1N32C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n32C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n32C02
4AQYC 2E8CA 4JV5C 5IWAC 4DCTA 2UU9C 2ZM6C 4X62C 4DR6C 4JI6C 2ONFA 1N36C 1HNWC 1LQLA 4B3MC 3T1HC 4K0KC 4NOZA 2HJGA 2QL8A 4JI8C 1JOSA 4DR5C 2KZFA 4YHHC 1I94C 2BJOA 1FJGC 1QWIA 1HH2P 3OTOC 2EGTA 4DUZC 4DR3C 4B3RC 3T1YC 4YY3C 4KHPC 4X65C 2OPLA 1HNZC 4NXNC 2UXDC 2OPLB 4DCVA 1UKKA 4LF7C 4LF6C 2UUAC 4DR2C 3I07A 5BR8C 2ASBA 1XMQC 3EERA 2UUBC 5LMNC 2E8FA 4DV0C 4LF8C 2YCBA 4JI4C 2UUCC 1XNQC 1PA4A 4JI7C 3AF5A 1ZB9A 4MH4A 1NYEA 4DV3C 4DUYC 4LFBC 5IT9D 1WH9A 1J5EC 4JI5C 4LFCC 4JI3C 4NXMC 3IEVA 4DV1C 4XX2A 4DCUA 3J80D 3R9XA 1N34C 4DR7C 1IBKC 3JAMD 1N32C 4B3TC 4DV4C 4B3SC 4BSZA 4DV7C 1KKGA 5A2QD 1MKYA 4JI0C 4GKKC 4LF5C 4DR1C 4DV5C 3GKUA 2PT7G 3LUSA 4MTNA 3R9WA 4DR4C 1L2FA 4X64C 2DYJA 2ATWA 2UXCC 2D7VA 4DV2C 2XR1A 1IBMC 4DCSA 3AF6A 2VQFC 4X66C 1USPA 1USPB 2CY1A 4JYAC 3J81D 1XNRC 5LMUC 4DV6C 2UXBC 2F4VC 4OX9C 2E5LC 4LF9C 1K0RA 1HNXC 5FLXD 1IBLC 3J7AD 2PN2A 1WF3A 4LF4C 1N33C 2HHHC 2VQEC 4LFAC 1VLAA 2CXCA 4GKJC 1HR0C 1ZB8A 2E8EA 4JI1C 3IEUA 1ML8A 1XMOC 2JMPA 4JI2C 3CJEA 2E7GA 1N2FA 1EGAA
chains in the Genus database with same CATH superfamily
4PUGA 4JV5C 4DCTA 4DR6C 1LQLA 2D1SA 4NOZA 5E7QA 1JOSA 1FJGC 4TPSB 3OTOC 3A4IA 4YY3C 2AYAA 3NYQA 1HNZC 3DLPX 2UXDC 2QVZX 2OPLB 4LF7C 1IB8A 2M5OA 5BSRA 2PG1E 2E8FA 3LNVA 1P7LA 1BA3A 3E7XA 4DUYC 1PG4A 2E0GA 3B7WA 3I08A 1V26A 4LFCC 4JI3C 4NXMC 2ZTBA 4DR7C 2DPLA 3VNRA 4LE5A 4B3TC 2P2JA 2P2BA 5A2QD 3GR0A 4LF5C 1PU1A 2PT7G 1XRCA 3LUSA 4MTNA 3R9WA 5BSMA 2BH1X 4DR4C 4RVOA 5A19A 2ATWA 2D7VA 1XRBA 4DCSA 5CZVA 4X66C 3UEBA 3L95X 4RMNA 1NY8A 1USPB 3CQ1A 2QW0X 4FUTA 2E5LC 1K0RA 2M5HA 3A25A 3PBKA 1IBLC 3J7AD 3N2QA 4LF4C 1WF3A 2Y27A 1VLAA 4FUQA 3KXWA 4GKJC 1V60A 3CQ2A 1HR0C 1ZB8A 4RM3A 4JI1C 3CJEA 3SO4A 2NCLA 3FCEA 2MM9A 5CZXA 3LAXA 5KYTA 4B3MC 3T1HC 4K0KC 2HJGA 2QL8A 1TH5A 1O90A 3EQ6A 2KZFA 1I94C 2BJOA 2D1RA 3FCCA 1HH2P 5AE3A 4DUZC 4DR3C 4ISBA 5K8FA 2OPLA 2KZ0A 4D56A 4DCVA 2UUAC 4G37A 4RLQA 5GTDA 1MXCA 4R1LA 2UUBC 5LMNC 4OYCA 4DV0C 4EATA 4LF8C 4I9FA 4JI4C 1XS3A 1PA4A 2Y4NA 1ZB9A 3ETOA 1RG9A 4JM1A 5IT9D 1MXBA 4JI5C 2ZZNA 1O93A 4D4IA 2DHMA 2D1QA 1N34C 4BBYA 3NPDA 3PESA 1RY2A 3TR3A 4DV4C 4BSZA 4DV7C 1FLOA 4JI0C 4GKKC 3R44A 4DG8A 1L2FA 2V7BA 4X64C 3PROC 4HPVA 5LCIA 2QVYX 5BUQA 2PROA 3UOWA 1USPA 2CU6A 5BURA 5BSTA 1P4EC 3A9UA 1MDFA 4OX9C 1HNXC 5FLXD 2YWBA 2MMAB 2HHHC 1FUGA 2VQEC 2KDNA 4D57A 4PROC 2E8EA 2JMPA 4GXQA 5JRHA 5BSUA 1EGAA 4AQYC 3GR1A 2Z51A 4GXRA 3UX2A 4X62C 2ZM6C 2OO4A 5A1GA 4JI6C 4RVNA 2ONFA 1O92A 2WD9A 1XRAA 5T8TA 4JI8C 3RV2A 4GS5A 4KTTA 4PUIA 2OBVA 1QWIA 2EGTA 4B3RC 4KHPC 4ZJZA 4OXIA 4DR2C 1YJ7A 3I07A 5BR8C 1XMQC 5BSWA 4PZPA 2YCBA 1GPMA 2UUCC 3LNOA 5AE2A 4JI7C 5IFIA 2P2MA 4MH4A 1NYEA 4LFBC 1J5EC 3IEVA 4XX2A 4DCUA 3R9XA 3IMLA 1IBKC 4R1MA 3VNSA 4K0BA 1PG3A 4B3SC 1KKGA 2VZEA 3A26A 4DV5C 4DR1C 2P20A 4G36A 5BSVA 1AMUA 5A1IA 2UXCC 4DV2C 3UX3A 2XR1A 2VQFC 3GPCA 3NI2A 3UZ0A 1LCIA 4WS9A 3H2TA 1YGTA 3J81D 4IR7A 5LMUC 4DV6C 1UWDA 3TUFA 4LF9C 3AY0A 3O2EA 4I9GA 4PHTA 2Y4OA 3CQ3A 4LFAC 1T5DX 4U5YD 5ADZA 4BCAA 4L7IA 1T5HX 2MCQA 3C5EA 4IZ6A 3E7WA 4NDNA 3IEUA 2P2FA 4JI2C 1XHJA 1WCJA 2E7GA 2D27A 2E8CA 2VSQA 5IWAC 4PUHA 2UU9C 5AE1A 1N36C 2JNVA 1HNWC 2WP0C 4DR5C 4YHHC 4G1IA 4RLFA 3T1YC 1O9TA 5T8SA 4X65C 4NXNC 2ZZMA 3ETCA 1UKKA 4LF6C 3G7SA 4RM2A 4D4GA 4R0MA 4L4QA 3VNQA 2ASBA 3EERA 1P4EA 4ODJA 4WV3A 4BC7A 3TQIA 1XNQC 1M6XC 3AF5A 4FTFA 3LGXA 4BC9A 4DV3C 1WH9A 3NYRA 1XDXA 1MXAA 2YX1A 4DV1C 3J80D 4L2ZA 3TDEA 3CW9A 3JAMD 1N32C 3S82A 1MD9A 1MDBA 1MKYA 4KTVA 3GKUA 3L8CA 2DYJA 1V25A 1M6XA 3K6RA 5KYVA 1IBMC 5K85A 3A9VA 3AF6A 1QM4A 1ULTA 2P02A 5BUSA 2CY1A 4JYAC 2YWCA 1XNRC 3DAYA 1VEHA 2UXBC 3IPLA 2QVXX 3CW8X 2F4VC 4DG9A 5H9UA 2D28C 2PN2A 1N33C 2P2QA 3DHVA 4ZLPA 2CXCA 3RG2A 2D1TA 3FM7A 5KEIA 3N54B 1ML8A 1XMOC 5DV9A 1N2FA
chains in the Genus database with same CATH topology
4JV5C 4DCTA 4DR6C 1LQLA 2D1SA 4NOZA 5E7QA 1JOSA 1FJGC 4TPSB 3OTOC 3A4IA 4YY3C 2AYAA 3NYQA 1HNZC 3DLPX 2UXDC 2QVZX 2OPLB 4LF7C 5BSRA 2E8FA 3LNVA 1P7LA 1BA3A 3E7XA 4DUYC 1PG4A 2E0GA 3B7WA 3I08A 1V26A 4LFCC 4JI3C 4NXMC 4DR7C 2DPLA 3VNRA 4LE5A 4B3TC 2P2JA 2P2BA 5A2QD 3GR0A 4LF5C 2PT7G 1XRCA 3LUSA 4MTNA 3R9WA 5BSMA 2BH1X 4DR4C 4RVOA 5A19A 2ATWA 2D7VA 1XRBA 4DCSA 5CZVA 4X66C 3L95X 4RMNA 1USPB 2QW0X 4FUTA 2E5LC 1K0RA 3PBKA 1IBLC 3J7AD 3N2QA 4LF4C 1WF3A 2Y27A 1VLAA 4FUQA 3KXWA 4GKJC 1HR0C 1ZB8A 4RM3A 4JI1C 3CJEA 3SO4A 3FCEA 5CZXA 3LAXA 5KYTA 4B3MC 3T1HC 4K0KC 2HJGA 2QL8A 1O90A 3EQ6A 2KZFA 1I94C 2BJOA 2D1RA 3FCCA 1HH2P 5AE3A 4DUZC 4DR3C 4ISBA 5K8FA 2OPLA 4D56A 4DCVA 2UUAC 4G37A 4RLQA 5GTDA 1MXCA 4R1LA 2UUBC 5LMNC 4OYCA 4DV0C 4EATA 4LF8C 4I9FA 4JI4C 1PA4A 2Y4NA 1ZB9A 3ETOA 1RG9A 4JM1A 5IT9D 1MXBA 4JI5C 1O93A 4D4IA 2D1QA 1N34C 4BBYA 3NPDA 3PESA 1RY2A 4DV4C 4BSZA 4DV7C 4JI0C 4GKKC 3R44A 4DG8A 1L2FA 2V7BA 4X64C 3PROC 4HPVA 2QVYX 5BUQA 2PROA 3UOWA 1USPA 5BURA 5BSTA 3A9UA 1MDFA 4OX9C 1HNXC 5FLXD 2YWBA 2HHHC 1FUGA 2VQEC 4D57A 4PROC 2E8EA 2JMPA 4GXQA 5JRHA 5BSUA 1EGAA 4AQYC 3GR1A 4GXRA 2ZM6C 4X62C 2OO4A 5A1GA 4JI6C 4RVNA 2ONFA 1O92A 2WD9A 1XRAA 5T8TA 4JI8C 3RV2A 4GS5A 4KTTA 2OBVA 1QWIA 2EGTA 4B3RC 4KHPC 4ZJZA 4OXIA 4DR2C 1YJ7A 3I07A 5BR8C 1XMQC 5BSWA 4PZPA 2YCBA 1GPMA 2UUCC 5AE2A 4JI7C 5IFIA 2P2MA 4MH4A 1NYEA 4LFBC 1J5EC 3IEVA 4XX2A 4DCUA 3R9XA 3IMLA 1IBKC 4R1MA 3VNSA 4K0BA 1PG3A 4B3SC 1KKGA 2VZEA 4DR1C 4DV5C 2P20A 4G36A 5BSVA 1AMUA 5A1IA 2UXCC 4DV2C 2XR1A 2VQFC 3GPCA 3NI2A 3UZ0A 1LCIA 4WS9A 3H2TA 3J81D 4IR7A 5LMUC 4DV6C 3TUFA 4LF9C 4I9GA 4PHTA 2Y4OA 4LFAC 1T5DX 4U5YD 5ADZA 4BCAA 4L7IA 1T5HX 3C5EA 4IZ6A 3E7WA 4NDNA 3IEUA 2P2FA 4JI2C 2E7GA 2D27A 2E8CA 2VSQA 5IWAC 2UU9C 5AE1A 1N36C 1HNWC 2WP0C 4DR5C 4YHHC 4G1IA 4RLFA 3T1YC 1O9TA 5T8SA 4X65C 4NXNC 3ETCA 1UKKA 4LF6C 3G7SA 4RM2A 4D4GA 4R0MA 4L4QA 3VNQA 2ASBA 3EERA 4ODJA 4WV3A 4BC7A 3TQIA 1XNQC 3AF5A 4FTFA 3LGXA 4BC9A 4DV3C 1WH9A 3NYRA 1MXAA 4DV1C 3J80D 4L2ZA 3TDEA 3CW9A 3JAMD 1N32C 3S82A 1MD9A 1MDBA 1MKYA 4KTVA 3GKUA 3L8CA 2DYJA 1V25A 5KYVA 1IBMC 5K85A 3A9VA 3AF6A 1QM4A 1ULTA 2P02A 5BUSA 2CY1A 4JYAC 2YWCA 1XNRC 3DAYA 2UXBC 3IPLA 2QVXX 3CW8X 2F4VC 4DG9A 5H9UA 2D28C 2PN2A 1N33C 2P2QA 3DHVA 4ZLPA 2CXCA 3RG2A 2D1TA 5KEIA 3N54B 1ML8A 1XMOC 5DV9A 1N2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY C;  2E8C A;  4JV5 C;  5IWA C;  4DCT A;  2UU9 C;  2ZM6 C;  4X62 C;  4DR6 C;  4JI6 C;  2ONF A;  1N36 C;  1HNW C;  1LQL A;  4B3M C;  3T1H C;  4K0K C;  4NOZ A;  2HJG A;  2QL8 A;  4JI8 C;  1JOS A;  4DR5 C;  2KZF A;  4YHH C;  1I94 C;  2BJO A;  1FJG C;  1QWI A;  1HH2 P;  3OTO C;  2EGT A;  4DUZ C;  4DR3 C;  4B3R C;  3T1Y C;  4YY3 C;  4KHP C;  4X65 C;  2OPL A;  1HNZ C;  4NXN C;  2UXD C;  2OPL B;  4DCV A;  1UKK A;  4LF7 C;  4LF6 C;  2UUA C;  4DR2 C;  3I07 A;  5BR8 C;  2ASB A;  1XMQ C;  3EER A;  2UUB C;  5LMN C;  2E8F A;  4DV0 C;  4LF8 C;  2YCB A;  4JI4 C;  2UUC C;  1XNQ C;  1PA4 A;  4JI7 C;  3AF5 A;  1ZB9 A;  4MH4 A;  1NYE A;  4DV3 C;  4DUY C;  4LFB C;  5IT9 D;  1WH9 A;  1J5E C;  4JI5 C;  4LFC C;  4JI3 C;  4NXM C;  3IEV A;  4DV1 C;  4XX2 A;  4DCU A;  3J80 D;  3R9X A;  1N34 C;  4DR7 C;  1IBK C;  3JAM D;  1N32 C;  4B3T C;  4DV4 C;  4B3S C;  4BSZ A;  4DV7 C;  1KKG A;  5A2Q D;  1MKY A;  4JI0 C;  4GKK C;  4LF5 C;  4DR1 C;  4DV5 C;  3GKU A;  2PT7 G;  3LUS A;  4MTN A;  3R9W A;  4DR4 C;  1L2F A;  4X64 C;  2DYJ A;  2ATW A;  2UXC C;  2D7V A;  4DV2 C;  2XR1 A;  1IBM C;  4DCS A;  3AF6 A;  2VQF C;  4X66 C;  1USP A;  1USP B;  2CY1 A;  4JYA C;  3J81 D;  1XNR C;  5LMU C;  4DV6 C;  2UXB C;  2F4V C;  4OX9 C;  2E5L C;  4LF9 C;  1K0R A;  1HNX C;  5FLX D;  1IBL C;  3J7A D;  2PN2 A;  1WF3 A;  4LF4 C;  1N33 C;  2HHH C;  2VQE C;  4LFA C;  1VLA A;  2CXC A;  4GKJ C;  1HR0 C;  1ZB8 A;  2E8E A;  4JI1 C;  3IEU A;  1ML8 A;  1XMO C;  2JMP A;  4JI2 C;  3CJE A;  2E7G A;  1N2F A;  1EGA A; 
#chains in the Genus database with same CATH topology
 4PUG A;  4JV5 C;  4DCT A;  4DR6 C;  1LQL A;  2D1S A;  4NOZ A;  5E7Q A;  1JOS A;  1FJG C;  4TPS B;  3OTO C;  3A4I A;  4YY3 C;  2AYA A;  3NYQ A;  1HNZ C;  3DLP X;  2UXD C;  2QVZ X;  2OPL B;  4LF7 C;  1IB8 A;  2M5O A;  5BSR A;  2PG1 E;  2E8F A;  3LNV A;  1P7L A;  1BA3 A;  3E7X A;  4DUY C;  1PG4 A;  2E0G A;  3B7W A;  3I08 A;  1V26 A;  4LFC C;  4JI3 C;  4NXM C;  2ZTB A;  4DR7 C;  2DPL A;  3VNR A;  4LE5 A;  4B3T C;  2P2J A;  2P2B A;  5A2Q D;  3GR0 A;  4LF5 C;  1PU1 A;  2PT7 G;  1XRC A;  3LUS A;  4MTN A;  3R9W A;  5BSM A;  2BH1 X;  4DR4 C;  4RVO A;  5A19 A;  2ATW A;  2D7V A;  1XRB A;  4DCS A;  5CZV A;  4X66 C;  3UEB A;  3L95 X;  4RMN A;  1NY8 A;  1USP B;  3CQ1 A;  2QW0 X;  4FUT A;  2E5L C;  1K0R A;  2M5H A;  3A25 A;  3PBK A;  1IBL C;  3J7A D;  3N2Q A;  4LF4 C;  1WF3 A;  2Y27 A;  1VLA A;  4FUQ A;  3KXW A;  4GKJ C;  1V60 A;  3CQ2 A;  1HR0 C;  1ZB8 A;  4RM3 A;  4JI1 C;  3CJE A;  3SO4 A;  2NCL A;  3FCE A;  2MM9 A;  5CZX A;  3LAX A;  5KYT A;  4B3M C;  3T1H C;  4K0K C;  2HJG A;  2QL8 A;  1TH5 A;  1O90 A;  3EQ6 A;  2KZF A;  1I94 C;  2BJO A;  2D1R A;  3FCC A;  1HH2 P;  5AE3 A;  4DUZ C;  4DR3 C;  4ISB A;  5K8F A;  2OPL A;  2KZ0 A;  4D56 A;  4DCV A;  2UUA C;  4G37 A;  4RLQ A;  5GTD A;  1MXC A;  4R1L A;  2UUB C;  5LMN C;  4OYC A;  4DV0 C;  4EAT A;  4LF8 C;  4I9F A;  4JI4 C;  1XS3 A;  1PA4 A;  2Y4N A;  1ZB9 A;  3ETO A;  1RG9 A;  4JM1 A;  5IT9 D;  1MXB A;  4JI5 C;  2ZZN A;  1O93 A;  4D4I A;  2DHM A;  2D1Q A;  1N34 C;  4BBY A;  3NPD A;  3PES A;  1RY2 A;  3TR3 A;  4DV4 C;  4BSZ A;  4DV7 C;  1FLO A;  4JI0 C;  4GKK C;  3R44 A;  4DG8 A;  1L2F A;  2V7B A;  4X64 C;  3PRO C;  4HPV A;  5LCI A;  2QVY X;  5BUQ A;  2PRO A;  3UOW A;  1USP A;  2CU6 A;  5BUR A;  5BST A;  1P4E C;  3A9U A;  1MDF A;  4OX9 C;  1HNX C;  5FLX D;  2YWB A;  2MMA B;  2HHH C;  1FUG A;  2VQE C;  2KDN A;  4D57 A;  4PRO C;  2E8E A;  2JMP A;  4GXQ A;  5JRH A;  5BSU A;  1EGA A;  4AQY C;  3GR1 A;  2Z51 A;  4GXR A;  3UX2 A;  4X62 C;  2ZM6 C;  2OO4 A;  5A1G A;  4JI6 C;  4RVN A;  2ONF A;  1O92 A;  2WD9 A;  1XRA A;  5T8T A;  4JI8 C;  3RV2 A;  4GS5 A;  4KTT A;  4PUI A;  2OBV A;  1QWI A;  2EGT A;  4B3R C;  4KHP C;  4ZJZ A;  4OXI A;  4DR2 C;  1YJ7 A;  3I07 A;  5BR8 C;  1XMQ C;  5BSW A;  4PZP A;  2YCB A;  1GPM A;  2UUC C;  3LNO A;  5AE2 A;  4JI7 C;  5IFI A;  2P2M A;  4MH4 A;  1NYE A;  4LFB C;  1J5E C;  3IEV A;  4XX2 A;  4DCU A;  3R9X A;  3IML A;  1IBK C;  4R1M A;  3VNS A;  4K0B A;  1PG3 A;  4B3S C;  1KKG A;  2VZE A;  3A26 A;  4DV5 C;  4DR1 C;  2P20 A;  4G36 A;  5BSV A;  1AMU A;  5A1I A;  2UXC C;  4DV2 C;  3UX3 A;  2XR1 A;  2VQF C;  3GPC A;  3NI2 A;  3UZ0 A;  1LCI A;  4WS9 A;  3H2T A;  1YGT A;  3J81 D;  4IR7 A;  5LMU C;  4DV6 C;  1UWD A;  3TUF A;  4LF9 C;  3AY0 A;  3O2E A;  4I9G A;  4PHT A;  2Y4O A;  3CQ3 A;  4LFA C;  1T5D X;  4U5Y D;  5ADZ A;  4BCA A;  4L7I A;  1T5H X;  2MCQ A;  3C5E A;  4IZ6 A;  3E7W A;  4NDN A;  3IEU A;  2P2F A;  4JI2 C;  1XHJ A;  1WCJ A;  2E7G A;  2D27 A;  2E8C A;  2VSQ A;  5IWA C;  4PUH A;  2UU9 C;  5AE1 A;  1N36 C;  2JNV A;  1HNW C;  2WP0 C;  4DR5 C;  4YHH C;  4G1I A;  4RLF A;  3T1Y C;  1O9T A;  5T8S A;  4X65 C;  4NXN C;  2ZZM A;  3ETC A;  1UKK A;  4LF6 C;  3G7S A;  4RM2 A;  4D4G A;  4R0M A;  4L4Q A;  3VNQ A;  2ASB A;  3EER A;  1P4E A;  4ODJ A;  4WV3 A;  4BC7 A;  3TQI A;  1XNQ C;  1M6X C;  3AF5 A;  4FTF A;  3LGX A;  4BC9 A;  4DV3 C;  1WH9 A;  3NYR A;  1XDX A;  1MXA A;  2YX1 A;  4DV1 C;  3J80 D;  4L2Z A;  3TDE A;  3CW9 A;  3JAM D;  1N32 C;  3S82 A;  1MD9 A;  1MDB A;  1MKY A;  4KTV A;  3GKU A;  3L8C A;  2DYJ A;  1V25 A;  1M6X A;  3K6R A;  5KYV A;  1IBM C;  5K85 A;  3A9V A;  3AF6 A;  1QM4 A;  1ULT A;  2P02 A;  5BUS A;  2CY1 A;  4JYA C;  2YWC A;  1XNR C;  3DAY A;  1VEH A;  2UXB C;  3IPL A;  2QVX X;  3CW8 X;  2F4V C;  4DG9 A;  5H9U A;  2D28 C;  2PN2 A;  1N33 C;  2P2Q A;  3DHV A;  4ZLP A;  2CXC A;  3RG2 A;  2D1T A;  3FM7 A;  5KEI A;  3N54 B;  1ML8 A;  1XMO C;  5DV9 A;  1N2F A; 
#chains in the Genus database with same CATH homology
 4JV5 C;  4DCT A;  4DR6 C;  1LQL A;  2D1S A;  4NOZ A;  5E7Q A;  1JOS A;  1FJG C;  4TPS B;  3OTO C;  3A4I A;  4YY3 C;  2AYA A;  3NYQ A;  1HNZ C;  3DLP X;  2UXD C;  2QVZ X;  2OPL B;  4LF7 C;  5BSR A;  2E8F A;  3LNV A;  1P7L A;  1BA3 A;  3E7X A;  4DUY C;  1PG4 A;  2E0G A;  3B7W A;  3I08 A;  1V26 A;  4LFC C;  4JI3 C;  4NXM C;  4DR7 C;  2DPL A;  3VNR A;  4LE5 A;  4B3T C;  2P2J A;  2P2B A;  5A2Q D;  3GR0 A;  4LF5 C;  2PT7 G;  1XRC A;  3LUS A;  4MTN A;  3R9W A;  5BSM A;  2BH1 X;  4DR4 C;  4RVO A;  5A19 A;  2ATW A;  2D7V A;  1XRB A;  4DCS A;  5CZV A;  4X66 C;  3L95 X;  4RMN A;  1USP B;  2QW0 X;  4FUT A;  2E5L C;  1K0R A;  3PBK A;  1IBL C;  3J7A D;  3N2Q A;  4LF4 C;  1WF3 A;  2Y27 A;  1VLA A;  4FUQ A;  3KXW A;  4GKJ C;  1HR0 C;  1ZB8 A;  4RM3 A;  4JI1 C;  3CJE A;  3SO4 A;  3FCE A;  5CZX A;  3LAX A;  5KYT A;  4B3M C;  3T1H C;  4K0K C;  2HJG A;  2QL8 A;  1O90 A;  3EQ6 A;  2KZF A;  1I94 C;  2BJO A;  2D1R A;  3FCC A;  1HH2 P;  5AE3 A;  4DUZ C;  4DR3 C;  4ISB A;  5K8F A;  2OPL A;  4D56 A;  4DCV A;  2UUA C;  4G37 A;  4RLQ A;  5GTD A;  1MXC A;  4R1L A;  2UUB C;  5LMN C;  4OYC A;  4DV0 C;  4EAT A;  4LF8 C;  4I9F A;  4JI4 C;  1PA4 A;  2Y4N A;  1ZB9 A;  3ETO A;  1RG9 A;  4JM1 A;  5IT9 D;  1MXB A;  4JI5 C;  1O93 A;  4D4I A;  2D1Q A;  1N34 C;  4BBY A;  3NPD A;  3PES A;  1RY2 A;  4DV4 C;  4BSZ A;  4DV7 C;  4JI0 C;  4GKK C;  3R44 A;  4DG8 A;  1L2F A;  2V7B A;  4X64 C;  3PRO C;  4HPV A;  2QVY X;  5BUQ A;  2PRO A;  3UOW A;  1USP A;  5BUR A;  5BST A;  3A9U A;  1MDF A;  4OX9 C;  1HNX C;  5FLX D;  2YWB A;  2HHH C;  1FUG A;  2VQE C;  4D57 A;  4PRO C;  2E8E A;  2JMP A;  4GXQ A;  5JRH A;  5BSU A;  1EGA A;  4AQY C;  3GR1 A;  4GXR A;  2ZM6 C;  4X62 C;  2OO4 A;  5A1G A;  4JI6 C;  4RVN A;  2ONF A;  1O92 A;  2WD9 A;  1XRA A;  5T8T A;  4JI8 C;  3RV2 A;  4GS5 A;  4KTT A;  2OBV A;  1QWI A;  2EGT A;  4B3R C;  4KHP C;  4ZJZ A;  4OXI A;  4DR2 C;  1YJ7 A;  3I07 A;  5BR8 C;  1XMQ C;  5BSW A;  4PZP A;  2YCB A;  1GPM A;  2UUC C;  5AE2 A;  4JI7 C;  5IFI A;  2P2M A;  4MH4 A;  1NYE A;  4LFB C;  1J5E C;  3IEV A;  4XX2 A;  4DCU A;  3R9X A;  3IML A;  1IBK C;  4R1M A;  3VNS A;  4K0B A;  1PG3 A;  4B3S C;  1KKG A;  2VZE A;  4DR1 C;  4DV5 C;  2P20 A;  4G36 A;  5BSV A;  1AMU A;  5A1I A;  2UXC C;  4DV2 C;  2XR1 A;  2VQF C;  3GPC A;  3NI2 A;  3UZ0 A;  1LCI A;  4WS9 A;  3H2T A;  3J81 D;  4IR7 A;  5LMU C;  4DV6 C;  3TUF A;  4LF9 C;  4I9G A;  4PHT A;  2Y4O A;  4LFA C;  1T5D X;  4U5Y D;  5ADZ A;  4BCA A;  4L7I A;  1T5H X;  3C5E A;  4IZ6 A;  3E7W A;  4NDN A;  3IEU A;  2P2F A;  4JI2 C;  2E7G A;  2D27 A;  2E8C A;  2VSQ A;  5IWA C;  2UU9 C;  5AE1 A;  1N36 C;  1HNW C;  2WP0 C;  4DR5 C;  4YHH C;  4G1I A;  4RLF A;  3T1Y C;  1O9T A;  5T8S A;  4X65 C;  4NXN C;  3ETC A;  1UKK A;  4LF6 C;  3G7S A;  4RM2 A;  4D4G A;  4R0M A;  4L4Q A;  3VNQ A;  2ASB A;  3EER A;  4ODJ A;  4WV3 A;  4BC7 A;  3TQI A;  1XNQ C;  3AF5 A;  4FTF A;  3LGX A;  4BC9 A;  4DV3 C;  1WH9 A;  3NYR A;  1MXA A;  4DV1 C;  3J80 D;  4L2Z A;  3TDE A;  3CW9 A;  3JAM D;  1N32 C;  3S82 A;  1MD9 A;  1MDB A;  1MKY A;  4KTV A;  3GKU A;  3L8C A;  2DYJ A;  1V25 A;  5KYV A;  1IBM C;  5K85 A;  3A9V A;  3AF6 A;  1QM4 A;  1ULT A;  2P02 A;  5BUS A;  2CY1 A;  4JYA C;  2YWC A;  1XNR C;  3DAY A;  2UXB C;  3IPL A;  2QVX X;  3CW8 X;  2F4V C;  4DG9 A;  5H9U A;  2D28 C;  2PN2 A;  1N33 C;  2P2Q A;  3DHV A;  4ZLP A;  2CXC A;  3RG2 A;  2D1T A;  5KEI A;  3N54 B;  1ML8 A;  1XMO C;  5DV9 A;  1N2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...