1N32C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n32C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n32C02
1LQLA 4DR6C 4DR7C 3I07A 2E8FA 3J81D 1PA4A 4X66C 1IBLC 4LF4C 4B3TC 2E8EA 4JI4C 2VQFC 3IEUA 2UUCC 2YCBA 2HHHC 4DR4C 1IBKC 2CXCA 2QL8A 4MH4A 4DV0C 2BJOA 2PT7G 4JI8C 4DV3C 4JI1C 1N36C 1N32C 4DUZC 4DR1C 4LF9C 4DCUA 4GKJC 4JYAC 1WF3A 5IT9D 4KHPC 4XX2A 5BR8C 4JI7C 1HH2P 5A2QD 2UUBC 4MTNA 2UXDC 3GKUA 4LF8C 4DV7C 1N2FA 4DV1C 4DV6C 4LFCC 4DCTA 1XNRC 1USPB 2UXBC 1J5EC 2ONFA 4NXMC 4JI0C 3EERA 2EGTA 2CY1A 3T1YC 2UUAC 4OX9C 5LMUC 1FJGC 2E7GA 3R9XA 2ZM6C 4B3MC 1K0RA 2KZFA 2UU9C 1HNZC 1N33C 5IWAC 3AF6A 1WH9A 2D7VA 2ATWA 1USPA 4YY3C 1IBMC 1XNQC 5LMNC 4YHHC 4DR2C 1JOSA 4X64C 1ML8A 4DCVA 4DV5C 4NXNC 2VQEC 3CJEA 4JI3C 4LF6C 4AQYC 1NYEA 4X65C 2XR1A 4JI2C 4DCSA 1ZB9A 4JI6C 4LFBC 4DR5C 2F4VC 4JV5C 1HNWC 2UXCC 2OPLB 1I94C 1HNXC 1ZB8A 3J7AD 3T1HC 4K0KC 4DUYC 1MKYA 4DR3C 1XMQC 1UKKA 4DV2C 1QWIA 4NOZA 3OTOC 1XMOC 4LF7C 4JI5C 1VLAA 5FLXD 4B3SC 3AF5A 2E8CA 3LUSA 3R9WA 1L2FA 1EGAA 2ASBA 1KKGA 2HJGA 2DYJA 2PN2A 4X62C 2E5LC 3IEVA 4LFAC 4DV4C 2JMPA 2OPLA 1HR0C 4LF5C 4BSZA 4B3RC 4GKKC 3JAMD 1N34C 3J80D
chains in the Genus database with same CATH superfamily
1LQLA 4DR6C 2E8FA 3J81D 1PA4A 3UX2A 2E8EA 4I9GA 3A26A 2UUCC 3AY0A 2HHHC 1YJ7A 1IB8A 4U5YD 2CXCA 4FTFA 3TR3A 4JI1C 3IMLA 3LNOA 2V7BA 1O9TA 5IT9D 4D57A 2P2JA 2ZTBA 1LCIA 4JI7C 3NPDA 3NYQA 4GXRA 5BURA 2UUBC 1O90A 3UZ0A 2P20A 4KTTA 4MTNA 3I08A 4L7IA 2MCQA 4DV6C 1XNRC 3A25A 4NXMC 4ISBA 2YWBA 2QVYX 3GR0A 4FUTA 5K85A 4R1MA 1P4EA 3PBKA 4GS5A 4TPSB 1USPA 2KZ0A 1JOSA 5ADZA 1PG4A 4X64C 3ETOA 4JI3C 5KEIA 1XS3A 1NYEA 4PHTA 1TH5A 2XR1A 3A9UA 2MMAB 4DR5C 3SO4A 5E7QA 1O92A 4HPVA 3TDEA 4IR7A 5KYVA 4K0KC 4PUIA 3RG2A 4R1LA 4WV3A 4DV2C 1V26A 4RM2A 2E8CA 4PROC 3IEVA 2E5LC 4X62C 5BUSA 2QW0X 2JMPA 4B3RC 4EATA 2QVXX 3J80D 3H2TA 3I07A 5A1GA 4JI4C 3FCCA 4ODJA 1IBKC 1PU1A 4MH4A 4DV0C 5AE3A 4JI8C 2Y4OA 4GKJC 3DLPX 4KHPC 4XX2A 1V60A 4LF8C 3PESA 4G36A 1T5DX 5BSRA 4DV7C 1XRAA 5DV9A 4DCTA 1USPB 3FM7A 2D1TA 5BSUA 3FCEA 3T1YC 4OX9C 1FJGC 2E7GA 3R9XA 2P2QA 1FUGA 5AE2A 2ZM6C 2KZFA 1MDBA 2UU9C 1HNZC 5H9UA 2PG1E 1BA3A 5LMNC 2DHMA 2WP0C 3UOWA 1ML8A 4L4QA 2YWCA 3G7SA 4DV5C 2M5HA 2JNVA 4LF6C 3CQ2A 3NYRA 3ETCA 4X65C 4JI2C 1ZB9A 2CU6A 5KYTA 3CW8X 2F4VC 3IPLA 2UXCC 1MD9A 3S82A 4GXQA 1I94C 3J7AD 4IZ6A 4DUYC 5A1IA 4FUQA 4RMNA 4NOZA 1GPMA 5A19A 4LF7C 1YGTA 3PROC 1VLAA 2MM9A 2E0GA 3GPCA 5JRHA 3RV2A 4BC9A 3LUSA 3R9WA 3VNSA 2YX1A 2DYJA 2PN2A 4DV4C 1HR0C 1MXAA 4BSZA 1RG9A 3TQIA 4BCAA 2M5OA 2PROA 3IEUA 5CZXA 3CW9A 2YCBA 4DR4C 1PG3A 2D27A 2QL8A 4DV3C 4R0MA 4DUZC 4D4IA 1FLOA 1MXBA 4DR1C 4DCUA 4LF9C 3L95X 4JM1A 2D1QA 5A2QD 1ULTA 5T8TA 4D56A 1MXCA 2D1SA 4DV1C 4LFCC 3DAYA 2UXBC 3B7WA 2KDNA 4JI0C 4BBYA 4RM3A 2UUAC 2Y4NA 1VEHA 4B3MC 3VNQA 4DG8A 5IWAC 3AF6A 1WH9A 5BSWA 1V25A 3N2QA 4YY3C 4YHHC 4DR2C 5K8FA 1RY2A 4L2ZA 5BSTA 4NXNC 2VQEC 3CJEA 5LCIA 2P2MA 3CQ1A 4DCSA 1P4EC 4D4GA 1HNWC 1HNXC 2Z51A 5BSVA 1MKYA 4DR3C 1UKKA 5AE1A 2AYAA 4NDNA 1QWIA 1XMOC 1NY8A 4JI5C 5FLXD 5CZVA 2D1RA 4RVOA 4B3SC 1UWDA 3AF5A 1EGAA 1KKGA 2HJGA 4LFAC 2OPLA 5BSMA 3JAMD 1N34C 1M6XC 3VNRA 4K0BA 4DR7C 4LF4C 1IBLC 2P2BA 4X66C 4B3TC 1WCJA 2VQFC 2BH1X 1XHJA 2VZEA 2BJOA 2PT7G 3O2EA 1N36C 1N32C 4DG9A 4JYAC 1WF3A 3E7XA 5T8SA 5BR8C 1HH2P 1QM4A 2P2FA 2UXDC 3GKUA 2D28C 4PUHA 4PZPA 3UX3A 1N2FA 5BUQA 1J5EC 3K6RA 2ONFA 3EERA 2EGTA 1P7LA 2Y27A 4KTVA 2CY1A 5LMUC 3GR1A 3TUFA 4BC7A 1K0RA 3DHVA 3CQ3A 2VSQA 1T5HX 1N33C 4PUGA 4G1IA 3LNVA 3LAXA 2D7VA 1AMUA 1IBMC 2ATWA 4I9FA 1M6XA 4OXIA 1XNQC 4DCVA 3A9VA 2ZZMA 3A4IA 4AQYC 4RVNA 1MDFA 1XDXA 3E7WA 2NCLA 2P02A 3C5EA 4ZLPA 1O93A 4JI6C 4LFBC 4WS9A 4JV5C 3LGXA 3L8CA 4G37A 2OPLB 1ZB8A 3NI2A 5GTDA 3T1HC 1XRCA 5IFIA 4LE5A 1XMQC 4ZJZA 1XRBA 2WD9A 3OTOC 2ZZNA 2OO4A 4OYCA 4RLQA 4RLFA 3EQ6A 1L2FA 3R44A 2ASBA 3UEBA 2OBVA 2DPLA 4LF5C 4GKKC 3N54B 3KXWA 2QVZX
chains in the Genus database with same CATH topology
1LQLA 4DR6C 2E8FA 3J81D 1PA4A 2E8EA 4I9GA 2UUCC 2HHHC 1YJ7A 4U5YD 2CXCA 4FTFA 4JI1C 3IMLA 2V7BA 1O9TA 5IT9D 4D57A 2P2JA 1LCIA 4JI7C 3NPDA 3NYQA 4GXRA 5BURA 2UUBC 1O90A 3UZ0A 2P20A 4KTTA 4MTNA 3I08A 4L7IA 4DV6C 1XNRC 4NXMC 4ISBA 2YWBA 2QVYX 3GR0A 4FUTA 5K85A 4R1MA 3PBKA 4GS5A 4TPSB 1USPA 1JOSA 5ADZA 1PG4A 4X64C 3ETOA 4JI3C 5KEIA 1NYEA 4PHTA 2XR1A 3A9UA 4DR5C 3SO4A 5E7QA 1O92A 4HPVA 3TDEA 4IR7A 5KYVA 4K0KC 3RG2A 4R1LA 4WV3A 4DV2C 1V26A 4RM2A 2E8CA 4PROC 3IEVA 2E5LC 4X62C 5BUSA 2QW0X 2JMPA 4B3RC 4EATA 2QVXX 3J80D 3H2TA 3I07A 5A1GA 4JI4C 3FCCA 4ODJA 1IBKC 4MH4A 4DV0C 5AE3A 4JI8C 2Y4OA 4GKJC 3DLPX 4KHPC 4XX2A 4LF8C 3PESA 4G36A 1T5DX 5BSRA 4DV7C 1XRAA 5DV9A 4DCTA 1USPB 2D1TA 5BSUA 3FCEA 3T1YC 4OX9C 1FJGC 2E7GA 3R9XA 2P2QA 1FUGA 5AE2A 2ZM6C 2KZFA 1MDBA 2UU9C 1HNZC 5H9UA 1BA3A 5LMNC 2WP0C 3UOWA 1ML8A 4L4QA 2YWCA 3G7SA 4DV5C 4LF6C 3NYRA 3ETCA 4X65C 4JI2C 1ZB9A 5KYTA 3CW8X 2F4VC 3IPLA 2UXCC 1MD9A 3S82A 4GXQA 1I94C 3J7AD 4IZ6A 4DUYC 5A1IA 4FUQA 4RMNA 4NOZA 1GPMA 5A19A 4LF7C 3PROC 1VLAA 2E0GA 3GPCA 5JRHA 3RV2A 4BC9A 3LUSA 3R9WA 3VNSA 2DYJA 2PN2A 4DV4C 1HR0C 1MXAA 4BSZA 1RG9A 3TQIA 4BCAA 2PROA 3IEUA 5CZXA 3CW9A 2YCBA 4DR4C 1PG3A 2D27A 2QL8A 4DV3C 4R0MA 4DUZC 4D4IA 1MXBA 4DR1C 4DCUA 4LF9C 3L95X 4JM1A 2D1QA 5A2QD 1ULTA 5T8TA 4D56A 1MXCA 2D1SA 4DV1C 4LFCC 3DAYA 2UXBC 3B7WA 4JI0C 4BBYA 4RM3A 2UUAC 2Y4NA 4B3MC 3VNQA 4DG8A 5IWAC 3AF6A 1WH9A 5BSWA 1V25A 3N2QA 4YY3C 4YHHC 4DR2C 5K8FA 1RY2A 4L2ZA 5BSTA 4NXNC 2VQEC 3CJEA 2P2MA 4DCSA 4D4GA 1HNWC 1HNXC 5BSVA 1MKYA 4DR3C 1UKKA 5AE1A 2AYAA 4NDNA 1QWIA 1XMOC 4JI5C 5FLXD 5CZVA 2D1RA 4RVOA 4B3SC 3AF5A 1EGAA 1KKGA 2HJGA 4LFAC 2OPLA 5BSMA 3JAMD 1N34C 3VNRA 4K0BA 4DR7C 4LF4C 1IBLC 2P2BA 4X66C 4B3TC 2VQFC 2BH1X 2VZEA 2BJOA 2PT7G 1N36C 1N32C 4DG9A 4JYAC 1WF3A 3E7XA 5T8SA 5BR8C 1HH2P 1QM4A 2P2FA 2UXDC 3GKUA 2D28C 4PZPA 1N2FA 5BUQA 1J5EC 2ONFA 3EERA 2EGTA 1P7LA 2Y27A 4KTVA 2CY1A 5LMUC 3GR1A 3TUFA 4BC7A 1K0RA 3DHVA 2VSQA 1T5HX 1N33C 4G1IA 3LNVA 3LAXA 2D7VA 1AMUA 1IBMC 2ATWA 4I9FA 1XNQC 4OXIA 4DCVA 3A9VA 3A4IA 4AQYC 4RVNA 1MDFA 3E7WA 2P02A 3C5EA 4ZLPA 1O93A 4JI6C 4LFBC 4WS9A 4JV5C 3LGXA 3L8CA 4G37A 2OPLB 1ZB8A 3NI2A 5GTDA 3T1HC 1XRCA 5IFIA 4LE5A 1XMQC 4ZJZA 1XRBA 2WD9A 3OTOC 2OO4A 4OYCA 4RLQA 4RLFA 3EQ6A 1L2FA 3R44A 2ASBA 2OBVA 2DPLA 4LF5C 4GKKC 3N54B 3KXWA 2QVZX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  4DR6 C;  4DR7 C;  3I07 A;  2E8F A;  3J81 D;  1PA4 A;  4X66 C;  1IBL C;  4LF4 C;  4B3T C;  2E8E A;  4JI4 C;  2VQF C;  3IEU A;  2UUC C;  2YCB A;  2HHH C;  4DR4 C;  1IBK C;  2CXC A;  2QL8 A;  4MH4 A;  4DV0 C;  2BJO A;  2PT7 G;  4JI8 C;  4DV3 C;  4JI1 C;  1N36 C;  1N32 C;  4DUZ C;  4DR1 C;  4LF9 C;  4DCU A;  4GKJ C;  4JYA C;  1WF3 A;  5IT9 D;  4KHP C;  4XX2 A;  5BR8 C;  4JI7 C;  1HH2 P;  5A2Q D;  2UUB C;  4MTN A;  2UXD C;  3GKU A;  4LF8 C;  4DV7 C;  1N2F A;  4DV1 C;  4DV6 C;  4LFC C;  4DCT A;  1XNR C;  1USP B;  2UXB C;  1J5E C;  2ONF A;  4NXM C;  4JI0 C;  3EER A;  2EGT A;  2CY1 A;  3T1Y C;  2UUA C;  4OX9 C;  5LMU C;  1FJG C;  2E7G A;  3R9X A;  2ZM6 C;  4B3M C;  1K0R A;  2KZF A;  2UU9 C;  1HNZ C;  1N33 C;  5IWA C;  3AF6 A;  1WH9 A;  2D7V A;  2ATW A;  1USP A;  4YY3 C;  1IBM C;  1XNQ C;  5LMN C;  4YHH C;  4DR2 C;  1JOS A;  4X64 C;  1ML8 A;  4DCV A;  4DV5 C;  4NXN C;  2VQE C;  3CJE A;  4JI3 C;  4LF6 C;  4AQY C;  1NYE A;  4X65 C;  2XR1 A;  4JI2 C;  4DCS A;  1ZB9 A;  4JI6 C;  4LFB C;  4DR5 C;  2F4V C;  4JV5 C;  1HNW C;  2UXC C;  2OPL B;  1I94 C;  1HNX C;  1ZB8 A;  3J7A D;  3T1H C;  4K0K C;  4DUY C;  1MKY A;  4DR3 C;  1XMQ C;  1UKK A;  4DV2 C;  1QWI A;  4NOZ A;  3OTO C;  1XMO C;  4LF7 C;  4JI5 C;  1VLA A;  5FLX D;  4B3S C;  3AF5 A;  2E8C A;  3LUS A;  3R9W A;  1L2F A;  1EGA A;  2ASB A;  1KKG A;  2HJG A;  2DYJ A;  2PN2 A;  4X62 C;  2E5L C;  3IEV A;  4LFA C;  4DV4 C;  2JMP A;  2OPL A;  1HR0 C;  4LF5 C;  4BSZ A;  4B3R C;  4GKK C;  3JAM D;  1N34 C;  3J80 D; 
#chains in the Genus database with same CATH topology
 1LQL A;  4DR6 C;  2E8F A;  3J81 D;  1PA4 A;  3UX2 A;  2E8E A;  4I9G A;  3A26 A;  2UUC C;  3AY0 A;  2HHH C;  1YJ7 A;  1IB8 A;  4U5Y D;  2CXC A;  4FTF A;  3TR3 A;  4JI1 C;  3IML A;  3LNO A;  2V7B A;  1O9T A;  5IT9 D;  4D57 A;  2P2J A;  2ZTB A;  1LCI A;  4JI7 C;  3NPD A;  3NYQ A;  4GXR A;  5BUR A;  2UUB C;  1O90 A;  3UZ0 A;  2P20 A;  4KTT A;  4MTN A;  3I08 A;  4L7I A;  2MCQ A;  4DV6 C;  1XNR C;  3A25 A;  4NXM C;  4ISB A;  2YWB A;  2QVY X;  3GR0 A;  4FUT A;  5K85 A;  4R1M A;  1P4E A;  3PBK A;  4GS5 A;  4TPS B;  1USP A;  2KZ0 A;  1JOS A;  5ADZ A;  1PG4 A;  4X64 C;  3ETO A;  4JI3 C;  5KEI A;  1XS3 A;  1NYE A;  4PHT A;  1TH5 A;  2XR1 A;  3A9U A;  2MMA B;  4DR5 C;  3SO4 A;  5E7Q A;  1O92 A;  4HPV A;  3TDE A;  4IR7 A;  5KYV A;  4K0K C;  4PUI A;  3RG2 A;  4R1L A;  4WV3 A;  4DV2 C;  1V26 A;  4RM2 A;  2E8C A;  4PRO C;  3IEV A;  2E5L C;  4X62 C;  5BUS A;  2QW0 X;  2JMP A;  4B3R C;  4EAT A;  2QVX X;  3J80 D;  3H2T A;  3I07 A;  5A1G A;  4JI4 C;  3FCC A;  4ODJ A;  1IBK C;  1PU1 A;  4MH4 A;  4DV0 C;  5AE3 A;  4JI8 C;  2Y4O A;  4GKJ C;  3DLP X;  4KHP C;  4XX2 A;  1V60 A;  4LF8 C;  3PES A;  4G36 A;  1T5D X;  5BSR A;  4DV7 C;  1XRA A;  5DV9 A;  4DCT A;  1USP B;  3FM7 A;  2D1T A;  5BSU A;  3FCE A;  3T1Y C;  4OX9 C;  1FJG C;  2E7G A;  3R9X A;  2P2Q A;  1FUG A;  5AE2 A;  2ZM6 C;  2KZF A;  1MDB A;  2UU9 C;  1HNZ C;  5H9U A;  2PG1 E;  1BA3 A;  5LMN C;  2DHM A;  2WP0 C;  3UOW A;  1ML8 A;  4L4Q A;  2YWC A;  3G7S A;  4DV5 C;  2M5H A;  2JNV A;  4LF6 C;  3CQ2 A;  3NYR A;  3ETC A;  4X65 C;  4JI2 C;  1ZB9 A;  2CU6 A;  5KYT A;  3CW8 X;  2F4V C;  3IPL A;  2UXC C;  1MD9 A;  3S82 A;  4GXQ A;  1I94 C;  3J7A D;  4IZ6 A;  4DUY C;  5A1I A;  4FUQ A;  4RMN A;  4NOZ A;  1GPM A;  5A19 A;  4LF7 C;  1YGT A;  3PRO C;  1VLA A;  2MM9 A;  2E0G A;  3GPC A;  5JRH A;  3RV2 A;  4BC9 A;  3LUS A;  3R9W A;  3VNS A;  2YX1 A;  2DYJ A;  2PN2 A;  4DV4 C;  1HR0 C;  1MXA A;  4BSZ A;  1RG9 A;  3TQI A;  4BCA A;  2M5O A;  2PRO A;  3IEU A;  5CZX A;  3CW9 A;  2YCB A;  4DR4 C;  1PG3 A;  2D27 A;  2QL8 A;  4DV3 C;  4R0M A;  4DUZ C;  4D4I A;  1FLO A;  1MXB A;  4DR1 C;  4DCU A;  4LF9 C;  3L95 X;  4JM1 A;  2D1Q A;  5A2Q D;  1ULT A;  5T8T A;  4D56 A;  1MXC A;  2D1S A;  4DV1 C;  4LFC C;  3DAY A;  2UXB C;  3B7W A;  2KDN A;  4JI0 C;  4BBY A;  4RM3 A;  2UUA C;  2Y4N A;  1VEH A;  4B3M C;  3VNQ A;  4DG8 A;  5IWA C;  3AF6 A;  1WH9 A;  5BSW A;  1V25 A;  3N2Q A;  4YY3 C;  4YHH C;  4DR2 C;  5K8F A;  1RY2 A;  4L2Z A;  5BST A;  4NXN C;  2VQE C;  3CJE A;  5LCI A;  2P2M A;  3CQ1 A;  4DCS A;  1P4E C;  4D4G A;  1HNW C;  1HNX C;  2Z51 A;  5BSV A;  1MKY A;  4DR3 C;  1UKK A;  5AE1 A;  2AYA A;  4NDN A;  1QWI A;  1XMO C;  1NY8 A;  4JI5 C;  5FLX D;  5CZV A;  2D1R A;  4RVO A;  4B3S C;  1UWD A;  3AF5 A;  1EGA A;  1KKG A;  2HJG A;  4LFA C;  2OPL A;  5BSM A;  3JAM D;  1N34 C;  1M6X C;  3VNR A;  4K0B A;  4DR7 C;  4LF4 C;  1IBL C;  2P2B A;  4X66 C;  4B3T C;  1WCJ A;  2VQF C;  2BH1 X;  1XHJ A;  2VZE A;  2BJO A;  2PT7 G;  3O2E A;  1N36 C;  1N32 C;  4DG9 A;  4JYA C;  1WF3 A;  3E7X A;  5T8S A;  5BR8 C;  1HH2 P;  1QM4 A;  2P2F A;  2UXD C;  3GKU A;  2D28 C;  4PUH A;  4PZP A;  3UX3 A;  1N2F A;  5BUQ A;  1J5E C;  3K6R A;  2ONF A;  3EER A;  2EGT A;  1P7L A;  2Y27 A;  4KTV A;  2CY1 A;  5LMU C;  3GR1 A;  3TUF A;  4BC7 A;  1K0R A;  3DHV A;  3CQ3 A;  2VSQ A;  1T5H X;  1N33 C;  4PUG A;  4G1I A;  3LNV A;  3LAX A;  2D7V A;  1AMU A;  1IBM C;  2ATW A;  4I9F A;  1M6X A;  4OXI A;  1XNQ C;  4DCV A;  3A9V A;  2ZZM A;  3A4I A;  4AQY C;  4RVN A;  1MDF A;  1XDX A;  3E7W A;  2NCL A;  2P02 A;  3C5E A;  4ZLP A;  1O93 A;  4JI6 C;  4LFB C;  4WS9 A;  4JV5 C;  3LGX A;  3L8C A;  4G37 A;  2OPL B;  1ZB8 A;  3NI2 A;  5GTD A;  3T1H C;  1XRC A;  5IFI A;  4LE5 A;  1XMQ C;  4ZJZ A;  1XRB A;  2WD9 A;  3OTO C;  2ZZN A;  2OO4 A;  4OYC A;  4RLQ A;  4RLF A;  3EQ6 A;  1L2F A;  3R44 A;  2ASB A;  3UEB A;  2OBV A;  2DPL A;  4LF5 C;  4GKK C;  3N54 B;  3KXW A;  2QVZ X; 
#chains in the Genus database with same CATH homology
 1LQL A;  4DR6 C;  2E8F A;  3J81 D;  1PA4 A;  2E8E A;  4I9G A;  2UUC C;  2HHH C;  1YJ7 A;  4U5Y D;  2CXC A;  4FTF A;  4JI1 C;  3IML A;  2V7B A;  1O9T A;  5IT9 D;  4D57 A;  2P2J A;  1LCI A;  4JI7 C;  3NPD A;  3NYQ A;  4GXR A;  5BUR A;  2UUB C;  1O90 A;  3UZ0 A;  2P20 A;  4KTT A;  4MTN A;  3I08 A;  4L7I A;  4DV6 C;  1XNR C;  4NXM C;  4ISB A;  2YWB A;  2QVY X;  3GR0 A;  4FUT A;  5K85 A;  4R1M A;  3PBK A;  4GS5 A;  4TPS B;  1USP A;  1JOS A;  5ADZ A;  1PG4 A;  4X64 C;  3ETO A;  4JI3 C;  5KEI A;  1NYE A;  4PHT A;  2XR1 A;  3A9U A;  4DR5 C;  3SO4 A;  5E7Q A;  1O92 A;  4HPV A;  3TDE A;  4IR7 A;  5KYV A;  4K0K C;  3RG2 A;  4R1L A;  4WV3 A;  4DV2 C;  1V26 A;  4RM2 A;  2E8C A;  4PRO C;  3IEV A;  2E5L C;  4X62 C;  5BUS A;  2QW0 X;  2JMP A;  4B3R C;  4EAT A;  2QVX X;  3J80 D;  3H2T A;  3I07 A;  5A1G A;  4JI4 C;  3FCC A;  4ODJ A;  1IBK C;  4MH4 A;  4DV0 C;  5AE3 A;  4JI8 C;  2Y4O A;  4GKJ C;  3DLP X;  4KHP C;  4XX2 A;  4LF8 C;  3PES A;  4G36 A;  1T5D X;  5BSR A;  4DV7 C;  1XRA A;  5DV9 A;  4DCT A;  1USP B;  2D1T A;  5BSU A;  3FCE A;  3T1Y C;  4OX9 C;  1FJG C;  2E7G A;  3R9X A;  2P2Q A;  1FUG A;  5AE2 A;  2ZM6 C;  2KZF A;  1MDB A;  2UU9 C;  1HNZ C;  5H9U A;  1BA3 A;  5LMN C;  2WP0 C;  3UOW A;  1ML8 A;  4L4Q A;  2YWC A;  3G7S A;  4DV5 C;  4LF6 C;  3NYR A;  3ETC A;  4X65 C;  4JI2 C;  1ZB9 A;  5KYT A;  3CW8 X;  2F4V C;  3IPL A;  2UXC C;  1MD9 A;  3S82 A;  4GXQ A;  1I94 C;  3J7A D;  4IZ6 A;  4DUY C;  5A1I A;  4FUQ A;  4RMN A;  4NOZ A;  1GPM A;  5A19 A;  4LF7 C;  3PRO C;  1VLA A;  2E0G A;  3GPC A;  5JRH A;  3RV2 A;  4BC9 A;  3LUS A;  3R9W A;  3VNS A;  2DYJ A;  2PN2 A;  4DV4 C;  1HR0 C;  1MXA A;  4BSZ A;  1RG9 A;  3TQI A;  4BCA A;  2PRO A;  3IEU A;  5CZX A;  3CW9 A;  2YCB A;  4DR4 C;  1PG3 A;  2D27 A;  2QL8 A;  4DV3 C;  4R0M A;  4DUZ C;  4D4I A;  1MXB A;  4DR1 C;  4DCU A;  4LF9 C;  3L95 X;  4JM1 A;  2D1Q A;  5A2Q D;  1ULT A;  5T8T A;  4D56 A;  1MXC A;  2D1S A;  4DV1 C;  4LFC C;  3DAY A;  2UXB C;  3B7W A;  4JI0 C;  4BBY A;  4RM3 A;  2UUA C;  2Y4N A;  4B3M C;  3VNQ A;  4DG8 A;  5IWA C;  3AF6 A;  1WH9 A;  5BSW A;  1V25 A;  3N2Q A;  4YY3 C;  4YHH C;  4DR2 C;  5K8F A;  1RY2 A;  4L2Z A;  5BST A;  4NXN C;  2VQE C;  3CJE A;  2P2M A;  4DCS A;  4D4G A;  1HNW C;  1HNX C;  5BSV A;  1MKY A;  4DR3 C;  1UKK A;  5AE1 A;  2AYA A;  4NDN A;  1QWI A;  1XMO C;  4JI5 C;  5FLX D;  5CZV A;  2D1R A;  4RVO A;  4B3S C;  3AF5 A;  1EGA A;  1KKG A;  2HJG A;  4LFA C;  2OPL A;  5BSM A;  3JAM D;  1N34 C;  3VNR A;  4K0B A;  4DR7 C;  4LF4 C;  1IBL C;  2P2B A;  4X66 C;  4B3T C;  2VQF C;  2BH1 X;  2VZE A;  2BJO A;  2PT7 G;  1N36 C;  1N32 C;  4DG9 A;  4JYA C;  1WF3 A;  3E7X A;  5T8S A;  5BR8 C;  1HH2 P;  1QM4 A;  2P2F A;  2UXD C;  3GKU A;  2D28 C;  4PZP A;  1N2F A;  5BUQ A;  1J5E C;  2ONF A;  3EER A;  2EGT A;  1P7L A;  2Y27 A;  4KTV A;  2CY1 A;  5LMU C;  3GR1 A;  3TUF A;  4BC7 A;  1K0R A;  3DHV A;  2VSQ A;  1T5H X;  1N33 C;  4G1I A;  3LNV A;  3LAX A;  2D7V A;  1AMU A;  1IBM C;  2ATW A;  4I9F A;  1XNQ C;  4OXI A;  4DCV A;  3A9V A;  3A4I A;  4AQY C;  4RVN A;  1MDF A;  3E7W A;  2P02 A;  3C5E A;  4ZLP A;  1O93 A;  4JI6 C;  4LFB C;  4WS9 A;  4JV5 C;  3LGX A;  3L8C A;  4G37 A;  2OPL B;  1ZB8 A;  3NI2 A;  5GTD A;  3T1H C;  1XRC A;  5IFI A;  4LE5 A;  1XMQ C;  4ZJZ A;  1XRB A;  2WD9 A;  3OTO C;  2OO4 A;  4OYC A;  4RLQ A;  4RLF A;  3EQ6 A;  1L2F A;  3R44 A;  2ASB A;  2OBV A;  2DPL A;  4LF5 C;  4GKK C;  3N54 B;  3KXW A;  2QVZ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...