 4JYAC 1N32C 1HH2P 4XX2A 4BSZA 1HNXC 4LF8C 2E8FA 4LF4C 4KHPC 2CXCA 2KZFA 4B3SC 3IEVA 4DCUA 3LUSA 3R9WA 3AF6A 1LQLA 2EGTA 2YCBA 1USPA 4AQYC 4DR3C 4JI5C 2ASBA 1N2FA 1PA4A 4YY3C 2UXBC 1J5EC 1IBMC 3J80D 4JI6C 1KKGA 3J81D 4X65C 4JI0C 4DUZC 4DR6C 5FLXD 5LMNC 1IBKC 1XMOC 2UUAC 2DYJA 4NXMC 4DR5C 4DCTA 1HNZC 4GKJC 3EERA 2UUCC 5IWAC 2VQEC 4DCSA 1XNRC 2UXDC 4X62C 2ONFA 2QL8A 4K0KC
chains in the Genus database with same CATH superfamily
4LF6C 1ZB8A 2ATWA 4I9GA 3DLPX 4I9FA 3AY0A 3DHVA 1N36C 4LF7C 2E5LC 1BA3A 1V25A 2P2JA 5BSVA 4HPVA 5A19A 1VLAA 3A26A 3KXWA 3B7WA 3PBKA 3JAMD 3GKUA 4RVNA 5BURA 4PUIA 2CY1A 3FM7A 3NI2A 1RG9A 2D1QA 2M5OA 4KTVA 5KYTA 1IBLC 5BSTA 2E8EA 5LMUC 4NOZA 4X64C 3TQIA 3RV2A 2UUBC 4JI7C 2QW0X 4LFCC 3CJEA 1FLOA 1XRBA 3A9VA 3OTOC 1PG4A 3A4IA 5K85A 5AE1A 3L8CA 1P4EA 5DV9A 4DR1C 1MXBA 1RY2A 3EQ6A 4L2ZA 2MMAB 3GPCA 4R0MA 1L2FA 1WH9A 3FCCA 4NDNA 3CQ3A 2JNVA 3E7XA 2D1RA 4XX2A 1VEHA 3LGXA 3LNVA 2KZFA 4D57A 3UX3A 5A1IA 1LQLA 2YCBA 3LNOA 4D4IA 2ASBA 4G36A 5FLXD 5LMNC 4KTTA 4DCTA 3G7SA 3UZ0A 4BC7A 5E7QA 4K0KC 2BJOA 4RVOA 4G37A 4JI3C 5A2QD 1T5DX 4DV2C 1HR0C 5T8TA 3H2TA 1YGTA 2PT7G 2VZEA 4DG9A 5BUSA 5GTDA 5BSRA 4DUYC 4U5YD 3UEBA 3A25A 2Z51A 1QWIA 4IZ6A 4FUTA 4B3RC 4ZLPA 3VNRA 1O90A 4OXIA 4ISBA 1IB8A 1WF3A 1TH5A 3NYQA 4WS9A 2DHMA 4DV0C 2VSQA 3S82A 3R44A 4JI8C 4DR4C 1MKYA 4PZPA 4GKKC 1QM4A 5IFIA 4B3TC 2XR1A 4JI1C 2OBVA 3I08A 1LCIA 4FTFA 4IR7A 4MH4A 4JYAC 1N32C 3PESA 2QVYX 4RM3A 1ULTA 1MXAA 4LF4C 5JRHA 3O2EA 2EGTA 5BUQA 4R1MA 2E0GA 3TR3A 4RMNA 2ZTBA 2BH1X 1J5EC 1M6XC 3J81D 4DUZC 1AMUA 4PHTA 4D56A 1V60A 1XMOC 1GPMA 5CZVA 2DYJA 4BBYA 5AE3A 4DR5C 5CZXA 1HNZC 2UUCC 2P02A 3RG2A 4ZJZA 2UXDC 4X62C 1MDFA 2QVZX 5BR8C 4GXQA 1N33C 3VNSA 4NXNC 4ODJA 4B3MC 2ZM6C 4JM1A 2OPLA 4L7IA 4DV4C 3T1YC 1ML8A 1T5HX 2E8CA 1ZB9A 4EATA 1USPB 2P20A 4DG8A 2V7BA 4D4GA 2QVXX 3N2QA 3T1HC 5ADZA 4RLFA 2D1SA 1EGAA 4LF5C 4TPSB 1NYEA 1O92A 4RM2A 2KDNA 2WP0C 3CQ2A 3CW8X 2D27A 1PU1A 1O93A 1XNQC 3LAXA 2P2FA 1JOSA 4L4QA 2HHHC 2JMPA 1NY8A 3UOWA 1UKKA 3I07A 1XRAA 5BSWA 4LF9C 4JI4C 2OO4A 3DAYA 4G1IA 4PUGA 2P2MA 4GS5A 3R9XA 2MCQA 2P2QA 4DCVA 2HJGA 1XS3A 2PN2A 3E7WA 2AYAA 1XDXA 1MXCA 1HH2P 4BSZA 1MDBA 1HNXC 4LF8C 4KHPC 1P4EC 4B3SC 2CU6A 3R9WA 3AF6A 5BSMA 2Y4OA 1USPA 3FCEA 4JI5C 3K6RA 4R1LA 2PROA 1IBMC 4JI6C 3TDEA 1XHJA 4JI0C 4DR6C 3GR1A 2NCLA 3CQ1A 1IBKC 2UUAC 2KZ0A 2YX1A 4NXMC 4OYCA 1M6XA 3EERA 5IWAC 3SO4A 2VQEC 4BCAA 2QL8A 4YHHC 1HNWC 2D1TA 1K0RA 4X66C 4LFAC 4JV5C 5LCIA 4MTNA 3VNQA 3IEUA 3IPLA 2OPLB 3IMLA 3AF5A 4DV1C 2E7GA 2M5HA 4RLQA 1O9TA 3A9UA 2PG1E 1N34C 2Y4NA 3UX2A 3N54B 3C5EA 2VQFC 2UU9C 4LFBC 1P7LA 4DV7C 5IT9D 5BSUA 4GXRA 4FUQA 1FUGA 4PROC 2UXCC 1WCJA 5T8SA 2MM9A 2WD9A 5K8FA 5AE2A 1XRCA 2D7VA 4DV3C 4DR2C 1I94C 4DR7C 1V26A 5KYVA 3CW9A 1FJGC 2Y27A 4OX9C 3J7AD 2F4VC 4DV5C 5A1GA 3L95X 4DV6C 4JI2C 2ZZNA 3PROC 1XMQC 3ETOA 4PUHA 2YWBA 1PG3A 3ETCA 2E8FA 2CXCA 4LE5A 3IEVA 4DCUA 3LUSA 4WV3A 4AQYC 4K0BA 2DPLA 4DR3C 3NPDA 2YWCA 1N2FA 1PA4A 4YY3C 2UXBC 3J80D 1KKGA 2ZZMA 1UWDA 3GR0A 4X65C 1MD9A 4GKJC 3TUFA 3NYRA 5KEIA 2P2BA 4DCSA 1XNRC 1YJ7A 4BC9A 5H9UA 2ONFA 2D28C
chains in the Genus database with same CATH topology
4LF6C 1ZB8A 2ATWA 4I9GA 3DLPX 4I9FA 3DHVA 1N36C 4LF7C 2E5LC 1BA3A 1V25A 2P2JA 5BSVA 4HPVA 5A19A 1VLAA 3KXWA 3B7WA 3PBKA 3JAMD 3GKUA 4RVNA 5BURA 2CY1A 3NI2A 1RG9A 2D1QA 4KTVA 5KYTA 1IBLC 5BSTA 2E8EA 5LMUC 4NOZA 4X64C 3TQIA 3RV2A 2UUBC 4JI7C 2QW0X 4LFCC 3CJEA 1XRBA 3A9VA 3OTOC 1PG4A 3A4IA 5K85A 5AE1A 3L8CA 5DV9A 3EQ6A 1MXBA 1RY2A 4L2ZA 4DR1C 3GPCA 4R0MA 1L2FA 1WH9A 3FCCA 4NDNA 3E7XA 2D1RA 4XX2A 3LGXA 3LNVA 2KZFA 4D57A 5A1IA 1LQLA 2YCBA 4D4IA 2ASBA 4G36A 5FLXD 5LMNC 4KTTA 4DCTA 3G7SA 3UZ0A 4BC7A 5E7QA 4K0KC 2BJOA 4RVOA 4G37A 4JI3C 5A2QD 1T5DX 4DV2C 1HR0C 5T8TA 3H2TA 2PT7G 2VZEA 4DG9A 5BUSA 5GTDA 5BSRA 4DUYC 4U5YD 1QWIA 4IZ6A 4FUTA 4B3RC 4ZLPA 3VNRA 1O90A 4OXIA 4ISBA 1WF3A 3NYQA 4WS9A 4DV0C 2VSQA 3S82A 3R44A 4JI8C 4DR4C 1MKYA 4PZPA 4GKKC 1QM4A 5IFIA 4B3TC 2XR1A 4JI1C 2OBVA 3I08A 1LCIA 4FTFA 4IR7A 4MH4A 4JYAC 1N32C 3PESA 2QVYX 4RM3A 1ULTA 1MXAA 4LF4C 5JRHA 2EGTA 5BUQA 4R1MA 2E0GA 4RMNA 2BH1X 1J5EC 3J81D 4DUZC 1AMUA 4PHTA 4D56A 1XMOC 1GPMA 5CZVA 2DYJA 4BBYA 5AE3A 4DR5C 5CZXA 1HNZC 2UUCC 2P02A 3RG2A 4ZJZA 2UXDC 4X62C 1MDFA 2QVZX 5BR8C 4GXQA 1N33C 3VNSA 4NXNC 4ODJA 4B3MC 2ZM6C 4JM1A 2OPLA 4L7IA 4DV4C 3T1YC 1ML8A 1T5HX 2E8CA 1ZB9A 4EATA 1USPB 2P20A 4DG8A 2V7BA 4D4GA 2QVXX 3N2QA 3T1HC 5ADZA 4RLFA 2D1SA 1EGAA 4LF5C 4TPSB 1NYEA 1O92A 4RM2A 2WP0C 3CW8X 2D27A 1O93A 1XNQC 3LAXA 2P2FA 1JOSA 4L4QA 2HHHC 2JMPA 3UOWA 1UKKA 3I07A 1XRAA 5BSWA 4LF9C 4JI4C 2OO4A 3DAYA 4G1IA 2P2MA 4GS5A 3R9XA 2P2QA 4DCVA 2HJGA 2PN2A 3E7WA 2AYAA 1MXCA 1HH2P 4BSZA 1MDBA 1HNXC 4LF8C 4KHPC 4B3SC 3R9WA 3AF6A 5BSMA 2Y4OA 1USPA 3FCEA 4JI5C 4R1LA 2PROA 1IBMC 4JI6C 3TDEA 4JI0C 4DR6C 3GR1A 1IBKC 2UUAC 4NXMC 4OYCA 3EERA 5IWAC 3SO4A 2VQEC 4BCAA 2QL8A 4YHHC 1HNWC 2D1TA 1K0RA 4X66C 4LFAC 4JV5C 4MTNA 3VNQA 3IEUA 3IPLA 2OPLB 3IMLA 3AF5A 4DV1C 2E7GA 4RLQA 1O9TA 3A9UA 1N34C 2Y4NA 3N54B 3C5EA 2VQFC 2UU9C 4LFBC 1P7LA 4DV7C 5IT9D 5BSUA 4GXRA 4FUQA 1FUGA 4PROC 2UXCC 5T8SA 2WD9A 5K8FA 5AE2A 1XRCA 2D7VA 4DV3C 4DR2C 1I94C 4DR7C 1V26A 5KYVA 3CW9A 1FJGC 4OX9C 2Y27A 3J7AD 2F4VC 4DV5C 5A1GA 3L95X 4DV6C 4JI2C 3PROC 1XMQC 3ETOA 2YWBA 1PG3A 3ETCA 2E8FA 2CXCA 4LE5A 3IEVA 4DCUA 3LUSA 4WV3A 4AQYC 4K0BA 2DPLA 4DR3C 3NPDA 2YWCA 1N2FA 1PA4A 4YY3C 2UXBC 3J80D 1KKGA 3GR0A 4X65C 1MD9A 4GKJC 3TUFA 3NYRA 5KEIA 2P2BA 4DCSA 1XNRC 1YJ7A 4BC9A 5H9UA 2ONFA 2D28C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 C;  2BJO A;  4YHH C;  4LF6 C;  1HNW C;  1N33 C;  1ZB8 A;  1K0R A;  2ATW A;  4JI3 C;  5A2Q D;  4B3M C;  4NXN C;  4DV2 C;  4X66 C;  4LFA C;  4JV5 C;  1N36 C;  4MTN A;  2ZM6 C;  1HR0 C;  2E5L C;  3IEU A;  4LF7 C;  2OPL A;  4DV4 C;  2OPL B;  1VLA A;  2PT7 G;  3T1Y C;  1ML8 A;  3AF5 A;  2E8C A;  1ZB9 A;  1USP B;  4DV1 C;  3JAM D;  3GKU A;  3T1H C;  2E7G A;  2CY1 A;  1N34 C;  1EGA A;  4LF5 C;  1IBL C;  1NYE A;  4DUY C;  2E8E A;  2VQF C;  5LMU C;  2UU9 C;  4LFB C;  1QWI A;  4DV7 C;  4NOZ A;  5IT9 D;  4X64 C;  4B3R C;  2UUB C;  1XNQ C;  4JI7 C;  4LFC C;  3CJE A;  2UXC C;  1WF3 A;  1JOS A;  2HHH C;  2JMP A;  3OTO C;  1UKK A;  3I07 A;  4DV0 C;  2D7V A;  4DV3 C;  4DR2 C;  1I94 C;  4LF9 C;  4JI4 C;  4JI8 C;  4DR4 C;  4DR7 C;  1MKY A;  4DR1 C;  1FJG C;  3R9X A;  4GKK C;  4OX9 C;  3J7A D;  4B3T C;  2XR1 A;  4JI1 C;  1L2F A;  1WH9 A;  2F4V C;  4DCV A;  4DV5 C;  2HJG A;  2PN2 A;  4JI2 C;  4DV6 C;  4MH4 A;  1XMQ C;  4JYA C;  1N32 C;  1HH2 P;  4XX2 A;  4BSZ A;  1HNX C;  4LF8 C;  2E8F A;  4LF4 C;  4KHP C;  2CXC A;  2KZF A;  4B3S C;  3IEV A;  4DCU A;  3LUS A;  3R9W A;  3AF6 A;  1LQL A;  2EGT A;  2YCB A;  1USP A;  4AQY C;  4DR3 C;  4JI5 C;  2ASB A;  1N2F A;  1PA4 A;  4YY3 C;  2UXB C;  1J5E C;  1IBM C;  3J80 D;  4JI6 C;  1KKG A;  3J81 D;  4X65 C;  4JI0 C;  4DUZ C;  4DR6 C;  5FLX D;  5LMN C;  1IBK C;  1XMO C;  2UUA C;  2DYJ A;  4NXM C;  4DR5 C;  4DCT A;  1HNZ C;  4GKJ C;  3EER A;  2UUC C;  5IWA C;  2VQE C;  4DCS A;  1XNR C;  2UXD C;  4X62 C;  2ONF A;  2QL8 A;  4K0K C; 
#chains in the Genus database with same CATH topology
 4LF6 C;  1ZB8 A;  2ATW A;  4I9G A;  3DLP X;  4I9F A;  3AY0 A;  3DHV A;  1N36 C;  4LF7 C;  2E5L C;  1BA3 A;  1V25 A;  2P2J A;  5BSV A;  4HPV A;  5A19 A;  1VLA A;  3A26 A;  3KXW A;  3B7W A;  3PBK A;  3JAM D;  3GKU A;  4RVN A;  5BUR A;  4PUI A;  2CY1 A;  3FM7 A;  3NI2 A;  1RG9 A;  2D1Q A;  2M5O A;  4KTV A;  5KYT A;  1IBL C;  5BST A;  2E8E A;  5LMU C;  4NOZ A;  4X64 C;  3TQI A;  3RV2 A;  2UUB C;  4JI7 C;  2QW0 X;  4LFC C;  3CJE A;  1FLO A;  1XRB A;  3A9V A;  3OTO C;  1PG4 A;  3A4I A;  5K85 A;  5AE1 A;  3L8C A;  1P4E A;  5DV9 A;  4DR1 C;  1MXB A;  1RY2 A;  3EQ6 A;  4L2Z A;  2MMA B;  3GPC A;  4R0M A;  1L2F A;  1WH9 A;  3FCC A;  4NDN A;  3CQ3 A;  2JNV A;  3E7X A;  2D1R A;  4XX2 A;  1VEH A;  3LGX A;  3LNV A;  2KZF A;  4D57 A;  3UX3 A;  5A1I A;  1LQL A;  2YCB A;  3LNO A;  4D4I A;  2ASB A;  4G36 A;  5FLX D;  5LMN C;  4KTT A;  4DCT A;  3G7S A;  3UZ0 A;  4BC7 A;  5E7Q A;  4K0K C;  2BJO A;  4RVO A;  4G37 A;  4JI3 C;  5A2Q D;  1T5D X;  4DV2 C;  1HR0 C;  5T8T A;  3H2T A;  1YGT A;  2PT7 G;  2VZE A;  4DG9 A;  5BUS A;  5GTD A;  5BSR A;  4DUY C;  4U5Y D;  3UEB A;  3A25 A;  2Z51 A;  1QWI A;  4IZ6 A;  4FUT A;  4B3R C;  4ZLP A;  3VNR A;  1O90 A;  4OXI A;  4ISB A;  1IB8 A;  1WF3 A;  1TH5 A;  3NYQ A;  4WS9 A;  2DHM A;  4DV0 C;  2VSQ A;  3S82 A;  3R44 A;  4JI8 C;  4DR4 C;  1MKY A;  4PZP A;  4GKK C;  1QM4 A;  5IFI A;  4B3T C;  2XR1 A;  4JI1 C;  2OBV A;  3I08 A;  1LCI A;  4FTF A;  4IR7 A;  4MH4 A;  4JYA C;  1N32 C;  3PES A;  2QVY X;  4RM3 A;  1ULT A;  1MXA A;  4LF4 C;  5JRH A;  3O2E A;  2EGT A;  5BUQ A;  4R1M A;  2E0G A;  3TR3 A;  4RMN A;  2ZTB A;  2BH1 X;  1J5E C;  1M6X C;  3J81 D;  4DUZ C;  1AMU A;  4PHT A;  4D56 A;  1V60 A;  1XMO C;  1GPM A;  5CZV A;  2DYJ A;  4BBY A;  5AE3 A;  4DR5 C;  5CZX A;  1HNZ C;  2UUC C;  2P02 A;  3RG2 A;  4ZJZ A;  2UXD C;  4X62 C;  1MDF A;  2QVZ X;  5BR8 C;  4GXQ A;  1N33 C;  3VNS A;  4NXN C;  4ODJ A;  4B3M C;  2ZM6 C;  4JM1 A;  2OPL A;  4L7I A;  4DV4 C;  3T1Y C;  1ML8 A;  1T5H X;  2E8C A;  1ZB9 A;  4EAT A;  1USP B;  2P20 A;  4DG8 A;  2V7B A;  4D4G A;  2QVX X;  3N2Q A;  3T1H C;  5ADZ A;  4RLF A;  2D1S A;  1EGA A;  4LF5 C;  4TPS B;  1NYE A;  1O92 A;  4RM2 A;  2KDN A;  2WP0 C;  3CQ2 A;  3CW8 X;  2D27 A;  1PU1 A;  1O93 A;  1XNQ C;  3LAX A;  2P2F A;  1JOS A;  4L4Q A;  2HHH C;  2JMP A;  1NY8 A;  3UOW A;  1UKK A;  3I07 A;  1XRA A;  5BSW A;  4LF9 C;  4JI4 C;  2OO4 A;  3DAY A;  4G1I A;  4PUG A;  2P2M A;  4GS5 A;  3R9X A;  2MCQ A;  2P2Q A;  4DCV A;  2HJG A;  1XS3 A;  2PN2 A;  3E7W A;  2AYA A;  1XDX A;  1MXC A;  1HH2 P;  4BSZ A;  1MDB A;  1HNX C;  4LF8 C;  4KHP C;  1P4E C;  4B3S C;  2CU6 A;  3R9W A;  3AF6 A;  5BSM A;  2Y4O A;  1USP A;  3FCE A;  4JI5 C;  3K6R A;  4R1L A;  2PRO A;  1IBM C;  4JI6 C;  3TDE A;  1XHJ A;  4JI0 C;  4DR6 C;  3GR1 A;  2NCL A;  3CQ1 A;  1IBK C;  2UUA C;  2KZ0 A;  2YX1 A;  4NXM C;  4OYC A;  1M6X A;  3EER A;  5IWA C;  3SO4 A;  2VQE C;  4BCA A;  2QL8 A;  4YHH C;  1HNW C;  2D1T A;  1K0R A;  4X66 C;  4LFA C;  4JV5 C;  5LCI A;  4MTN A;  3VNQ A;  3IEU A;  3IPL A;  2OPL B;  3IML A;  3AF5 A;  4DV1 C;  2E7G A;  2M5H A;  4RLQ A;  1O9T A;  3A9U A;  2PG1 E;  1N34 C;  2Y4N A;  3UX2 A;  3N54 B;  3C5E A;  2VQF C;  2UU9 C;  4LFB C;  1P7L A;  4DV7 C;  5IT9 D;  5BSU A;  4GXR A;  4FUQ A;  1FUG A;  4PRO C;  2UXC C;  1WCJ A;  5T8S A;  2MM9 A;  2WD9 A;  5K8F A;  5AE2 A;  1XRC A;  2D7V A;  4DV3 C;  4DR2 C;  1I94 C;  4DR7 C;  1V26 A;  5KYV A;  3CW9 A;  1FJG C;  2Y27 A;  4OX9 C;  3J7A D;  2F4V C;  4DV5 C;  5A1G A;  3L95 X;  4DV6 C;  4JI2 C;  2ZZN A;  3PRO C;  1XMQ C;  3ETO A;  4PUH A;  2YWB A;  1PG3 A;  3ETC A;  2E8F A;  2CXC A;  4LE5 A;  3IEV A;  4DCU A;  3LUS A;  4WV3 A;  4AQY C;  4K0B A;  2DPL A;  4DR3 C;  3NPD A;  2YWC A;  1N2F A;  1PA4 A;  4YY3 C;  2UXB C;  3J80 D;  1KKG A;  2ZZM A;  1UWD A;  3GR0 A;  4X65 C;  1MD9 A;  4GKJ C;  3TUF A;  3NYR A;  5KEI A;  2P2B A;  4DCS A;  1XNR C;  1YJ7 A;  4BC9 A;  5H9U A;  2ONF A;  2D28 C; 
#chains in the Genus database with same CATH homology
 4LF6 C;  1ZB8 A;  2ATW A;  4I9G A;  3DLP X;  4I9F A;  3DHV A;  1N36 C;  4LF7 C;  2E5L C;  1BA3 A;  1V25 A;  2P2J A;  5BSV A;  4HPV A;  5A19 A;  1VLA A;  3KXW A;  3B7W A;  3PBK A;  3JAM D;  3GKU A;  4RVN A;  5BUR A;  2CY1 A;  3NI2 A;  1RG9 A;  2D1Q A;  4KTV A;  5KYT A;  1IBL C;  5BST A;  2E8E A;  5LMU C;  4NOZ A;  4X64 C;  3TQI A;  3RV2 A;  2UUB C;  4JI7 C;  2QW0 X;  4LFC C;  3CJE A;  1XRB A;  3A9V A;  3OTO C;  1PG4 A;  3A4I A;  5K85 A;  5AE1 A;  3L8C A;  5DV9 A;  3EQ6 A;  1MXB A;  1RY2 A;  4L2Z A;  4DR1 C;  3GPC A;  4R0M A;  1L2F A;  1WH9 A;  3FCC A;  4NDN A;  3E7X A;  2D1R A;  4XX2 A;  3LGX A;  3LNV A;  2KZF A;  4D57 A;  5A1I A;  1LQL A;  2YCB A;  4D4I A;  2ASB A;  4G36 A;  5FLX D;  5LMN C;  4KTT A;  4DCT A;  3G7S A;  3UZ0 A;  4BC7 A;  5E7Q A;  4K0K C;  2BJO A;  4RVO A;  4G37 A;  4JI3 C;  5A2Q D;  1T5D X;  4DV2 C;  1HR0 C;  5T8T A;  3H2T A;  2PT7 G;  2VZE A;  4DG9 A;  5BUS A;  5GTD A;  5BSR A;  4DUY C;  4U5Y D;  1QWI A;  4IZ6 A;  4FUT A;  4B3R C;  4ZLP A;  3VNR A;  1O90 A;  4OXI A;  4ISB A;  1WF3 A;  3NYQ A;  4WS9 A;  4DV0 C;  2VSQ A;  3S82 A;  3R44 A;  4JI8 C;  4DR4 C;  1MKY A;  4PZP A;  4GKK C;  1QM4 A;  5IFI A;  4B3T C;  2XR1 A;  4JI1 C;  2OBV A;  3I08 A;  1LCI A;  4FTF A;  4IR7 A;  4MH4 A;  4JYA C;  1N32 C;  3PES A;  2QVY X;  4RM3 A;  1ULT A;  1MXA A;  4LF4 C;  5JRH A;  2EGT A;  5BUQ A;  4R1M A;  2E0G A;  4RMN A;  2BH1 X;  1J5E C;  3J81 D;  4DUZ C;  1AMU A;  4PHT A;  4D56 A;  1XMO C;  1GPM A;  5CZV A;  2DYJ A;  4BBY A;  5AE3 A;  4DR5 C;  5CZX A;  1HNZ C;  2UUC C;  2P02 A;  3RG2 A;  4ZJZ A;  2UXD C;  4X62 C;  1MDF A;  2QVZ X;  5BR8 C;  4GXQ A;  1N33 C;  3VNS A;  4NXN C;  4ODJ A;  4B3M C;  2ZM6 C;  4JM1 A;  2OPL A;  4L7I A;  4DV4 C;  3T1Y C;  1ML8 A;  1T5H X;  2E8C A;  1ZB9 A;  4EAT A;  1USP B;  2P20 A;  4DG8 A;  2V7B A;  4D4G A;  2QVX X;  3N2Q A;  3T1H C;  5ADZ A;  4RLF A;  2D1S A;  1EGA A;  4LF5 C;  4TPS B;  1NYE A;  1O92 A;  4RM2 A;  2WP0 C;  3CW8 X;  2D27 A;  1O93 A;  1XNQ C;  3LAX A;  2P2F A;  1JOS A;  4L4Q A;  2HHH C;  2JMP A;  3UOW A;  1UKK A;  3I07 A;  1XRA A;  5BSW A;  4LF9 C;  4JI4 C;  2OO4 A;  3DAY A;  4G1I A;  2P2M A;  4GS5 A;  3R9X A;  2P2Q A;  4DCV A;  2HJG A;  2PN2 A;  3E7W A;  2AYA A;  1MXC A;  1HH2 P;  4BSZ A;  1MDB A;  1HNX C;  4LF8 C;  4KHP C;  4B3S C;  3R9W A;  3AF6 A;  5BSM A;  2Y4O A;  1USP A;  3FCE A;  4JI5 C;  4R1L A;  2PRO A;  1IBM C;  4JI6 C;  3TDE A;  4JI0 C;  4DR6 C;  3GR1 A;  1IBK C;  2UUA C;  4NXM C;  4OYC A;  3EER A;  5IWA C;  3SO4 A;  2VQE C;  4BCA A;  2QL8 A;  4YHH C;  1HNW C;  2D1T A;  1K0R A;  4X66 C;  4LFA C;  4JV5 C;  4MTN A;  3VNQ A;  3IEU A;  3IPL A;  2OPL B;  3IML A;  3AF5 A;  4DV1 C;  2E7G A;  4RLQ A;  1O9T A;  3A9U A;  1N34 C;  2Y4N A;  3N54 B;  3C5E A;  2VQF C;  2UU9 C;  4LFB C;  1P7L A;  4DV7 C;  5IT9 D;  5BSU A;  4GXR A;  4FUQ A;  1FUG A;  4PRO C;  2UXC C;  5T8S A;  2WD9 A;  5K8F A;  5AE2 A;  1XRC A;  2D7V A;  4DV3 C;  4DR2 C;  1I94 C;  4DR7 C;  1V26 A;  5KYV A;  3CW9 A;  1FJG C;  4OX9 C;  2Y27 A;  3J7A D;  2F4V C;  4DV5 C;  5A1G A;  3L95 X;  4DV6 C;  4JI2 C;  3PRO C;  1XMQ C;  3ETO A;  2YWB A;  1PG3 A;  3ETC A;  2E8F A;  2CXC A;  4LE5 A;  3IEV A;  4DCU A;  3LUS A;  4WV3 A;  4AQY C;  4K0B A;  2DPL A;  4DR3 C;  3NPD A;  2YWC A;  1N2F A;  1PA4 A;  4YY3 C;  2UXB C;  3J80 D;  1KKG A;  3GR0 A;  4X65 C;  1MD9 A;  4GKJ C;  3TUF A;  3NYR A;  5KEI A;  2P2B A;  4DCS A;  1XNR C;  1YJ7 A;  4BC9 A;  5H9U A;  2ONF A;  2D28 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...