1N32C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n32C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n32C02
1HH2P 4LF5C 1N32C 1N2FA 1XMOC 4LF7C 2E8CA 1N34C 4X66C 4DR2C 1PA4A 2EGTA 1WF3A 5FLXD 4NOZA 4DCSA 4JI4C 1L2FA 2BJOA 5BR8C 1MKYA 2F4VC 1JOSA 2HJGA 4YY3C 1ZB9A 4DV6C 1XNQC 4DR7C 1K0RA 2UUBC 2D7VA 4DV2C 2OPLA 4JI1C 4DR1C 4DUZC 4X62C 1HR0C 2DYJA 2ATWA 2KZFA 2E8EA 3J80D 4DUYC 4JI8C 4JI7C 4YHHC 3I07A 3J81D 4LF6C 3CJEA 5A2QD 4JYAC 1N33C 2E8FA 4JI3C 4DR5C 3R9XA 4DCVA 3J7AD 2ASBA 4NXMC 1NYEA 2UUCC 4BSZA 2ZM6C 1HNWC 4JI2C 1XNRC 1IBLC 4DR6C 3T1HC 4LFBC 4X65C 3T1YC 4JI6C 1LQLA 3GKUA 4B3SC 2UXCC 2E7GA 2UU9C 4MTNA 2UUAC 1XMQC 4KHPC 2E5LC 3LUSA 3JAMD 4LF9C 1HNZC 1ML8A 1QWIA 3EERA 1USPB 4NXNC 3AF6A 1KKGA 4JV5C 4DV7C 4DV5C 1J5EC 4LF8C 3IEUA 4XX2A 1N36C 4DV3C 4DCTA 2VQFC 4DV1C 1FJGC 4DV0C 1VLAA 1ZB8A 2XR1A 5LMNC 2UXDC 2OPLB 1I94C 4DCUA 1HNXC 4JI5C 4B3RC 4DV4C 4GKJC 2JMPA 4JI0C 4B3TC 2PT7G 3OTOC 4DR4C 3IEVA 2YCBA 2CXCA 2VQEC 1WH9A 5IWAC 3AF5A 2HHHC 3R9WA 4GKKC 2QL8A 4LFAC 1EGAA 5IT9D 2ONFA 1USPA 1UKKA 4DR3C 4B3MC 1IBKC 2PN2A 4MH4A 4X64C 2CY1A 5LMUC 4LFCC 4K0KC 1IBMC 4LF4C 4AQYC 2UXBC 4OX9C
chains in the Genus database with same CATH superfamily
1T5DX 1N2FA 3GR1A 1N34C 1P7LA 2AYAA 1PA4A 2EGTA 4I9GA 4NOZA 5BSUA 1YGTA 2BJOA 3AY0A 5BR8C 1MKYA 2NCLA 3G7SA 1XNQC 3CW8X 1V26A 1RY2A 2D27A 3ETOA 4FTFA 5AE2A 2PROA 1HR0C 4JI8C 4DUYC 1TH5A 3RV2A 1RG9A 3K6RA 2E8FA 4JI3C 3R9XA 2P2QA 2ZM6C 1HNWC 2YX1A 4KTVA 4RMNA 5KYVA 1XNRC 1O92A 1FUGA 3T1YC 4G37A 1MXCA 2MCQA 2WD9A 4IZ6A 3JAMD 1HNZC 1ML8A 1M6XC 3IPLA 2MMAB 4D4GA 4GS5A 3UX3A 1XS3A 4XX2A 1N36C 3TQIA 1FJGC 5BSWA 3NYQA 5LMNC 2P2MA 2UXDC 2OPLB 1I94C 1MDBA 2JMPA 1XRBA 2CU6A 4B3TC 3IEVA 2VQEC 5KYTA 4GXRA 3A4IA 4L4QA 5T8SA 4ISBA 2ONFA 1LCIA 2KDNA 4G36A 1IBKC 4B3MC 2PN2A 3A9VA 4MH4A 2CY1A 4LF4C 4AQYC 5BSMA 4RM2A 5A19A 1XRCA 1WF3A 4JI4C 1GPMA 3C5EA 1L2FA 2ZZNA 1ULTA 2DPLA 2M5HA 2Y4NA 1K0RA 2UUBC 1V60A 4DR1C 4K0BA 4FUTA 2ATWA 1PU1A 2KZFA 4R1MA 4JI7C 2DHMA 3J81D 2D28C 1FLOA 3FCCA 5A2QD 4DR5C 3TDEA 3A9UA 5A1GA 1NYEA 5DV9A 2UUCC 4JI2C 3UOWA 3TR3A 5BSTA 4FUQA 4X65C 1LQLA 5A1IA 5BSRA 3VNQA 1O9TA 4LE5A 4KHPC 2E5LC 1MD9A 3EERA 2QVZX 5BUQA 4PUIA 3AF6A 2ZTBA 5H9UA 2Y4OA 2WP0C 4LF8C 4DCTA 2VQFC 5E7QA 1VLAA 4WS9A 1ZB8A 3UEBA 3L95X 5CZVA 4DV4C 2PG1E 4JI0C 1PG3A 4OXIA 1UWDA 2YCBA 3NI2A 1WH9A 5IWAC 2Y27A 3R9WA 2D1TA 3N2QA 4RLFA 1YJ7A 3FM7A 1UKKA 3S82A 1XRAA 4PROC 4L2ZA 3A26A 1WCJA 4LFCC 3O2EA 4PZPA 2QVXX 1XDXA 5T8TA 4BC9A 4RVOA 2E8CA 4R0MA 5FLXD 4RM3A 3GR0A 1XHJA 1M6XA 5BSVA 2OBVA 4PUGA 3IMLA 1JOSA 4YY3C 4DV6C 4DR7C 5BURA 4DV2C 2OPLA 4DUZC 2P02A 4L7IA 3N54B 3UZ0A 2E8EA 4BC7A 4U5YD 4YHHC 2QW0X 5K8FA 3RG2A 1N33C 2V7BA 4D56A 3UX2A 5BUSA 3J7AD 1MDFA 3PBKA 1IBLC 4PHTA 5IFIA 3T1HC 4LFBC 3GKUA 4B3SC 2UU9C 2VZEA 1T5HX 4ZLPA 3LUSA 5LCIA 4LF9C 3CQ1A 4NDNA 1QWIA 1VEHA 1USPB 1P4EC 2D1RA 2YWCA 4JV5C 4DV7C 1J5EC 3IEUA 4BCAA 2D1QA 4DV0C 5KEIA 5AE3A 2XR1A 1QM4A 1HNXC 4JI5C 2P2JA 3B7WA 4D4IA 3DAYA 3OTOC 4I9FA 1NY8A 1BA3A 3AF5A 3L8CA 2HHHC 4GKKC 1EGAA 5IT9D 1USPA 1P4EA 4DR3C 5K85A 4ODJA 3GPCA 4X64C 3E7WA 3I08A 2UXBC 4OX9C 1V25A 4EATA 1HH2P 4LF5C 1N32C 1XMOC 3NPDA 2YWBA 4LF7C 4KTTA 4X66C 4DR2C 2D1SA 4DCSA 3CQ3A 3CQ2A 4WV3A 4PUHA 2KZ0A 3VNSA 4IR7A 2F4VC 3A25A 2HJGA 3NYRA 1ZB9A 3DHVA 2QVYX 2D7VA 4JI1C 4X62C 4R1LA 2P2BA 3R44A 3PESA 2DYJA 2M5OA 3J80D 3LGXA 4DG8A 3I07A 1O90A 3LAXA 4GXQA 3DLPX 2P20A 4LF6C 4HPVA 3CJEA 4OYCA 4JYAC 3EQ6A 1PG4A 4DCVA 2Z51A 2ASBA 4NXMC 4BSZA 3ETCA 4RLQA 2VSQA 4JM1A 4TPSB 2ZZMA 4G1IA 5AE1A 4DR6C 4JI6C 3PROC 2UXCC 2E7GA 5CZXA 4MTNA 2UUAC 4ZJZA 1XMQC 3SO4A 2OO4A 2BH1X 2MM9A 3TUFA 4D57A 3E7XA 4NXNC 1KKGA 4DV5C 3CW9A 4BBYA 4DV3C 4DV1C 5GTDA 4B3RC 4GKJC 3H2TA 2E0GA 4DCUA 1IB8A 4RVNA 3LNVA 5ADZA 2PT7G 4DR4C 4DG9A 2CXCA 1MXAA 5JRHA 3LNOA 2JNVA 2P2FA 2QL8A 4LFAC 3KXWA 3VNRA 1O93A 3FCEA 5LMUC 4K0KC 1IBMC 1AMUA 1MXBA
chains in the Genus database with same CATH topology
1T5DX 1N2FA 3GR1A 1N34C 1P7LA 2AYAA 1PA4A 2EGTA 4I9GA 4NOZA 5BSUA 2BJOA 5BR8C 1MKYA 3G7SA 1XNQC 3CW8X 1V26A 1RY2A 2D27A 3ETOA 4FTFA 5AE2A 2PROA 1HR0C 4JI8C 4DUYC 3RV2A 1RG9A 2E8FA 4JI3C 3R9XA 2P2QA 2ZM6C 1HNWC 4KTVA 4RMNA 5KYVA 1XNRC 1O92A 1FUGA 3T1YC 4G37A 1MXCA 2WD9A 4IZ6A 3JAMD 1HNZC 1ML8A 3IPLA 4D4GA 4GS5A 4XX2A 1N36C 3TQIA 1FJGC 5BSWA 3NYQA 5LMNC 2P2MA 2UXDC 2OPLB 1I94C 1MDBA 2JMPA 1XRBA 4B3TC 3IEVA 2VQEC 5KYTA 4GXRA 3A4IA 4L4QA 5T8SA 4ISBA 2ONFA 1LCIA 4G36A 1IBKC 4B3MC 2PN2A 3A9VA 4MH4A 2CY1A 4LF4C 4AQYC 5BSMA 4RM2A 5A19A 1XRCA 1WF3A 4JI4C 1GPMA 3C5EA 1L2FA 1ULTA 2DPLA 2Y4NA 1K0RA 2UUBC 4DR1C 4K0BA 4FUTA 2ATWA 2KZFA 4R1MA 4JI7C 3J81D 2D28C 3FCCA 5A2QD 4DR5C 3TDEA 3A9UA 5A1GA 1NYEA 5DV9A 2UUCC 4JI2C 3UOWA 5BSTA 4FUQA 4X65C 1LQLA 5A1IA 5BSRA 3VNQA 1O9TA 4LE5A 4KHPC 2E5LC 1MD9A 3EERA 2QVZX 5BUQA 3AF6A 5H9UA 2Y4OA 2WP0C 4LF8C 4DCTA 2VQFC 5E7QA 1VLAA 4WS9A 1ZB8A 3L95X 5CZVA 4DV4C 4JI0C 1PG3A 4OXIA 2YCBA 3NI2A 1WH9A 5IWAC 2Y27A 3R9WA 2D1TA 3N2QA 4RLFA 1YJ7A 1UKKA 3S82A 1XRAA 4PROC 4L2ZA 4LFCC 4PZPA 2QVXX 5T8TA 4BC9A 4RVOA 2E8CA 4R0MA 5FLXD 4RM3A 3GR0A 5BSVA 2OBVA 3IMLA 1JOSA 4YY3C 4DV6C 4DR7C 5BURA 4DV2C 2OPLA 4DUZC 2P02A 4L7IA 3N54B 3UZ0A 2E8EA 4BC7A 4U5YD 4YHHC 2QW0X 5K8FA 3RG2A 1N33C 2V7BA 4D56A 5BUSA 3J7AD 1MDFA 3PBKA 1IBLC 4PHTA 5IFIA 3T1HC 4LFBC 3GKUA 4B3SC 2UU9C 2VZEA 1T5HX 4ZLPA 3LUSA 4LF9C 4NDNA 1QWIA 1USPB 2D1RA 2YWCA 4JV5C 4DV7C 1J5EC 3IEUA 4BCAA 2D1QA 4DV0C 5KEIA 5AE3A 2XR1A 1QM4A 1HNXC 4JI5C 2P2JA 3B7WA 4D4IA 3DAYA 3OTOC 4I9FA 1BA3A 3AF5A 3L8CA 2HHHC 4GKKC 1EGAA 5IT9D 1USPA 4DR3C 5K85A 4ODJA 3GPCA 4X64C 3E7WA 3I08A 2UXBC 4OX9C 1V25A 4EATA 1HH2P 4LF5C 1N32C 1XMOC 3NPDA 2YWBA 4LF7C 4KTTA 4X66C 4DR2C 2D1SA 4DCSA 4WV3A 3VNSA 2F4VC 4IR7A 2HJGA 3NYRA 1ZB9A 3DHVA 2QVYX 2D7VA 4JI1C 4X62C 4R1LA 2P2BA 3R44A 3PESA 2DYJA 3J80D 3LGXA 4DG8A 3I07A 1O90A 3LAXA 4GXQA 3DLPX 2P20A 4LF6C 4HPVA 3CJEA 4OYCA 4JYAC 3EQ6A 1PG4A 4DCVA 2ASBA 4NXMC 4BSZA 3ETCA 4RLQA 2VSQA 4JM1A 4TPSB 4G1IA 5AE1A 4DR6C 4JI6C 3PROC 2UXCC 2E7GA 5CZXA 4MTNA 2UUAC 4ZJZA 1XMQC 3SO4A 2OO4A 2BH1X 3TUFA 4D57A 3E7XA 4NXNC 1KKGA 4DV5C 3CW9A 4BBYA 4DV3C 4DV1C 5GTDA 4B3RC 4GKJC 3H2TA 2E0GA 4DCUA 4RVNA 3LNVA 5ADZA 2PT7G 4DR4C 4DG9A 2CXCA 1MXAA 5JRHA 2P2FA 2QL8A 4LFAC 3KXWA 3VNRA 1O93A 3FCEA 5LMUC 4K0KC 1IBMC 1AMUA 1MXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH2 P;  4LF5 C;  1N32 C;  1N2F A;  1XMO C;  4LF7 C;  2E8C A;  1N34 C;  4X66 C;  4DR2 C;  1PA4 A;  2EGT A;  1WF3 A;  5FLX D;  4NOZ A;  4DCS A;  4JI4 C;  1L2F A;  2BJO A;  5BR8 C;  1MKY A;  2F4V C;  1JOS A;  2HJG A;  4YY3 C;  1ZB9 A;  4DV6 C;  1XNQ C;  4DR7 C;  1K0R A;  2UUB C;  2D7V A;  4DV2 C;  2OPL A;  4JI1 C;  4DR1 C;  4DUZ C;  4X62 C;  1HR0 C;  2DYJ A;  2ATW A;  2KZF A;  2E8E A;  3J80 D;  4DUY C;  4JI8 C;  4JI7 C;  4YHH C;  3I07 A;  3J81 D;  4LF6 C;  3CJE A;  5A2Q D;  4JYA C;  1N33 C;  2E8F A;  4JI3 C;  4DR5 C;  3R9X A;  4DCV A;  3J7A D;  2ASB A;  4NXM C;  1NYE A;  2UUC C;  4BSZ A;  2ZM6 C;  1HNW C;  4JI2 C;  1XNR C;  1IBL C;  4DR6 C;  3T1H C;  4LFB C;  4X65 C;  3T1Y C;  4JI6 C;  1LQL A;  3GKU A;  4B3S C;  2UXC C;  2E7G A;  2UU9 C;  4MTN A;  2UUA C;  1XMQ C;  4KHP C;  2E5L C;  3LUS A;  3JAM D;  4LF9 C;  1HNZ C;  1ML8 A;  1QWI A;  3EER A;  1USP B;  4NXN C;  3AF6 A;  1KKG A;  4JV5 C;  4DV7 C;  4DV5 C;  1J5E C;  4LF8 C;  3IEU A;  4XX2 A;  1N36 C;  4DV3 C;  4DCT A;  2VQF C;  4DV1 C;  1FJG C;  4DV0 C;  1VLA A;  1ZB8 A;  2XR1 A;  5LMN C;  2UXD C;  2OPL B;  1I94 C;  4DCU A;  1HNX C;  4JI5 C;  4B3R C;  4DV4 C;  4GKJ C;  2JMP A;  4JI0 C;  4B3T C;  2PT7 G;  3OTO C;  4DR4 C;  3IEV A;  2YCB A;  2CXC A;  2VQE C;  1WH9 A;  5IWA C;  3AF5 A;  2HHH C;  3R9W A;  4GKK C;  2QL8 A;  4LFA C;  1EGA A;  5IT9 D;  2ONF A;  1USP A;  1UKK A;  4DR3 C;  4B3M C;  1IBK C;  2PN2 A;  4MH4 A;  4X64 C;  2CY1 A;  5LMU C;  4LFC C;  4K0K C;  1IBM C;  4LF4 C;  4AQY C;  2UXB C;  4OX9 C; 
#chains in the Genus database with same CATH topology
 1T5D X;  1N2F A;  3GR1 A;  1N34 C;  1P7L A;  2AYA A;  1PA4 A;  2EGT A;  4I9G A;  4NOZ A;  5BSU A;  1YGT A;  2BJO A;  3AY0 A;  5BR8 C;  1MKY A;  2NCL A;  3G7S A;  1XNQ C;  3CW8 X;  1V26 A;  1RY2 A;  2D27 A;  3ETO A;  4FTF A;  5AE2 A;  2PRO A;  1HR0 C;  4JI8 C;  4DUY C;  1TH5 A;  3RV2 A;  1RG9 A;  3K6R A;  2E8F A;  4JI3 C;  3R9X A;  2P2Q A;  2ZM6 C;  1HNW C;  2YX1 A;  4KTV A;  4RMN A;  5KYV A;  1XNR C;  1O92 A;  1FUG A;  3T1Y C;  4G37 A;  1MXC A;  2MCQ A;  2WD9 A;  4IZ6 A;  3JAM D;  1HNZ C;  1ML8 A;  1M6X C;  3IPL A;  2MMA B;  4D4G A;  4GS5 A;  3UX3 A;  1XS3 A;  4XX2 A;  1N36 C;  3TQI A;  1FJG C;  5BSW A;  3NYQ A;  5LMN C;  2P2M A;  2UXD C;  2OPL B;  1I94 C;  1MDB A;  2JMP A;  1XRB A;  2CU6 A;  4B3T C;  3IEV A;  2VQE C;  5KYT A;  4GXR A;  3A4I A;  4L4Q A;  5T8S A;  4ISB A;  2ONF A;  1LCI A;  2KDN A;  4G36 A;  1IBK C;  4B3M C;  2PN2 A;  3A9V A;  4MH4 A;  2CY1 A;  4LF4 C;  4AQY C;  5BSM A;  4RM2 A;  5A19 A;  1XRC A;  1WF3 A;  4JI4 C;  1GPM A;  3C5E A;  1L2F A;  2ZZN A;  1ULT A;  2DPL A;  2M5H A;  2Y4N A;  1K0R A;  2UUB C;  1V60 A;  4DR1 C;  4K0B A;  4FUT A;  2ATW A;  1PU1 A;  2KZF A;  4R1M A;  4JI7 C;  2DHM A;  3J81 D;  2D28 C;  1FLO A;  3FCC A;  5A2Q D;  4DR5 C;  3TDE A;  3A9U A;  5A1G A;  1NYE A;  5DV9 A;  2UUC C;  4JI2 C;  3UOW A;  3TR3 A;  5BST A;  4FUQ A;  4X65 C;  1LQL A;  5A1I A;  5BSR A;  3VNQ A;  1O9T A;  4LE5 A;  4KHP C;  2E5L C;  1MD9 A;  3EER A;  2QVZ X;  5BUQ A;  4PUI A;  3AF6 A;  2ZTB A;  5H9U A;  2Y4O A;  2WP0 C;  4LF8 C;  4DCT A;  2VQF C;  5E7Q A;  1VLA A;  4WS9 A;  1ZB8 A;  3UEB A;  3L95 X;  5CZV A;  4DV4 C;  2PG1 E;  4JI0 C;  1PG3 A;  4OXI A;  1UWD A;  2YCB A;  3NI2 A;  1WH9 A;  5IWA C;  2Y27 A;  3R9W A;  2D1T A;  3N2Q A;  4RLF A;  1YJ7 A;  3FM7 A;  1UKK A;  3S82 A;  1XRA A;  4PRO C;  4L2Z A;  3A26 A;  1WCJ A;  4LFC C;  3O2E A;  4PZP A;  2QVX X;  1XDX A;  5T8T A;  4BC9 A;  4RVO A;  2E8C A;  4R0M A;  5FLX D;  4RM3 A;  3GR0 A;  1XHJ A;  1M6X A;  5BSV A;  2OBV A;  4PUG A;  3IML A;  1JOS A;  4YY3 C;  4DV6 C;  4DR7 C;  5BUR A;  4DV2 C;  2OPL A;  4DUZ C;  2P02 A;  4L7I A;  3N54 B;  3UZ0 A;  2E8E A;  4BC7 A;  4U5Y D;  4YHH C;  2QW0 X;  5K8F A;  3RG2 A;  1N33 C;  2V7B A;  4D56 A;  3UX2 A;  5BUS A;  3J7A D;  1MDF A;  3PBK A;  1IBL C;  4PHT A;  5IFI A;  3T1H C;  4LFB C;  3GKU A;  4B3S C;  2UU9 C;  2VZE A;  1T5H X;  4ZLP A;  3LUS A;  5LCI A;  4LF9 C;  3CQ1 A;  4NDN A;  1QWI A;  1VEH A;  1USP B;  1P4E C;  2D1R A;  2YWC A;  4JV5 C;  4DV7 C;  1J5E C;  3IEU A;  4BCA A;  2D1Q A;  4DV0 C;  5KEI A;  5AE3 A;  2XR1 A;  1QM4 A;  1HNX C;  4JI5 C;  2P2J A;  3B7W A;  4D4I A;  3DAY A;  3OTO C;  4I9F A;  1NY8 A;  1BA3 A;  3AF5 A;  3L8C A;  2HHH C;  4GKK C;  1EGA A;  5IT9 D;  1USP A;  1P4E A;  4DR3 C;  5K85 A;  4ODJ A;  3GPC A;  4X64 C;  3E7W A;  3I08 A;  2UXB C;  4OX9 C;  1V25 A;  4EAT A;  1HH2 P;  4LF5 C;  1N32 C;  1XMO C;  3NPD A;  2YWB A;  4LF7 C;  4KTT A;  4X66 C;  4DR2 C;  2D1S A;  4DCS A;  3CQ3 A;  3CQ2 A;  4WV3 A;  4PUH A;  2KZ0 A;  3VNS A;  4IR7 A;  2F4V C;  3A25 A;  2HJG A;  3NYR A;  1ZB9 A;  3DHV A;  2QVY X;  2D7V A;  4JI1 C;  4X62 C;  4R1L A;  2P2B A;  3R44 A;  3PES A;  2DYJ A;  2M5O A;  3J80 D;  3LGX A;  4DG8 A;  3I07 A;  1O90 A;  3LAX A;  4GXQ A;  3DLP X;  2P20 A;  4LF6 C;  4HPV A;  3CJE A;  4OYC A;  4JYA C;  3EQ6 A;  1PG4 A;  4DCV A;  2Z51 A;  2ASB A;  4NXM C;  4BSZ A;  3ETC A;  4RLQ A;  2VSQ A;  4JM1 A;  4TPS B;  2ZZM A;  4G1I A;  5AE1 A;  4DR6 C;  4JI6 C;  3PRO C;  2UXC C;  2E7G A;  5CZX A;  4MTN A;  2UUA C;  4ZJZ A;  1XMQ C;  3SO4 A;  2OO4 A;  2BH1 X;  2MM9 A;  3TUF A;  4D57 A;  3E7X A;  4NXN C;  1KKG A;  4DV5 C;  3CW9 A;  4BBY A;  4DV3 C;  4DV1 C;  5GTD A;  4B3R C;  4GKJ C;  3H2T A;  2E0G A;  4DCU A;  1IB8 A;  4RVN A;  3LNV A;  5ADZ A;  2PT7 G;  4DR4 C;  4DG9 A;  2CXC A;  1MXA A;  5JRH A;  3LNO A;  2JNV A;  2P2F A;  2QL8 A;  4LFA C;  3KXW A;  3VNR A;  1O93 A;  3FCE A;  5LMU C;  4K0K C;  1IBM C;  1AMU A;  1MXB A; 
#chains in the Genus database with same CATH homology
 1T5D X;  1N2F A;  3GR1 A;  1N34 C;  1P7L A;  2AYA A;  1PA4 A;  2EGT A;  4I9G A;  4NOZ A;  5BSU A;  2BJO A;  5BR8 C;  1MKY A;  3G7S A;  1XNQ C;  3CW8 X;  1V26 A;  1RY2 A;  2D27 A;  3ETO A;  4FTF A;  5AE2 A;  2PRO A;  1HR0 C;  4JI8 C;  4DUY C;  3RV2 A;  1RG9 A;  2E8F A;  4JI3 C;  3R9X A;  2P2Q A;  2ZM6 C;  1HNW C;  4KTV A;  4RMN A;  5KYV A;  1XNR C;  1O92 A;  1FUG A;  3T1Y C;  4G37 A;  1MXC A;  2WD9 A;  4IZ6 A;  3JAM D;  1HNZ C;  1ML8 A;  3IPL A;  4D4G A;  4GS5 A;  4XX2 A;  1N36 C;  3TQI A;  1FJG C;  5BSW A;  3NYQ A;  5LMN C;  2P2M A;  2UXD C;  2OPL B;  1I94 C;  1MDB A;  2JMP A;  1XRB A;  4B3T C;  3IEV A;  2VQE C;  5KYT A;  4GXR A;  3A4I A;  4L4Q A;  5T8S A;  4ISB A;  2ONF A;  1LCI A;  4G36 A;  1IBK C;  4B3M C;  2PN2 A;  3A9V A;  4MH4 A;  2CY1 A;  4LF4 C;  4AQY C;  5BSM A;  4RM2 A;  5A19 A;  1XRC A;  1WF3 A;  4JI4 C;  1GPM A;  3C5E A;  1L2F A;  1ULT A;  2DPL A;  2Y4N A;  1K0R A;  2UUB C;  4DR1 C;  4K0B A;  4FUT A;  2ATW A;  2KZF A;  4R1M A;  4JI7 C;  3J81 D;  2D28 C;  3FCC A;  5A2Q D;  4DR5 C;  3TDE A;  3A9U A;  5A1G A;  1NYE A;  5DV9 A;  2UUC C;  4JI2 C;  3UOW A;  5BST A;  4FUQ A;  4X65 C;  1LQL A;  5A1I A;  5BSR A;  3VNQ A;  1O9T A;  4LE5 A;  4KHP C;  2E5L C;  1MD9 A;  3EER A;  2QVZ X;  5BUQ A;  3AF6 A;  5H9U A;  2Y4O A;  2WP0 C;  4LF8 C;  4DCT A;  2VQF C;  5E7Q A;  1VLA A;  4WS9 A;  1ZB8 A;  3L95 X;  5CZV A;  4DV4 C;  4JI0 C;  1PG3 A;  4OXI A;  2YCB A;  3NI2 A;  1WH9 A;  5IWA C;  2Y27 A;  3R9W A;  2D1T A;  3N2Q A;  4RLF A;  1YJ7 A;  1UKK A;  3S82 A;  1XRA A;  4PRO C;  4L2Z A;  4LFC C;  4PZP A;  2QVX X;  5T8T A;  4BC9 A;  4RVO A;  2E8C A;  4R0M A;  5FLX D;  4RM3 A;  3GR0 A;  5BSV A;  2OBV A;  3IML A;  1JOS A;  4YY3 C;  4DV6 C;  4DR7 C;  5BUR A;  4DV2 C;  2OPL A;  4DUZ C;  2P02 A;  4L7I A;  3N54 B;  3UZ0 A;  2E8E A;  4BC7 A;  4U5Y D;  4YHH C;  2QW0 X;  5K8F A;  3RG2 A;  1N33 C;  2V7B A;  4D56 A;  5BUS A;  3J7A D;  1MDF A;  3PBK A;  1IBL C;  4PHT A;  5IFI A;  3T1H C;  4LFB C;  3GKU A;  4B3S C;  2UU9 C;  2VZE A;  1T5H X;  4ZLP A;  3LUS A;  4LF9 C;  4NDN A;  1QWI A;  1USP B;  2D1R A;  2YWC A;  4JV5 C;  4DV7 C;  1J5E C;  3IEU A;  4BCA A;  2D1Q A;  4DV0 C;  5KEI A;  5AE3 A;  2XR1 A;  1QM4 A;  1HNX C;  4JI5 C;  2P2J A;  3B7W A;  4D4I A;  3DAY A;  3OTO C;  4I9F A;  1BA3 A;  3AF5 A;  3L8C A;  2HHH C;  4GKK C;  1EGA A;  5IT9 D;  1USP A;  4DR3 C;  5K85 A;  4ODJ A;  3GPC A;  4X64 C;  3E7W A;  3I08 A;  2UXB C;  4OX9 C;  1V25 A;  4EAT A;  1HH2 P;  4LF5 C;  1N32 C;  1XMO C;  3NPD A;  2YWB A;  4LF7 C;  4KTT A;  4X66 C;  4DR2 C;  2D1S A;  4DCS A;  4WV3 A;  3VNS A;  2F4V C;  4IR7 A;  2HJG A;  3NYR A;  1ZB9 A;  3DHV A;  2QVY X;  2D7V A;  4JI1 C;  4X62 C;  4R1L A;  2P2B A;  3R44 A;  3PES A;  2DYJ A;  3J80 D;  3LGX A;  4DG8 A;  3I07 A;  1O90 A;  3LAX A;  4GXQ A;  3DLP X;  2P20 A;  4LF6 C;  4HPV A;  3CJE A;  4OYC A;  4JYA C;  3EQ6 A;  1PG4 A;  4DCV A;  2ASB A;  4NXM C;  4BSZ A;  3ETC A;  4RLQ A;  2VSQ A;  4JM1 A;  4TPS B;  4G1I A;  5AE1 A;  4DR6 C;  4JI6 C;  3PRO C;  2UXC C;  2E7G A;  5CZX A;  4MTN A;  2UUA C;  4ZJZ A;  1XMQ C;  3SO4 A;  2OO4 A;  2BH1 X;  3TUF A;  4D57 A;  3E7X A;  4NXN C;  1KKG A;  4DV5 C;  3CW9 A;  4BBY A;  4DV3 C;  4DV1 C;  5GTD A;  4B3R C;  4GKJ C;  3H2T A;  2E0G A;  4DCU A;  4RVN A;  3LNV A;  5ADZ A;  2PT7 G;  4DR4 C;  4DG9 A;  2CXC A;  1MXA A;  5JRH A;  2P2F A;  2QL8 A;  4LFA C;  3KXW A;  3VNR A;  1O93 A;  3FCE A;  5LMU C;  4K0K C;  1IBM C;  1AMU A;  1MXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...