1N32C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n32C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n32C02
2HJGA 1IBKC 1PA4A 2UXCC 4LFBC 3T1YC 1XNRC 2VQFC 4LFAC 4JV5C 2UUAC 4JI4C 4JI6C 1MKYA 1UKKA 1L2FA 3J81D 4JI8C 2D7VA 3JAMD 2CXCA 4DCTA 2ASBA 4JI1C 4LF8C 4DUZC 1ZB9A 1JOSA 5LMUC 1NYEA 4B3MC 2PT7G 1WH9A 1ML8A 2UXDC 2YCBA 1XMOC 1K0RA 2JMPA 2EGTA 4DV0C 1VLAA 5IWAC 1USPA 1HNWC 4YHHC 2PN2A 4DR5C 4AQYC 2E8CA 4NOZA 3J80D 4YY3C 3R9XA 4DUYC 2VQEC 1N2FA 4LF7C 1XMQC 4JI3C 1HNZC 4DV4C 4X65C 1IBMC 1USPB 2OPLA 1N36C 2UXBC 4GKKC 2F4VC 4DV6C 4DCUA 5A2QD 4DCVA 1IBLC 4JYAC 1HH2P 2E7GA 4XX2A 1KKGA 3AF6A 4K0KC 1XNQC 4DV1C 4LF4C 4B3TC 2UUCC 1I94C 4DR4C 2QL8A 3LUSA 4DR1C 1LQLA 5FLXD 4GKJC 1QWIA 4LFCC 1WF3A 4JI2C 4BSZA 4DR2C 3IEUA 2CY1A 3R9WA 1FJGC 3AF5A 4X62C 3CJEA 4X66C 4DR6C 4DV7C 4B3SC 4OX9C 2ATWA 4LF9C 2XR1A 5LMNC 4X64C 2E8FA 3OTOC 4NXMC 4DV3C 3T1HC 4MH4A 3J7AD 2ONFA 3EERA 4DV5C 1N34C 1ZB8A 4JI0C 4DV2C 4DR7C 1EGAA 2KZFA 2BJOA 4KHPC 2UU9C 4DCSA 1N32C 2HHHC 4MTNA 1N33C 2OPLB 5IT9D 4LF5C 2E5LC 3IEVA 4DR3C 2DYJA 1HR0C 1HNXC 4B3RC 4JI5C 3GKUA 3I07A 4LF6C 1J5EC 2ZM6C 5BR8C 2E8EA 2UUBC 4JI7C 4NXNC
chains in the Genus database with same CATH superfamily
2HJGA 4RVOA 2KDNA 4D4IA 5BURA 1UWDA 4IR7A 2P2JA 4FUQA 4JV5C 5KYVA 5A1IA 3UX3A 5KYTA 5K8FA 1L2FA 2P2FA 2D7VA 3PBKA 1RG9A 4DCTA 3CQ3A 3GR1A 3UX2A 5LMUC 2E0GA 2UXDC 3AY0A 3DHVA 2EGTA 1O92A 5IWAC 3NYQA 2DHMA 4I9FA 1RY2A 4NDNA 2P2QA 2NCLA 2BH1X 2QVYX 4LF7C 4JI3C 2PG1E 1IBMC 2ZTBA 1N36C 2YWCA 2F4VC 3PESA 1XS3A 5A2QD 2E7GA 3A25A 3DLPX 1KKGA 3L95X 3K6RA 2UUCC 1I94C 2QL8A 1LQLA 5FLXD 2Y4OA 4RLQA 4GKJC 2PROA 4BSZA 1PG3A 1FJGC 3IMLA 3CJEA 3LAXA 2WD9A 3ETOA 4DV7C 3FCCA 3L8CA 4DG9A 3N54B 4BC7A 4LF9C 1MDFA 2E8FA 1AMUA 1T5DX 2VZEA 4DV5C 4JI0C 4KTVA 2KZFA 2BJOA 5DV9A 4KHPC 4DCSA 3NPDA 1ULTA 3CW9A 5IFIA 3RV2A 4FUTA 1MXAA 4DR3C 1HNXC 4JI5C 3I07A 4LF6C 4TPSB 4NXNC 4ZLPA 1IBKC 1PA4A 2UXCC 5GTDA 1YJ7A 3NYRA 1MKYA 1UKKA 3J81D 4JI8C 3JAMD 2CXCA 4L4QA 5H9UA 4DUZC 2YWBA 3GR0A 4JM1A 3C5EA 2P20A 4PZPA 4PHTA 3RG2A 3S82A 1XMOC 1K0RA 5CZXA 1VLAA 1O93A 2M5HA 2ZZMA 4G36A 4NOZA 3J80D 1O9TA 3A9UA 2MCQA 2D28C 3UZ0A 1N2FA 4R1MA 2OPLA 2D1QA 4DV6C 1IB8A 3E7XA 4DCVA 3TUFA 4BCAA 1IBLC 3VNSA 4D4GA 5ADZA 4K0KC 1XDXA 1XRCA 3LUSA 1P7LA 1P4EA 2D1SA 4DR2C 3R9WA 4RLFA 4EATA 5BUQA 2QVXX 2OO4A 2QVZX 4OX9C 4DR6C 2CU6A 4ODJA 1MXBA 2JNVA 5LMNC 1VEHA 3OTOC 4NXMC 1V25A 3J7AD 4MH4A 1XRAA 2ONFA 2OBVA 4OXIA 3EERA 4I9GA 2DPLA 3LNVA 4GXQA 5BSWA 3EQ6A 5K85A 2HHHC 4MTNA 4PROC 2OPLB 5IT9D 4PUGA 1FLOA 1HR0C 1J5EC 5BR8C 4G37A 2UUBC 1MXCA 4LFBC 3T1YC 4BBYA 3E7WA 3O2EA 2UUAC 2YX1A 4JI6C 5A1GA 4D56A 2Y27A 3A4IA 2ASBA 5AE1A 3LNOA 3UEBA 4ISBA 4RVNA 2M5OA 3VNQA 1JOSA 4GXRA 4B3MC 1V26A 2PT7G 3R44A 3A9VA 1ML8A 3TR3A 2JMPA 3SO4A 4WS9A 1HNWC 1YGTA 5BSTA 4YHHC 2PN2A 4AQYC 2Y4NA 2E8CA 5JRHA 4YY3C 3R9XA 1GPMA 1V60A 4DUYC 1M6XA 2VQEC 4L7IA 1LCIA 1HNZC 1USPB 4GKKC 4DCUA 3N2QA 3LGXA 1HH2P 4XX2A 3UOWA 3AF6A 5T8TA 1XNQC 1FUGA 4DV1C 4LF4C 4DR4C 3PROC 4L2ZA 4IZ6A 1QWIA 4LFCC 1WF3A 5E7QA 3NI2A 4FTFA 3IEUA 3I08A 4X66C 3G7SA 4B3SC 1WCJA 2ATWA 1QM4A 4KTTA 2XR1A 4K0BA 3H2TA 4X64C 3T1HC 5KEIA 1N34C 1ZB8A 4DV2C 1EGAA 2AYAA 2UU9C 1N32C 5AE3A 4RM3A 4PUIA 4U5YD 4DG8A 3GKUA 3FCEA 2V7BA 5LCIA 4ZJZA 2P2BA 1XNRC 1MD9A 4G1IA 5T8SA 2VQFC 1M6XC 5AE2A 4LFAC 4JI4C 1XRBA 1MDBA 3KXWA 1PU1A 4JI1C 3TQIA 4LF8C 1ZB9A 4LE5A 4OYCA 1NYEA 2WP0C 1WH9A 4R1LA 2ZZNA 2YCBA 2D1RA 1PG4A 4DV0C 1USPA 2Z51A 3VNRA 4DR5C 1O90A 3FM7A 1XMQC 4HPVA 4D57A 5BUSA 3ETCA 4X65C 3CQ1A 4DV4C 1BA3A 3A26A 2UXBC 3TDEA 1P4EC 2KZ0A 1T5HX 4JYAC 4B3TC 4DR1C 2MMAB 4JI2C 2CY1A 5BSVA 3AF5A 4X62C 5CZVA 4PUHA 5BSMA 2MM9A 3CW8X 2P02A 2QW0X 3B7WA 2D1TA 3IPLA 4DV3C 4RM2A 1NY8A 3DAYA 4R0MA 2D27A 4DR7C 3GPCA 5A19A 4GS5A 2VSQA 4BC9A 4RMNA 3CQ2A 1N33C 4LF5C 2P2MA 2E5LC 3IEVA 4WV3A 5BSUA 2DYJA 4B3RC 1TH5A 1XHJA 5BSRA 2ZM6C 2E8EA 4JI7C
chains in the Genus database with same CATH topology
2HJGA 4RVOA 4D4IA 5BURA 4IR7A 2P2JA 4FUQA 4JV5C 5KYVA 5A1IA 5KYTA 5K8FA 1L2FA 2P2FA 2D7VA 3PBKA 1RG9A 4DCTA 3GR1A 5LMUC 2E0GA 2UXDC 3DHVA 2EGTA 1O92A 5IWAC 3NYQA 4I9FA 1RY2A 4NDNA 2P2QA 2BH1X 2QVYX 4LF7C 4JI3C 1IBMC 1N36C 2YWCA 2F4VC 3PESA 5A2QD 2E7GA 3DLPX 1KKGA 3L95X 2UUCC 1I94C 2QL8A 1LQLA 5FLXD 2Y4OA 4RLQA 4GKJC 2PROA 4BSZA 1PG3A 1FJGC 3IMLA 3CJEA 3LAXA 2WD9A 3ETOA 4DV7C 3FCCA 3L8CA 4DG9A 3N54B 4BC7A 4LF9C 1MDFA 2E8FA 1AMUA 1T5DX 2VZEA 4DV5C 4JI0C 4KTVA 2KZFA 2BJOA 5DV9A 4KHPC 4DCSA 3NPDA 1ULTA 3CW9A 5IFIA 3RV2A 4FUTA 1MXAA 4DR3C 1HNXC 4JI5C 3I07A 4LF6C 4TPSB 4NXNC 4ZLPA 1IBKC 1PA4A 2UXCC 5GTDA 1YJ7A 3NYRA 1MKYA 1UKKA 3J81D 4JI8C 3JAMD 2CXCA 4L4QA 5H9UA 4DUZC 2YWBA 3GR0A 4JM1A 3C5EA 2P20A 4PZPA 4PHTA 3RG2A 3S82A 1XMOC 1K0RA 5CZXA 1VLAA 1O93A 4G36A 4NOZA 3J80D 1O9TA 3A9UA 2D28C 3UZ0A 1N2FA 4R1MA 2OPLA 2D1QA 4DV6C 3E7XA 4DCVA 3TUFA 4BCAA 1IBLC 3VNSA 4D4GA 5ADZA 4K0KC 1XRCA 3LUSA 1P7LA 2D1SA 4DR2C 3R9WA 4RLFA 4EATA 5BUQA 2QVXX 2OO4A 2QVZX 4OX9C 4DR6C 4ODJA 1MXBA 5LMNC 3OTOC 4NXMC 1V25A 3J7AD 4MH4A 1XRAA 2ONFA 2OBVA 4OXIA 3EERA 4I9GA 2DPLA 3LNVA 4GXQA 5BSWA 3EQ6A 5K85A 2HHHC 4MTNA 4PROC 2OPLB 5IT9D 1HR0C 1J5EC 5BR8C 4G37A 2UUBC 1MXCA 4LFBC 3T1YC 4BBYA 3E7WA 2UUAC 4JI6C 5A1GA 4D56A 2Y27A 3A4IA 2ASBA 5AE1A 4ISBA 4RVNA 3VNQA 1JOSA 4GXRA 4B3MC 1V26A 2PT7G 3R44A 3A9VA 1ML8A 2JMPA 3SO4A 4WS9A 1HNWC 5BSTA 4YHHC 2PN2A 4AQYC 2Y4NA 2E8CA 5JRHA 4YY3C 3R9XA 1GPMA 4DUYC 2VQEC 4L7IA 1LCIA 1HNZC 1USPB 4GKKC 4DCUA 3N2QA 3LGXA 1HH2P 4XX2A 3UOWA 3AF6A 5T8TA 1XNQC 1FUGA 4DV1C 4LF4C 4DR4C 3PROC 4L2ZA 4IZ6A 1QWIA 4LFCC 1WF3A 5E7QA 3NI2A 4FTFA 3IEUA 3I08A 4X66C 3G7SA 4B3SC 2ATWA 1QM4A 4KTTA 2XR1A 4K0BA 3H2TA 3T1HC 4X64C 5KEIA 1N34C 1ZB8A 4DV2C 1EGAA 2AYAA 2UU9C 1N32C 5AE3A 4RM3A 4U5YD 4DG8A 3GKUA 3FCEA 2V7BA 4ZJZA 2P2BA 1XNRC 1MD9A 4G1IA 5T8SA 2VQFC 5AE2A 4LFAC 4JI4C 1XRBA 1MDBA 3KXWA 4JI1C 3TQIA 4LF8C 1ZB9A 4LE5A 4OYCA 1NYEA 2WP0C 1WH9A 4R1LA 2YCBA 2D1RA 1PG4A 4DV0C 1USPA 3VNRA 4DR5C 1O90A 1XMQC 4HPVA 4D57A 5BUSA 3ETCA 4X65C 4DV4C 1BA3A 2UXBC 3TDEA 1T5HX 4JYAC 4B3TC 4DR1C 4JI2C 2CY1A 5BSVA 4X62C 3AF5A 5CZVA 5BSMA 3CW8X 2P02A 2QW0X 3B7WA 2D1TA 3IPLA 4DV3C 4RM2A 3DAYA 4R0MA 2D27A 4DR7C 3GPCA 5A19A 4GS5A 2VSQA 4BC9A 4RMNA 1N33C 4LF5C 2P2MA 2E5LC 3IEVA 4WV3A 5BSUA 2DYJA 4B3RC 5BSRA 2ZM6C 2E8EA 4JI7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  1IBK C;  1PA4 A;  2UXC C;  4LFB C;  3T1Y C;  1XNR C;  2VQF C;  4LFA C;  4JV5 C;  2UUA C;  4JI4 C;  4JI6 C;  1MKY A;  1UKK A;  1L2F A;  3J81 D;  4JI8 C;  2D7V A;  3JAM D;  2CXC A;  4DCT A;  2ASB A;  4JI1 C;  4LF8 C;  4DUZ C;  1ZB9 A;  1JOS A;  5LMU C;  1NYE A;  4B3M C;  2PT7 G;  1WH9 A;  1ML8 A;  2UXD C;  2YCB A;  1XMO C;  1K0R A;  2JMP A;  2EGT A;  4DV0 C;  1VLA A;  5IWA C;  1USP A;  1HNW C;  4YHH C;  2PN2 A;  4DR5 C;  4AQY C;  2E8C A;  4NOZ A;  3J80 D;  4YY3 C;  3R9X A;  4DUY C;  2VQE C;  1N2F A;  4LF7 C;  1XMQ C;  4JI3 C;  1HNZ C;  4DV4 C;  4X65 C;  1IBM C;  1USP B;  2OPL A;  1N36 C;  2UXB C;  4GKK C;  2F4V C;  4DV6 C;  4DCU A;  5A2Q D;  4DCV A;  1IBL C;  4JYA C;  1HH2 P;  2E7G A;  4XX2 A;  1KKG A;  3AF6 A;  4K0K C;  1XNQ C;  4DV1 C;  4LF4 C;  4B3T C;  2UUC C;  1I94 C;  4DR4 C;  2QL8 A;  3LUS A;  4DR1 C;  1LQL A;  5FLX D;  4GKJ C;  1QWI A;  4LFC C;  1WF3 A;  4JI2 C;  4BSZ A;  4DR2 C;  3IEU A;  2CY1 A;  3R9W A;  1FJG C;  3AF5 A;  4X62 C;  3CJE A;  4X66 C;  4DR6 C;  4DV7 C;  4B3S C;  4OX9 C;  2ATW A;  4LF9 C;  2XR1 A;  5LMN C;  4X64 C;  2E8F A;  3OTO C;  4NXM C;  4DV3 C;  3T1H C;  4MH4 A;  3J7A D;  2ONF A;  3EER A;  4DV5 C;  1N34 C;  1ZB8 A;  4JI0 C;  4DV2 C;  4DR7 C;  1EGA A;  2KZF A;  2BJO A;  4KHP C;  2UU9 C;  4DCS A;  1N32 C;  2HHH C;  4MTN A;  1N33 C;  2OPL B;  5IT9 D;  4LF5 C;  2E5L C;  3IEV A;  4DR3 C;  2DYJ A;  1HR0 C;  1HNX C;  4B3R C;  4JI5 C;  3GKU A;  3I07 A;  4LF6 C;  1J5E C;  2ZM6 C;  5BR8 C;  2E8E A;  2UUB C;  4JI7 C;  4NXN C; 
#chains in the Genus database with same CATH topology
 2HJG A;  4RVO A;  2KDN A;  4D4I A;  5BUR A;  1UWD A;  4IR7 A;  2P2J A;  4FUQ A;  4JV5 C;  5KYV A;  5A1I A;  3UX3 A;  5KYT A;  5K8F A;  1L2F A;  2P2F A;  2D7V A;  3PBK A;  1RG9 A;  4DCT A;  3CQ3 A;  3GR1 A;  3UX2 A;  5LMU C;  2E0G A;  2UXD C;  3AY0 A;  3DHV A;  2EGT A;  1O92 A;  5IWA C;  3NYQ A;  2DHM A;  4I9F A;  1RY2 A;  4NDN A;  2P2Q A;  2NCL A;  2BH1 X;  2QVY X;  4LF7 C;  4JI3 C;  2PG1 E;  1IBM C;  2ZTB A;  1N36 C;  2YWC A;  2F4V C;  3PES A;  1XS3 A;  5A2Q D;  2E7G A;  3A25 A;  3DLP X;  1KKG A;  3L95 X;  3K6R A;  2UUC C;  1I94 C;  2QL8 A;  1LQL A;  5FLX D;  2Y4O A;  4RLQ A;  4GKJ C;  2PRO A;  4BSZ A;  1PG3 A;  1FJG C;  3IML A;  3CJE A;  3LAX A;  2WD9 A;  3ETO A;  4DV7 C;  3FCC A;  3L8C A;  4DG9 A;  3N54 B;  4BC7 A;  4LF9 C;  1MDF A;  2E8F A;  1AMU A;  1T5D X;  2VZE A;  4DV5 C;  4JI0 C;  4KTV A;  2KZF A;  2BJO A;  5DV9 A;  4KHP C;  4DCS A;  3NPD A;  1ULT A;  3CW9 A;  5IFI A;  3RV2 A;  4FUT A;  1MXA A;  4DR3 C;  1HNX C;  4JI5 C;  3I07 A;  4LF6 C;  4TPS B;  4NXN C;  4ZLP A;  1IBK C;  1PA4 A;  2UXC C;  5GTD A;  1YJ7 A;  3NYR A;  1MKY A;  1UKK A;  3J81 D;  4JI8 C;  3JAM D;  2CXC A;  4L4Q A;  5H9U A;  4DUZ C;  2YWB A;  3GR0 A;  4JM1 A;  3C5E A;  2P20 A;  4PZP A;  4PHT A;  3RG2 A;  3S82 A;  1XMO C;  1K0R A;  5CZX A;  1VLA A;  1O93 A;  2M5H A;  2ZZM A;  4G36 A;  4NOZ A;  3J80 D;  1O9T A;  3A9U A;  2MCQ A;  2D28 C;  3UZ0 A;  1N2F A;  4R1M A;  2OPL A;  2D1Q A;  4DV6 C;  1IB8 A;  3E7X A;  4DCV A;  3TUF A;  4BCA A;  1IBL C;  3VNS A;  4D4G A;  5ADZ A;  4K0K C;  1XDX A;  1XRC A;  3LUS A;  1P7L A;  1P4E A;  2D1S A;  4DR2 C;  3R9W A;  4RLF A;  4EAT A;  5BUQ A;  2QVX X;  2OO4 A;  2QVZ X;  4OX9 C;  4DR6 C;  2CU6 A;  4ODJ A;  1MXB A;  2JNV A;  5LMN C;  1VEH A;  3OTO C;  4NXM C;  1V25 A;  3J7A D;  4MH4 A;  1XRA A;  2ONF A;  2OBV A;  4OXI A;  3EER A;  4I9G A;  2DPL A;  3LNV A;  4GXQ A;  5BSW A;  3EQ6 A;  5K85 A;  2HHH C;  4MTN A;  4PRO C;  2OPL B;  5IT9 D;  4PUG A;  1FLO A;  1HR0 C;  1J5E C;  5BR8 C;  4G37 A;  2UUB C;  1MXC A;  4LFB C;  3T1Y C;  4BBY A;  3E7W A;  3O2E A;  2UUA C;  2YX1 A;  4JI6 C;  5A1G A;  4D56 A;  2Y27 A;  3A4I A;  2ASB A;  5AE1 A;  3LNO A;  3UEB A;  4ISB A;  4RVN A;  2M5O A;  3VNQ A;  1JOS A;  4GXR A;  4B3M C;  1V26 A;  2PT7 G;  3R44 A;  3A9V A;  1ML8 A;  3TR3 A;  2JMP A;  3SO4 A;  4WS9 A;  1HNW C;  1YGT A;  5BST A;  4YHH C;  2PN2 A;  4AQY C;  2Y4N A;  2E8C A;  5JRH A;  4YY3 C;  3R9X A;  1GPM A;  1V60 A;  4DUY C;  1M6X A;  2VQE C;  4L7I A;  1LCI A;  1HNZ C;  1USP B;  4GKK C;  4DCU A;  3N2Q A;  3LGX A;  1HH2 P;  4XX2 A;  3UOW A;  3AF6 A;  5T8T A;  1XNQ C;  1FUG A;  4DV1 C;  4LF4 C;  4DR4 C;  3PRO C;  4L2Z A;  4IZ6 A;  1QWI A;  4LFC C;  1WF3 A;  5E7Q A;  3NI2 A;  4FTF A;  3IEU A;  3I08 A;  4X66 C;  3G7S A;  4B3S C;  1WCJ A;  2ATW A;  1QM4 A;  4KTT A;  2XR1 A;  4K0B A;  3H2T A;  4X64 C;  3T1H C;  5KEI A;  1N34 C;  1ZB8 A;  4DV2 C;  1EGA A;  2AYA A;  2UU9 C;  1N32 C;  5AE3 A;  4RM3 A;  4PUI A;  4U5Y D;  4DG8 A;  3GKU A;  3FCE A;  2V7B A;  5LCI A;  4ZJZ A;  2P2B A;  1XNR C;  1MD9 A;  4G1I A;  5T8S A;  2VQF C;  1M6X C;  5AE2 A;  4LFA C;  4JI4 C;  1XRB A;  1MDB A;  3KXW A;  1PU1 A;  4JI1 C;  3TQI A;  4LF8 C;  1ZB9 A;  4LE5 A;  4OYC A;  1NYE A;  2WP0 C;  1WH9 A;  4R1L A;  2ZZN A;  2YCB A;  2D1R A;  1PG4 A;  4DV0 C;  1USP A;  2Z51 A;  3VNR A;  4DR5 C;  1O90 A;  3FM7 A;  1XMQ C;  4HPV A;  4D57 A;  5BUS A;  3ETC A;  4X65 C;  3CQ1 A;  4DV4 C;  1BA3 A;  3A26 A;  2UXB C;  3TDE A;  1P4E C;  2KZ0 A;  1T5H X;  4JYA C;  4B3T C;  4DR1 C;  2MMA B;  4JI2 C;  2CY1 A;  5BSV A;  3AF5 A;  4X62 C;  5CZV A;  4PUH A;  5BSM A;  2MM9 A;  3CW8 X;  2P02 A;  2QW0 X;  3B7W A;  2D1T A;  3IPL A;  4DV3 C;  4RM2 A;  1NY8 A;  3DAY A;  4R0M A;  2D27 A;  4DR7 C;  3GPC A;  5A19 A;  4GS5 A;  2VSQ A;  4BC9 A;  4RMN A;  3CQ2 A;  1N33 C;  4LF5 C;  2P2M A;  2E5L C;  3IEV A;  4WV3 A;  5BSU A;  2DYJ A;  4B3R C;  1TH5 A;  1XHJ A;  5BSR A;  2ZM6 C;  2E8E A;  4JI7 C; 
#chains in the Genus database with same CATH homology
 2HJG A;  4RVO A;  4D4I A;  5BUR A;  4IR7 A;  2P2J A;  4FUQ A;  4JV5 C;  5KYV A;  5A1I A;  5KYT A;  5K8F A;  1L2F A;  2P2F A;  2D7V A;  3PBK A;  1RG9 A;  4DCT A;  3GR1 A;  5LMU C;  2E0G A;  2UXD C;  3DHV A;  2EGT A;  1O92 A;  5IWA C;  3NYQ A;  4I9F A;  1RY2 A;  4NDN A;  2P2Q A;  2BH1 X;  2QVY X;  4LF7 C;  4JI3 C;  1IBM C;  1N36 C;  2YWC A;  2F4V C;  3PES A;  5A2Q D;  2E7G A;  3DLP X;  1KKG A;  3L95 X;  2UUC C;  1I94 C;  2QL8 A;  1LQL A;  5FLX D;  2Y4O A;  4RLQ A;  4GKJ C;  2PRO A;  4BSZ A;  1PG3 A;  1FJG C;  3IML A;  3CJE A;  3LAX A;  2WD9 A;  3ETO A;  4DV7 C;  3FCC A;  3L8C A;  4DG9 A;  3N54 B;  4BC7 A;  4LF9 C;  1MDF A;  2E8F A;  1AMU A;  1T5D X;  2VZE A;  4DV5 C;  4JI0 C;  4KTV A;  2KZF A;  2BJO A;  5DV9 A;  4KHP C;  4DCS A;  3NPD A;  1ULT A;  3CW9 A;  5IFI A;  3RV2 A;  4FUT A;  1MXA A;  4DR3 C;  1HNX C;  4JI5 C;  3I07 A;  4LF6 C;  4TPS B;  4NXN C;  4ZLP A;  1IBK C;  1PA4 A;  2UXC C;  5GTD A;  1YJ7 A;  3NYR A;  1MKY A;  1UKK A;  3J81 D;  4JI8 C;  3JAM D;  2CXC A;  4L4Q A;  5H9U A;  4DUZ C;  2YWB A;  3GR0 A;  4JM1 A;  3C5E A;  2P20 A;  4PZP A;  4PHT A;  3RG2 A;  3S82 A;  1XMO C;  1K0R A;  5CZX A;  1VLA A;  1O93 A;  4G36 A;  4NOZ A;  3J80 D;  1O9T A;  3A9U A;  2D28 C;  3UZ0 A;  1N2F A;  4R1M A;  2OPL A;  2D1Q A;  4DV6 C;  3E7X A;  4DCV A;  3TUF A;  4BCA A;  1IBL C;  3VNS A;  4D4G A;  5ADZ A;  4K0K C;  1XRC A;  3LUS A;  1P7L A;  2D1S A;  4DR2 C;  3R9W A;  4RLF A;  4EAT A;  5BUQ A;  2QVX X;  2OO4 A;  2QVZ X;  4OX9 C;  4DR6 C;  4ODJ A;  1MXB A;  5LMN C;  3OTO C;  4NXM C;  1V25 A;  3J7A D;  4MH4 A;  1XRA A;  2ONF A;  2OBV A;  4OXI A;  3EER A;  4I9G A;  2DPL A;  3LNV A;  4GXQ A;  5BSW A;  3EQ6 A;  5K85 A;  2HHH C;  4MTN A;  4PRO C;  2OPL B;  5IT9 D;  1HR0 C;  1J5E C;  5BR8 C;  4G37 A;  2UUB C;  1MXC A;  4LFB C;  3T1Y C;  4BBY A;  3E7W A;  2UUA C;  4JI6 C;  5A1G A;  4D56 A;  2Y27 A;  3A4I A;  2ASB A;  5AE1 A;  4ISB A;  4RVN A;  3VNQ A;  1JOS A;  4GXR A;  4B3M C;  1V26 A;  2PT7 G;  3R44 A;  3A9V A;  1ML8 A;  2JMP A;  3SO4 A;  4WS9 A;  1HNW C;  5BST A;  4YHH C;  2PN2 A;  4AQY C;  2Y4N A;  2E8C A;  5JRH A;  4YY3 C;  3R9X A;  1GPM A;  4DUY C;  2VQE C;  4L7I A;  1LCI A;  1HNZ C;  1USP B;  4GKK C;  4DCU A;  3N2Q A;  3LGX A;  1HH2 P;  4XX2 A;  3UOW A;  3AF6 A;  5T8T A;  1XNQ C;  1FUG A;  4DV1 C;  4LF4 C;  4DR4 C;  3PRO C;  4L2Z A;  4IZ6 A;  1QWI A;  4LFC C;  1WF3 A;  5E7Q A;  3NI2 A;  4FTF A;  3IEU A;  3I08 A;  4X66 C;  3G7S A;  4B3S C;  2ATW A;  1QM4 A;  4KTT A;  2XR1 A;  4K0B A;  3H2T A;  3T1H C;  4X64 C;  5KEI A;  1N34 C;  1ZB8 A;  4DV2 C;  1EGA A;  2AYA A;  2UU9 C;  1N32 C;  5AE3 A;  4RM3 A;  4U5Y D;  4DG8 A;  3GKU A;  3FCE A;  2V7B A;  4ZJZ A;  2P2B A;  1XNR C;  1MD9 A;  4G1I A;  5T8S A;  2VQF C;  5AE2 A;  4LFA C;  4JI4 C;  1XRB A;  1MDB A;  3KXW A;  4JI1 C;  3TQI A;  4LF8 C;  1ZB9 A;  4LE5 A;  4OYC A;  1NYE A;  2WP0 C;  1WH9 A;  4R1L A;  2YCB A;  2D1R A;  1PG4 A;  4DV0 C;  1USP A;  3VNR A;  4DR5 C;  1O90 A;  1XMQ C;  4HPV A;  4D57 A;  5BUS A;  3ETC A;  4X65 C;  4DV4 C;  1BA3 A;  2UXB C;  3TDE A;  1T5H X;  4JYA C;  4B3T C;  4DR1 C;  4JI2 C;  2CY1 A;  5BSV A;  4X62 C;  3AF5 A;  5CZV A;  5BSM A;  3CW8 X;  2P02 A;  2QW0 X;  3B7W A;  2D1T A;  3IPL A;  4DV3 C;  4RM2 A;  3DAY A;  4R0M A;  2D27 A;  4DR7 C;  3GPC A;  5A19 A;  4GS5 A;  2VSQ A;  4BC9 A;  4RMN A;  1N33 C;  4LF5 C;  2P2M A;  2E5L C;  3IEV A;  4WV3 A;  5BSU A;  2DYJ A;  4B3R C;  5BSR A;  2ZM6 C;  2E8E A;  4JI7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...