4LF9C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf9C02
4JI5C 3R9XA 4XX2A 1KKGA 1UKKA 1MKYA 2ASBA 2E7GA 4JI7C 4GKKC 4DV1C 4DR2C 2UXBC 4LF8C 3LUSA 4LFAC 2OPLB 2ATWA 4JYAC 3J7AD 4X65C 2OPLA 4DV5C 4JI0C 4JI2C 1LQLA 4NXNC 5LMUC 1IBKC 4DR1C 1XMQC 2BJOA 2UXCC 2DYJA 3I07A 4NOZA 3IEVA 2D7VA 5A2QD 4B3MC 4JI8C 3R9WA 1WF3A 4LF6C 4DR4C 1JOSA 5IWAC 4LF5C 4MH4A 1NYEA 2F4VC 4DV3C 4LFCC 1XMOC 1L2FA 4X66C 4BSZA 4JI6C 4NXMC 4AQYC 4JI3C 1N33C 1HH2P 5IT9D 1IBLC 3GKUA 4DV2C 4JI4C 2UXDC 4DCUA 1USPB 2E5LC 4KHPC 1USPA 2XR1A 4DR3C 1N36C 2EGTA 4YHHC 4LFBC 1WH9A 2PN2A 1VLAA 1ZB8A 1I94C 2PT7G 4DR6C 4DV7C 1XNRC 1K0RA 4DCSA 4X64C 3T1YC 4X62C 4MTNA 1N34C 4K0KC 1HNXC 1ML8A 1N32C 1HNZC 4YY3C 3J81D 4B3RC 4OX9C 1QWIA 2YCBA 1ZB9A 2VQEC 2UUAC 2E8FA 2UUCC 1HNWC 4DV0C 4DCVA 2UU9C 4DV6C 3T1HC 2ONFA 3EERA 2CXCA 2E8EA 1J5EC 4B3SC 2JMPA 4DV4C 2HJGA 3JAMD 3AF6A 2KZFA 1HR0C 2ZM6C 4JI1C 4DCTA 1N2FA 2VQFC 5BR8C 1FJGC 4DR5C 1XNQC 1IBMC 4LF9C 3OTOC 2UUBC 3CJEA 4DUYC 2QL8A 4JV5C 2CY1A 2E8CA 4GKJC 1PA4A 3J80D 5LMNC 3IEUA 5FLXD 4DUZC 3AF5A 2HHHC 4B3TC 4DR7C 4LF7C 4LF4C 1EGAA
chains in the Genus database with same CATH superfamily
4IR7A 5GTDA 2ASBA 2Y27A 5BUQA 1IB8A 4GKKC 3SO4A 3A25A 4G36A 2OPLA 4K0BA 2KDNA 2M5OA 1LQLA 5LMUC 5AE3A 2BJOA 2UXCC 1V60A 3CQ3A 4DG8A 4JI8C 3R9WA 1WF3A 3FCCA 3E7WA 2WD9A 1RG9A 5IWAC 3UEBA 4NDNA 4HPVA 4MH4A 1NYEA 1YJ7A 1WCJA 4LFCC 4X66C 4BSZA 4JI6C 1HH2P 5IT9D 2P2QA 3GKUA 2UXDC 1PG4A 2P02A 1USPB 2XR1A 3NI2A 4YHHC 4FTFA 2YWCA 2PN2A 1XNRC 4I9FA 5T8SA 3T1YC 4X62C 1N34C 1ML8A 1N32C 4G1IA 1FLOA 4OXIA 4B3RC 1ZB9A 2VQEC 1XDXA 4ISBA 5E7QA 1HNWC 4R0MA 4DV0C 4DCVA 4WV3A 2UU9C 2QW0X 2Y4NA 3DLPX 1J5EC 5T8TA 4DV4C 2HJGA 2KZFA 3GR1A 5CZXA 4DCTA 3LAXA 5BR8C 1YGTA 3LNVA 3TQIA 1PU1A 4L4QA 3UOWA 4LF9C 2UUBC 3B7WA 1PA4A 3J80D 2D1QA 1MXCA 2P2MA 4B3TC 4DR7C 1EGAA 2ZZNA 5AE1A 3VNRA 1XRCA 3AY0A 4PZPA 5K8FA 4RLFA 4D4GA 2E7GA 4JI7C 4DV1C 4DR2C 3LUSA 3CQ2A 2ZTBA 3A9UA 5A19A 4X65C 4G37A 4DG9A 4TPSB 3UZ0A 4NXNC 1IBKC 1XMQC 2DYJA 2CU6A 3IEVA 5BUSA 1M6XA 2Z51A 4LF6C 1LCIA 4DR4C 5ADZA 2JNVA 4LF5C 2PROA 1XMOC 3NYQA 5JRHA 4AQYC 4RLQA 1N33C 5BSUA 2P2JA 2OBVA 1MDBA 4JI4C 4ZJZA 1USPA 4DR3C 1N36C 1V26A 4BC7A 1WH9A 3VNQA 2E0GA 4DR6C 4DV7C 1K0RA 3DAYA 4MTNA 4JM1A 5H9UA 4YY3C 2YCBA 2DHMA 3LNOA 5BSTA 2KZ0A 1GPMA 2QVYX 1ULTA 4RMNA 3H2TA 3EERA 2CXCA 2E8EA 2VSQA 1NY8A 2JMPA 3AF6A 3JAMD 1HR0C 1AMUA 4EATA 1N2FA 5KYVA 4PROC 1FJGC 4GS5A 2P20A 3CJEA 1P7LA 2CY1A 3RV2A 3IEUA 5DV9A 3ETOA 1MD9A 2HHHC 4D4IA 3S82A 3ETCA 4ZLPA 1UKKA 1VEHA 3CW8X 1M6XC 3NPDA 4RM3A 1FUGA 4LFAC 3TDEA 2ATWA 4JYAC 2D28C 4KTVA 3A26A 4DV5C 4JI0C 4JI2C 4R1LA 5CZVA 3DHVA 3TR3A 2M5HA 3I07A 4NOZA 2D7VA 2MMAB 5A2QD 4U5YD 3O2EA 5BSVA 3PBKA 3A9VA 5AE2A 3C5EA 4FUTA 1P4EA 1L2FA 3UX2A 4NXMC 3PROC 4JI3C 3A4IA 4DV2C 4DCUA 5BURA 5KYTA 2E5LC 1XRBA 5BSMA 2P2BA 3RG2A 3GR0A 3FM7A 1VLAA 1I94C 4PUGA 3VNSA 2AYAA 4DCSA 2P2FA 4X64C 4K0KC 1HNXC 3EQ6A 4BCAA 3E7XA 5A1GA 3J81D 4OX9C 1QWIA 5KEIA 4GXQA 2UUCC 3IPLA 4DV6C 3T1HC 1UWDA 2ONFA 4ODJA 4PHTA 1MXAA 4KTTA 2VQFC 3K6RA 4DR5C 4IZ6A 1XNQC 3OTOC 3CQ1A 2D1RA 3LGXA 5LMNC 1TH5A 4RVOA 5FLXD 2D1TA 5A1IA 4JI5C 3R9XA 4XX2A 1KKGA 4D56A 3CW9A 1MKYA 2D1SA 2ZZMA 4LE5A 3PESA 2UXBC 4LF8C 4OYCA 3TUFA 2OPLB 3J7AD 1O90A 2PG1E 4D57A 1PG3A 3IMLA 1P4EC 4FUQA 4DR1C 4RM2A 1XHJA 2WP0C 4B3MC 2MM9A 2DPLA 2D27A 1BA3A 1T5DX 1XRAA 4I9GA 4BBYA 2Y4OA 1JOSA 4LF4C 2QVXX 2F4VC 4DV3C 4BC9A 5IFIA 3R44A 4WS9A 1IBLC 3UX3A 4L2ZA 4KHPC 1XS3A 1MDFA 2NCLA 2EGTA 1O9TA 4GXRA 4LFBC 3I08A 1T5HX 3G7SA 3N2QA 1ZB8A 1O93A 2PT7G 4RVNA 1V25A 1QM4A 2BH1X 3KXWA 1HNZC 2V7BA 2UUAC 2E8FA 2QVZX 3L95X 1RY2A 4PUHA 4R1MA 4B3SC 3FCEA 4L7IA 2ZM6C 4JI1C 4PUIA 5BSWA 1IBMC 3GPCA 2VZEA 1O92A 2OO4A 4JV5C 4DUYC 2QL8A 2E8CA 4GKJC 2YWBA 3NYRA 5BSRA 2MCQA 4DUZC 3AF5A 2YX1A 3L8CA 3N54B 5K85A 4LF7C 5LCIA 1MXBA
chains in the Genus database with same CATH topology
4IR7A 5GTDA 2ASBA 2Y27A 5BUQA 4GKKC 3SO4A 4G36A 2OPLA 4K0BA 1LQLA 5LMUC 5AE3A 2BJOA 2UXCC 4DG8A 4JI8C 3R9WA 1WF3A 3FCCA 3E7WA 2WD9A 1RG9A 5IWAC 4NDNA 4HPVA 4MH4A 1NYEA 1YJ7A 4LFCC 4X66C 4BSZA 4JI6C 1HH2P 5IT9D 2P2QA 3GKUA 2UXDC 1PG4A 2P02A 1USPB 2XR1A 3NI2A 4YHHC 4FTFA 2YWCA 2PN2A 1XNRC 4I9FA 5T8SA 3T1YC 4X62C 1N34C 1ML8A 1N32C 4G1IA 4OXIA 4B3RC 1ZB9A 2VQEC 4ISBA 5E7QA 1HNWC 4R0MA 4DV0C 4DCVA 4WV3A 2UU9C 2QW0X 2Y4NA 3DLPX 1J5EC 5T8TA 4DV4C 2HJGA 2KZFA 3GR1A 5CZXA 4DCTA 3LAXA 5BR8C 3LNVA 3TQIA 4L4QA 3UOWA 4LF9C 2UUBC 3B7WA 1PA4A 3J80D 2D1QA 1MXCA 2P2MA 4B3TC 4DR7C 1EGAA 5AE1A 3VNRA 1XRCA 4PZPA 5K8FA 4RLFA 4D4GA 2E7GA 4JI7C 4DV1C 4DR2C 3LUSA 3A9UA 5A19A 4X65C 4G37A 4DG9A 4TPSB 3UZ0A 4NXNC 1IBKC 1XMQC 2DYJA 3IEVA 5BUSA 4LF6C 1LCIA 4DR4C 5ADZA 4LF5C 2PROA 1XMOC 3NYQA 5JRHA 4AQYC 4RLQA 1N33C 5BSUA 2P2JA 2OBVA 1MDBA 4JI4C 4ZJZA 1USPA 4DR3C 1N36C 1V26A 4BC7A 1WH9A 3VNQA 2E0GA 4DR6C 4DV7C 1K0RA 3DAYA 4MTNA 4JM1A 5H9UA 4YY3C 2YCBA 5BSTA 1GPMA 2QVYX 1ULTA 4RMNA 3H2TA 3EERA 2CXCA 2E8EA 2VSQA 2JMPA 3AF6A 3JAMD 1HR0C 1AMUA 4EATA 1N2FA 5KYVA 4PROC 1FJGC 4GS5A 2P20A 3CJEA 1P7LA 2CY1A 3RV2A 3IEUA 5DV9A 3ETOA 1MD9A 2HHHC 4D4IA 3S82A 3ETCA 4ZLPA 1UKKA 3CW8X 3NPDA 4RM3A 1FUGA 4LFAC 3TDEA 2ATWA 4JYAC 2D28C 4KTVA 4DV5C 4JI0C 4JI2C 4R1LA 5CZVA 3DHVA 3I07A 4NOZA 2D7VA 5A2QD 4U5YD 5BSVA 3PBKA 3A9VA 5AE2A 3C5EA 4FUTA 1L2FA 4NXMC 3PROC 4JI3C 3A4IA 4DV2C 4DCUA 5BURA 5KYTA 2E5LC 1XRBA 5BSMA 2P2BA 3RG2A 3GR0A 1VLAA 1I94C 3VNSA 2AYAA 4DCSA 2P2FA 4X64C 4K0KC 1HNXC 3EQ6A 4BCAA 3E7XA 5A1GA 3J81D 4OX9C 1QWIA 5KEIA 4GXQA 2UUCC 3IPLA 4DV6C 3T1HC 2ONFA 4ODJA 4PHTA 1MXAA 4KTTA 2VQFC 4DR5C 4IZ6A 1XNQC 3OTOC 2D1RA 3LGXA 5LMNC 4RVOA 5FLXD 2D1TA 5A1IA 4JI5C 3R9XA 4XX2A 1KKGA 4D56A 3CW9A 1MKYA 2D1SA 4LE5A 3PESA 2UXBC 4LF8C 4OYCA 3TUFA 2OPLB 3J7AD 1O90A 4D57A 1PG3A 3IMLA 4FUQA 4DR1C 4RM2A 2WP0C 4B3MC 2DPLA 2D27A 1BA3A 1T5DX 1XRAA 4I9GA 4BBYA 2Y4OA 1JOSA 2QVXX 2F4VC 4DV3C 4BC9A 5IFIA 3R44A 4WS9A 1IBLC 4L2ZA 4KHPC 1MDFA 2EGTA 1O9TA 4GXRA 4LFBC 3I08A 1T5HX 3G7SA 3N2QA 1ZB8A 1O93A 2PT7G 4RVNA 1V25A 1QM4A 2BH1X 3KXWA 1HNZC 2V7BA 2UUAC 2E8FA 2QVZX 3L95X 1RY2A 4R1MA 4B3SC 3FCEA 4L7IA 2ZM6C 4JI1C 5BSWA 1IBMC 3GPCA 2VZEA 1O92A 2OO4A 4JV5C 4DUYC 2QL8A 2E8CA 4GKJC 2YWBA 3NYRA 5BSRA 4DUZC 3AF5A 3L8CA 3N54B 5K85A 4LF7C 4LF4C 1MXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 C;  3R9X A;  4XX2 A;  1KKG A;  1UKK A;  1MKY A;  2ASB A;  2E7G A;  4JI7 C;  4GKK C;  4DV1 C;  4DR2 C;  2UXB C;  4LF8 C;  3LUS A;  4LFA C;  2OPL B;  2ATW A;  4JYA C;  3J7A D;  4X65 C;  2OPL A;  4DV5 C;  4JI0 C;  4JI2 C;  1LQL A;  4NXN C;  5LMU C;  1IBK C;  4DR1 C;  1XMQ C;  2BJO A;  2UXC C;  2DYJ A;  3I07 A;  4NOZ A;  3IEV A;  2D7V A;  5A2Q D;  4B3M C;  4JI8 C;  3R9W A;  1WF3 A;  4LF6 C;  4DR4 C;  1JOS A;  5IWA C;  4LF5 C;  4MH4 A;  1NYE A;  2F4V C;  4DV3 C;  4LFC C;  1XMO C;  1L2F A;  4X66 C;  4BSZ A;  4JI6 C;  4NXM C;  4AQY C;  4JI3 C;  1N33 C;  1HH2 P;  5IT9 D;  1IBL C;  3GKU A;  4DV2 C;  4JI4 C;  2UXD C;  4DCU A;  1USP B;  2E5L C;  4KHP C;  1USP A;  2XR1 A;  4DR3 C;  1N36 C;  2EGT A;  4YHH C;  4LFB C;  1WH9 A;  2PN2 A;  1VLA A;  1ZB8 A;  1I94 C;  2PT7 G;  4DR6 C;  4DV7 C;  1XNR C;  1K0R A;  4DCS A;  4X64 C;  3T1Y C;  4X62 C;  4MTN A;  1N34 C;  4K0K C;  1HNX C;  1ML8 A;  1N32 C;  1HNZ C;  4YY3 C;  3J81 D;  4B3R C;  4OX9 C;  1QWI A;  2YCB A;  1ZB9 A;  2VQE C;  2UUA C;  2E8F A;  2UUC C;  1HNW C;  4DV0 C;  4DCV A;  2UU9 C;  4DV6 C;  3T1H C;  2ONF A;  3EER A;  2CXC A;  2E8E A;  1J5E C;  4B3S C;  2JMP A;  4DV4 C;  2HJG A;  3JAM D;  3AF6 A;  2KZF A;  1HR0 C;  2ZM6 C;  4JI1 C;  4DCT A;  1N2F A;  2VQF C;  5BR8 C;  1FJG C;  4DR5 C;  1XNQ C;  1IBM C;  4LF9 C;  3OTO C;  2UUB C;  3CJE A;  4DUY C;  2QL8 A;  4JV5 C;  2CY1 A;  2E8C A;  4GKJ C;  1PA4 A;  3J80 D;  5LMN C;  3IEU A;  5FLX D;  4DUZ C;  3AF5 A;  2HHH C;  4B3T C;  4DR7 C;  4LF7 C;  4LF4 C;  1EGA A; 
#chains in the Genus database with same CATH topology
 4IR7 A;  5GTD A;  2ASB A;  2Y27 A;  5BUQ A;  1IB8 A;  4GKK C;  3SO4 A;  3A25 A;  4G36 A;  2OPL A;  4K0B A;  2KDN A;  2M5O A;  1LQL A;  5LMU C;  5AE3 A;  2BJO A;  2UXC C;  1V60 A;  3CQ3 A;  4DG8 A;  4JI8 C;  3R9W A;  1WF3 A;  3FCC A;  3E7W A;  2WD9 A;  1RG9 A;  5IWA C;  3UEB A;  4NDN A;  4HPV A;  4MH4 A;  1NYE A;  1YJ7 A;  1WCJ A;  4LFC C;  4X66 C;  4BSZ A;  4JI6 C;  1HH2 P;  5IT9 D;  2P2Q A;  3GKU A;  2UXD C;  1PG4 A;  2P02 A;  1USP B;  2XR1 A;  3NI2 A;  4YHH C;  4FTF A;  2YWC A;  2PN2 A;  1XNR C;  4I9F A;  5T8S A;  3T1Y C;  4X62 C;  1N34 C;  1ML8 A;  1N32 C;  4G1I A;  1FLO A;  4OXI A;  4B3R C;  1ZB9 A;  2VQE C;  1XDX A;  4ISB A;  5E7Q A;  1HNW C;  4R0M A;  4DV0 C;  4DCV A;  4WV3 A;  2UU9 C;  2QW0 X;  2Y4N A;  3DLP X;  1J5E C;  5T8T A;  4DV4 C;  2HJG A;  2KZF A;  3GR1 A;  5CZX A;  4DCT A;  3LAX A;  5BR8 C;  1YGT A;  3LNV A;  3TQI A;  1PU1 A;  4L4Q A;  3UOW A;  4LF9 C;  2UUB C;  3B7W A;  1PA4 A;  3J80 D;  2D1Q A;  1MXC A;  2P2M A;  4B3T C;  4DR7 C;  1EGA A;  2ZZN A;  5AE1 A;  3VNR A;  1XRC A;  3AY0 A;  4PZP A;  5K8F A;  4RLF A;  4D4G A;  2E7G A;  4JI7 C;  4DV1 C;  4DR2 C;  3LUS A;  3CQ2 A;  2ZTB A;  3A9U A;  5A19 A;  4X65 C;  4G37 A;  4DG9 A;  4TPS B;  3UZ0 A;  4NXN C;  1IBK C;  1XMQ C;  2DYJ A;  2CU6 A;  3IEV A;  5BUS A;  1M6X A;  2Z51 A;  4LF6 C;  1LCI A;  4DR4 C;  5ADZ A;  2JNV A;  4LF5 C;  2PRO A;  1XMO C;  3NYQ A;  5JRH A;  4AQY C;  4RLQ A;  1N33 C;  5BSU A;  2P2J A;  2OBV A;  1MDB A;  4JI4 C;  4ZJZ A;  1USP A;  4DR3 C;  1N36 C;  1V26 A;  4BC7 A;  1WH9 A;  3VNQ A;  2E0G A;  4DR6 C;  4DV7 C;  1K0R A;  3DAY A;  4MTN A;  4JM1 A;  5H9U A;  4YY3 C;  2YCB A;  2DHM A;  3LNO A;  5BST A;  2KZ0 A;  1GPM A;  2QVY X;  1ULT A;  4RMN A;  3H2T A;  3EER A;  2CXC A;  2E8E A;  2VSQ A;  1NY8 A;  2JMP A;  3AF6 A;  3JAM D;  1HR0 C;  1AMU A;  4EAT A;  1N2F A;  5KYV A;  4PRO C;  1FJG C;  4GS5 A;  2P20 A;  3CJE A;  1P7L A;  2CY1 A;  3RV2 A;  3IEU A;  5DV9 A;  3ETO A;  1MD9 A;  2HHH C;  4D4I A;  3S82 A;  3ETC A;  4ZLP A;  1UKK A;  1VEH A;  3CW8 X;  1M6X C;  3NPD A;  4RM3 A;  1FUG A;  4LFA C;  3TDE A;  2ATW A;  4JYA C;  2D28 C;  4KTV A;  3A26 A;  4DV5 C;  4JI0 C;  4JI2 C;  4R1L A;  5CZV A;  3DHV A;  3TR3 A;  2M5H A;  3I07 A;  4NOZ A;  2D7V A;  2MMA B;  5A2Q D;  4U5Y D;  3O2E A;  5BSV A;  3PBK A;  3A9V A;  5AE2 A;  3C5E A;  4FUT A;  1P4E A;  1L2F A;  3UX2 A;  4NXM C;  3PRO C;  4JI3 C;  3A4I A;  4DV2 C;  4DCU A;  5BUR A;  5KYT A;  2E5L C;  1XRB A;  5BSM A;  2P2B A;  3RG2 A;  3GR0 A;  3FM7 A;  1VLA A;  1I94 C;  4PUG A;  3VNS A;  2AYA A;  4DCS A;  2P2F A;  4X64 C;  4K0K C;  1HNX C;  3EQ6 A;  4BCA A;  3E7X A;  5A1G A;  3J81 D;  4OX9 C;  1QWI A;  5KEI A;  4GXQ A;  2UUC C;  3IPL A;  4DV6 C;  3T1H C;  1UWD A;  2ONF A;  4ODJ A;  4PHT A;  1MXA A;  4KTT A;  2VQF C;  3K6R A;  4DR5 C;  4IZ6 A;  1XNQ C;  3OTO C;  3CQ1 A;  2D1R A;  3LGX A;  5LMN C;  1TH5 A;  4RVO A;  5FLX D;  2D1T A;  5A1I A;  4JI5 C;  3R9X A;  4XX2 A;  1KKG A;  4D56 A;  3CW9 A;  1MKY A;  2D1S A;  2ZZM A;  4LE5 A;  3PES A;  2UXB C;  4LF8 C;  4OYC A;  3TUF A;  2OPL B;  3J7A D;  1O90 A;  2PG1 E;  4D57 A;  1PG3 A;  3IML A;  1P4E C;  4FUQ A;  4DR1 C;  4RM2 A;  1XHJ A;  2WP0 C;  4B3M C;  2MM9 A;  2DPL A;  2D27 A;  1BA3 A;  1T5D X;  1XRA A;  4I9G A;  4BBY A;  2Y4O A;  1JOS A;  4LF4 C;  2QVX X;  2F4V C;  4DV3 C;  4BC9 A;  5IFI A;  3R44 A;  4WS9 A;  1IBL C;  3UX3 A;  4L2Z A;  4KHP C;  1XS3 A;  1MDF A;  2NCL A;  2EGT A;  1O9T A;  4GXR A;  4LFB C;  3I08 A;  1T5H X;  3G7S A;  3N2Q A;  1ZB8 A;  1O93 A;  2PT7 G;  4RVN A;  1V25 A;  1QM4 A;  2BH1 X;  3KXW A;  1HNZ C;  2V7B A;  2UUA C;  2E8F A;  2QVZ X;  3L95 X;  1RY2 A;  4PUH A;  4R1M A;  4B3S C;  3FCE A;  4L7I A;  2ZM6 C;  4JI1 C;  4PUI A;  5BSW A;  1IBM C;  3GPC A;  2VZE A;  1O92 A;  2OO4 A;  4JV5 C;  4DUY C;  2QL8 A;  2E8C A;  4GKJ C;  2YWB A;  3NYR A;  5BSR A;  2MCQ A;  4DUZ C;  3AF5 A;  2YX1 A;  3L8C A;  3N54 B;  5K85 A;  4LF7 C;  5LCI A;  1MXB A; 
#chains in the Genus database with same CATH homology
 4IR7 A;  5GTD A;  2ASB A;  2Y27 A;  5BUQ A;  4GKK C;  3SO4 A;  4G36 A;  2OPL A;  4K0B A;  1LQL A;  5LMU C;  5AE3 A;  2BJO A;  2UXC C;  4DG8 A;  4JI8 C;  3R9W A;  1WF3 A;  3FCC A;  3E7W A;  2WD9 A;  1RG9 A;  5IWA C;  4NDN A;  4HPV A;  4MH4 A;  1NYE A;  1YJ7 A;  4LFC C;  4X66 C;  4BSZ A;  4JI6 C;  1HH2 P;  5IT9 D;  2P2Q A;  3GKU A;  2UXD C;  1PG4 A;  2P02 A;  1USP B;  2XR1 A;  3NI2 A;  4YHH C;  4FTF A;  2YWC A;  2PN2 A;  1XNR C;  4I9F A;  5T8S A;  3T1Y C;  4X62 C;  1N34 C;  1ML8 A;  1N32 C;  4G1I A;  4OXI A;  4B3R C;  1ZB9 A;  2VQE C;  4ISB A;  5E7Q A;  1HNW C;  4R0M A;  4DV0 C;  4DCV A;  4WV3 A;  2UU9 C;  2QW0 X;  2Y4N A;  3DLP X;  1J5E C;  5T8T A;  4DV4 C;  2HJG A;  2KZF A;  3GR1 A;  5CZX A;  4DCT A;  3LAX A;  5BR8 C;  3LNV A;  3TQI A;  4L4Q A;  3UOW A;  4LF9 C;  2UUB C;  3B7W A;  1PA4 A;  3J80 D;  2D1Q A;  1MXC A;  2P2M A;  4B3T C;  4DR7 C;  1EGA A;  5AE1 A;  3VNR A;  1XRC A;  4PZP A;  5K8F A;  4RLF A;  4D4G A;  2E7G A;  4JI7 C;  4DV1 C;  4DR2 C;  3LUS A;  3A9U A;  5A19 A;  4X65 C;  4G37 A;  4DG9 A;  4TPS B;  3UZ0 A;  4NXN C;  1IBK C;  1XMQ C;  2DYJ A;  3IEV A;  5BUS A;  4LF6 C;  1LCI A;  4DR4 C;  5ADZ A;  4LF5 C;  2PRO A;  1XMO C;  3NYQ A;  5JRH A;  4AQY C;  4RLQ A;  1N33 C;  5BSU A;  2P2J A;  2OBV A;  1MDB A;  4JI4 C;  4ZJZ A;  1USP A;  4DR3 C;  1N36 C;  1V26 A;  4BC7 A;  1WH9 A;  3VNQ A;  2E0G A;  4DR6 C;  4DV7 C;  1K0R A;  3DAY A;  4MTN A;  4JM1 A;  5H9U A;  4YY3 C;  2YCB A;  5BST A;  1GPM A;  2QVY X;  1ULT A;  4RMN A;  3H2T A;  3EER A;  2CXC A;  2E8E A;  2VSQ A;  2JMP A;  3AF6 A;  3JAM D;  1HR0 C;  1AMU A;  4EAT A;  1N2F A;  5KYV A;  4PRO C;  1FJG C;  4GS5 A;  2P20 A;  3CJE A;  1P7L A;  2CY1 A;  3RV2 A;  3IEU A;  5DV9 A;  3ETO A;  1MD9 A;  2HHH C;  4D4I A;  3S82 A;  3ETC A;  4ZLP A;  1UKK A;  3CW8 X;  3NPD A;  4RM3 A;  1FUG A;  4LFA C;  3TDE A;  2ATW A;  4JYA C;  2D28 C;  4KTV A;  4DV5 C;  4JI0 C;  4JI2 C;  4R1L A;  5CZV A;  3DHV A;  3I07 A;  4NOZ A;  2D7V A;  5A2Q D;  4U5Y D;  5BSV A;  3PBK A;  3A9V A;  5AE2 A;  3C5E A;  4FUT A;  1L2F A;  4NXM C;  3PRO C;  4JI3 C;  3A4I A;  4DV2 C;  4DCU A;  5BUR A;  5KYT A;  2E5L C;  1XRB A;  5BSM A;  2P2B A;  3RG2 A;  3GR0 A;  1VLA A;  1I94 C;  3VNS A;  2AYA A;  4DCS A;  2P2F A;  4X64 C;  4K0K C;  1HNX C;  3EQ6 A;  4BCA A;  3E7X A;  5A1G A;  3J81 D;  4OX9 C;  1QWI A;  5KEI A;  4GXQ A;  2UUC C;  3IPL A;  4DV6 C;  3T1H C;  2ONF A;  4ODJ A;  4PHT A;  1MXA A;  4KTT A;  2VQF C;  4DR5 C;  4IZ6 A;  1XNQ C;  3OTO C;  2D1R A;  3LGX A;  5LMN C;  4RVO A;  5FLX D;  2D1T A;  5A1I A;  4JI5 C;  3R9X A;  4XX2 A;  1KKG A;  4D56 A;  3CW9 A;  1MKY A;  2D1S A;  4LE5 A;  3PES A;  2UXB C;  4LF8 C;  4OYC A;  3TUF A;  2OPL B;  3J7A D;  1O90 A;  4D57 A;  1PG3 A;  3IML A;  4FUQ A;  4DR1 C;  4RM2 A;  2WP0 C;  4B3M C;  2DPL A;  2D27 A;  1BA3 A;  1T5D X;  1XRA A;  4I9G A;  4BBY A;  2Y4O A;  1JOS A;  2QVX X;  2F4V C;  4DV3 C;  4BC9 A;  5IFI A;  3R44 A;  4WS9 A;  1IBL C;  4L2Z A;  4KHP C;  1MDF A;  2EGT A;  1O9T A;  4GXR A;  4LFB C;  3I08 A;  1T5H X;  3G7S A;  3N2Q A;  1ZB8 A;  1O93 A;  2PT7 G;  4RVN A;  1V25 A;  1QM4 A;  2BH1 X;  3KXW A;  1HNZ C;  2V7B A;  2UUA C;  2E8F A;  2QVZ X;  3L95 X;  1RY2 A;  4R1M A;  4B3S C;  3FCE A;  4L7I A;  2ZM6 C;  4JI1 C;  5BSW A;  1IBM C;  3GPC A;  2VZE A;  1O92 A;  2OO4 A;  4JV5 C;  4DUY C;  2QL8 A;  2E8C A;  4GKJ C;  2YWB A;  3NYR A;  5BSR A;  4DUZ C;  3AF5 A;  3L8C A;  3N54 B;  5K85 A;  4LF7 C;  4LF4 C;  1MXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...