4LF9C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf9C02
1WH9A 2JMPA 1USPB 4DV5C 2E8CA 2OPLA 4GKJC 4LF4C 3GKUA 2DYJA 4DV2C 2ASBA 4GKKC 4B3MC 3LUSA 4X66C 1L2FA 4AQYC 1PA4A 4JI8C 4LF9C 4MTNA 2VQEC 1N36C 4DV3C 4JI7C 2UUBC 1LQLA 4X64C 4X65C 2E8EA 2PN2A 1UKKA 3CJEA 1JOSA 1NYEA 1ZB9A 5LMUC 3T1YC 3AF6A 2OPLB 2E7GA 2HJGA 4DR7C 2EGTA 1FJGC 3AF5A 1ZB8A 4DV0C 4MH4A 4JI1C 4OX9C 3JAMD 1J5EC 2D7VA 5LMNC 1K0RA 1IBLC 4DR6C 4DV4C 2YCBA 1N33C 2BJOA 4JYAC 3EERA 2ATWA 1WF3A 3R9WA 4DUZC 3OTOC 4LFBC 2UXBC 4DCSA 4DCTA 4LF6C 4K0KC 1XNQC 4YHHC 2UXDC 4B3SC 3J7AD 1HNZC 2UU9C 3J80D 4XX2A 2QL8A 1EGAA 1XNRC 4DV6C 2E8FA 1KKGA 4NXMC 5IT9D 1XMQC 4KHPC 3J81D 1HNXC 4JI0C 1HR0C 2F4VC 1HNWC 2ZM6C 4X62C 1MKYA 2VQFC 3IEVA 4DR2C 2UXCC 5A2QD 1HH2P 4DV1C 1XMOC 4B3TC 4DR5C 1N32C 1ML8A 2CY1A 2E5LC 2KZFA 4JV5C 4DCVA 1VLAA 4LF8C 4B3RC 2UUAC 4LF5C 2PT7G 1IBMC 4DR3C 4JI2C 4DR4C 1I94C 1QWIA 3I07A 4DCUA 4LFCC 5BR8C 4YY3C 4JI4C 4JI5C 4JI3C 1USPA 4DUYC 3R9XA 4BSZA 4DV7C 2ONFA 4NOZA 4LFAC 1IBKC 4DR1C 3IEUA 3T1HC 4LF7C 2CXCA 2HHHC 5IWAC 1N2FA 1N34C 2XR1A 4NXNC 2UUCC 5FLXD 4JI6C
chains in the Genus database with same CATH superfamily
5GTDA 4DV5C 2OPLA 3VNQA 3S82A 3LUSA 1FLOA 3NI2A 4MTNA 4RM3A 4BCAA 2PN2A 4GXRA 2D1SA 5LMUC 1P7LA 3UX3A 5KYTA 1XDXA 4DR7C 2EGTA 2KZ0A 1FJGC 3UZ0A 3FM7A 1MXCA 4EATA 4KTTA 4OX9C 3UOWA 1J5EC 1MDFA 4JM1A 2YCBA 4JYAC 4DUZC 3OTOC 4LFBC 2CU6A 1WCJA 5K8FA 4D57A 3I08A 4PHTA 5BUSA 2P2MA 4B3SC 3LNOA 1GPMA 4PUHA 3CW9A 5BSUA 5IT9D 1MXBA 3DLPX 1XHJA 2D1TA 4NDNA 1XRBA 2VQFC 4DR2C 5A2QD 5AE1A 4DV1C 3VNSA 1ML8A 3IPLA 2VSQA 2MCQA 2ZZNA 2MMAB 4B3RC 1IB8A 4PUGA 4DR4C 2D1RA 4YY3C 3LGXA 4JI5C 5CZXA 4D4GA 5BURA 4BSZA 1IBKC 2ZTBA 3CW8X 2D27A 3FCEA 3E7XA 1N34C 2XR1A 3PBKA 4BC9A 5BUQA 4BBYA 3B7WA 4G1IA 3EQ6A 3RV2A 4GKJC 3GKUA 1BA3A 3L8CA 4X66C 1O92A 1V25A 2VQEC 3ETCA 3UX2A 4JI7C 2UUBC 1LQLA 4PZPA 3AY0A 1V26A 2OPLB 1XS3A 4FUQA 4KTVA 5BSWA 3AF5A 1ZB8A 4ZLPA 4HPVA 4K0BA 2D7VA 2E0GA 1P4EC 1K0RA 1UWDA 2ATWA 2MM9A 4R0MA 4GS5A 3K6RA 4DCTA 2OO4A 4K0KC 1ULTA 2WD9A 3ETOA 1XNQC 5E7QA 2UXDC 1HNZC 4XX2A 1M6XC 2QL8A 1XNRC 4DV6C 2E8FA 5A1GA 4L7IA 1XMQC 1HR0C 5A19A 4G36A 4IZ6A 4DG8A 3A9UA 1XMOC 4B3TC 5IFIA 1N32C 2KZFA 4I9FA 4ISBA 3GPCA 2UUAC 1NY8A 4D4IA 5T8SA 4RMNA 4L2ZA 1QWIA 3I07A 4DCUA 5ADZA 4JI4C 3GR1A 2P2FA 1USPA 4FTFA 3CQ3A 1RG9A 2D28C 2D1QA 4ODJA 2P2JA 2ONFA 3TDEA 4DR1C 4D56A 3T1HC 2OBVA 5A1IA 4GXQA 3RG2A 4OYCA 3A25A 2DYJA 4DV2C 3NYRA 3N2QA 3SO4A 4R1LA 1L2FA 1PA4A 1T5DX 1O93A 4JI8C 1N36C 5BSTA 1P4EA 4X64C 2DPLA 2E8EA 5JRHA 3FCCA 1UKKA 2AYAA 2P2QA 3T1YC 1NYEA 4RVNA 3AF6A 2E7GA 1T5HX 4FUTA 3H2TA 4ZJZA 3PROC 5DV9A 5T8TA 4JI1C 5LMNC 1M6XA 4DR6C 2WP0C 1N33C 2YWBA 2BH1X 3R9WA 2UXBC 5CZVA 5K85A 4RM2A 1MD9A 4DCSA 1RY2A 4LF6C 1PU1A 2M5HA 3CQ1A 3J7AD 2M5OA 2UU9C 1FUGA 3TUFA 1KKGA 1MDBA 4KHPC 4RLFA 2F4VC 2ZM6C 4X62C 5LCIA 5BSMA 2UXCC 1HH2P 3GR0A 2Z51A 2YX1A 2CY1A 4DG9A 4DCVA 2PT7G 1IBMC 4DR3C 5BSRA 1XRAA 2JNVA 2QW0X 4JI3C 2V7BA 3A4IA 4NOZA 4LFAC 3IEUA 5AE3A 4LF7C 2CXCA 2HHHC 3G7SA 5BSVA 1TH5A 5IWAC 2P02A 2UUCC 4PROC 5FLXD 3LNVA 1YGTA 1WH9A 2JMPA 1USPB 2E8CA 4LF4C 2ASBA 4WS9A 2Y4NA 4GKKC 2KDNA 4TPSB 4PUIA 4B3MC 4AQYC 2PG1E 4RLQA 4LF9C 4DV3C 1LCIA 3PESA 4X65C 3CJEA 1JOSA 1ZB9A 2HJGA 4WV3A 1O90A 2P20A 4IR7A 3TR3A 1XRCA 4DV0C 4MH4A 3A9VA 2Y4OA 3JAMD 3C5EA 1IBLC 4DV4C 2BJOA 2PROA 3EERA 3O2EA 3KXWA 4OXIA 1WF3A 4L4QA 2QVYX 3DHVA 5KEIA 2DHMA 1AMUA 4YHHC 3J80D 3R44A 1YJ7A 1EGAA 5KYVA 4U5YD 2VZEA 4I9GA 3LAXA 4NXMC 3NYQA 2Y27A 3J81D 1HNXC 4JI0C 5H9UA 2QVXX 1HNWC 3CQ2A 1MKYA 2QVZX 3IEVA 3A26A 4R1MA 1O9TA 1PG4A 4DR5C 2E5LC 4LE5A 3TQIA 2ZZMA 4JV5C 1VLAA 4LF8C 3DAYA 4RVOA 2NCLA 1V60A 4LF5C 1PG3A 4JI2C 1QM4A 3N54B 1VEHA 1I94C 4LFCC 3IMLA 5BR8C 4G37A 4DUYC 3R9XA 5AE2A 3UEBA 3VNRA 3NPDA 4DV7C 1MXAA 3E7WA 2YWCA 3L95X 1N2FA 4NXNC 4BC7A 4JI6C 2P2BA
chains in the Genus database with same CATH topology
5GTDA 4DV5C 2OPLA 3VNQA 3S82A 3LUSA 3NI2A 4MTNA 4RM3A 4BCAA 2PN2A 4GXRA 2D1SA 5LMUC 1P7LA 5KYTA 4DR7C 2EGTA 1FJGC 3UZ0A 1MXCA 4EATA 4KTTA 4OX9C 3UOWA 1J5EC 1MDFA 4JM1A 2YCBA 4JYAC 4DUZC 3OTOC 4LFBC 5K8FA 4D57A 3I08A 4PHTA 5BUSA 2P2MA 4B3SC 1GPMA 3CW9A 5BSUA 5IT9D 1MXBA 3DLPX 2D1TA 4NDNA 1XRBA 2VQFC 4DR2C 5A2QD 5AE1A 4DV1C 3VNSA 1ML8A 3IPLA 2VSQA 4B3RC 4DR4C 2D1RA 4YY3C 3LGXA 4JI5C 5CZXA 4D4GA 5BURA 4BSZA 1IBKC 3CW8X 2D27A 3FCEA 3E7XA 1N34C 2XR1A 3PBKA 4BC9A 5BUQA 4BBYA 3B7WA 4G1IA 3EQ6A 3RV2A 4GKJC 3GKUA 1BA3A 3L8CA 4X66C 1O92A 1V25A 2VQEC 3ETCA 4JI7C 2UUBC 1LQLA 4PZPA 1V26A 2OPLB 4FUQA 4KTVA 5BSWA 3AF5A 1ZB8A 4ZLPA 4HPVA 4K0BA 2D7VA 2E0GA 1K0RA 2ATWA 4R0MA 4GS5A 4DCTA 2OO4A 4K0KC 1ULTA 2WD9A 3ETOA 1XNQC 5E7QA 2UXDC 1HNZC 4XX2A 2QL8A 1XNRC 4DV6C 2E8FA 5A1GA 4L7IA 1XMQC 1HR0C 5A19A 4G36A 4IZ6A 4DG8A 3A9UA 1XMOC 4B3TC 5IFIA 1N32C 2KZFA 4I9FA 4ISBA 3GPCA 2UUAC 4D4IA 5T8SA 4RMNA 4L2ZA 1QWIA 3I07A 4DCUA 5ADZA 4JI4C 3GR1A 2P2FA 1USPA 4FTFA 1RG9A 2D28C 2D1QA 4ODJA 2P2JA 2ONFA 3TDEA 4DR1C 4D56A 3T1HC 2OBVA 5A1IA 4GXQA 3RG2A 4OYCA 2DYJA 4DV2C 3NYRA 3N2QA 3SO4A 4R1LA 1L2FA 1PA4A 1T5DX 1O93A 4JI8C 1N36C 5BSTA 4X64C 2DPLA 2E8EA 5JRHA 3FCCA 1UKKA 2AYAA 2P2QA 3T1YC 1NYEA 4RVNA 3AF6A 2E7GA 1T5HX 4FUTA 3H2TA 4ZJZA 3PROC 5DV9A 5T8TA 4JI1C 5LMNC 4DR6C 2WP0C 1N33C 2YWBA 2BH1X 3R9WA 2UXBC 5CZVA 5K85A 4RM2A 1MD9A 4DCSA 1RY2A 4LF6C 3J7AD 2UU9C 1FUGA 3TUFA 1KKGA 1MDBA 4KHPC 4RLFA 2F4VC 2ZM6C 4X62C 5BSMA 2UXCC 1HH2P 3GR0A 2CY1A 4DG9A 4DCVA 2PT7G 1IBMC 4DR3C 5BSRA 1XRAA 2QW0X 4JI3C 2V7BA 3A4IA 4NOZA 4LFAC 3IEUA 5AE3A 4LF7C 2CXCA 2HHHC 3G7SA 5BSVA 5IWAC 2P02A 2UUCC 4PROC 5FLXD 3LNVA 1WH9A 2JMPA 1USPB 2E8CA 4LF4C 2ASBA 4WS9A 2Y4NA 4GKKC 4B3MC 4TPSB 4AQYC 4RLQA 4LF9C 4DV3C 1LCIA 3PESA 4X65C 3CJEA 1JOSA 1ZB9A 2HJGA 4WV3A 1O90A 2P20A 4IR7A 1XRCA 4DV0C 4MH4A 3A9VA 2Y4OA 3JAMD 3C5EA 1IBLC 4DV4C 2BJOA 2PROA 3EERA 3KXWA 4OXIA 1WF3A 4L4QA 2QVYX 3DHVA 5KEIA 1AMUA 4YHHC 3J80D 3R44A 1YJ7A 1EGAA 5KYVA 4U5YD 2VZEA 4I9GA 3LAXA 4NXMC 3NYQA 2Y27A 3J81D 1HNXC 4JI0C 5H9UA 2QVXX 1HNWC 1MKYA 2QVZX 3IEVA 4R1MA 1O9TA 1PG4A 4DR5C 2E5LC 4LE5A 3TQIA 4JV5C 1VLAA 4LF8C 3DAYA 4RVOA 4LF5C 1PG3A 4JI2C 1QM4A 3N54B 1I94C 4LFCC 3IMLA 5BR8C 4G37A 4DUYC 3R9XA 5AE2A 3VNRA 3NPDA 4DV7C 1MXAA 3E7WA 2YWCA 3L95X 1N2FA 4NXNC 4BC7A 4JI6C 2P2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH9 A;  2JMP A;  1USP B;  4DV5 C;  2E8C A;  2OPL A;  4GKJ C;  4LF4 C;  3GKU A;  2DYJ A;  4DV2 C;  2ASB A;  4GKK C;  4B3M C;  3LUS A;  4X66 C;  1L2F A;  4AQY C;  1PA4 A;  4JI8 C;  4LF9 C;  4MTN A;  2VQE C;  1N36 C;  4DV3 C;  4JI7 C;  2UUB C;  1LQL A;  4X64 C;  4X65 C;  2E8E A;  2PN2 A;  1UKK A;  3CJE A;  1JOS A;  1NYE A;  1ZB9 A;  5LMU C;  3T1Y C;  3AF6 A;  2OPL B;  2E7G A;  2HJG A;  4DR7 C;  2EGT A;  1FJG C;  3AF5 A;  1ZB8 A;  4DV0 C;  4MH4 A;  4JI1 C;  4OX9 C;  3JAM D;  1J5E C;  2D7V A;  5LMN C;  1K0R A;  1IBL C;  4DR6 C;  4DV4 C;  2YCB A;  1N33 C;  2BJO A;  4JYA C;  3EER A;  2ATW A;  1WF3 A;  3R9W A;  4DUZ C;  3OTO C;  4LFB C;  2UXB C;  4DCS A;  4DCT A;  4LF6 C;  4K0K C;  1XNQ C;  4YHH C;  2UXD C;  4B3S C;  3J7A D;  1HNZ C;  2UU9 C;  3J80 D;  4XX2 A;  2QL8 A;  1EGA A;  1XNR C;  4DV6 C;  2E8F A;  1KKG A;  4NXM C;  5IT9 D;  1XMQ C;  4KHP C;  3J81 D;  1HNX C;  4JI0 C;  1HR0 C;  2F4V C;  1HNW C;  2ZM6 C;  4X62 C;  1MKY A;  2VQF C;  3IEV A;  4DR2 C;  2UXC C;  5A2Q D;  1HH2 P;  4DV1 C;  1XMO C;  4B3T C;  4DR5 C;  1N32 C;  1ML8 A;  2CY1 A;  2E5L C;  2KZF A;  4JV5 C;  4DCV A;  1VLA A;  4LF8 C;  4B3R C;  2UUA C;  4LF5 C;  2PT7 G;  1IBM C;  4DR3 C;  4JI2 C;  4DR4 C;  1I94 C;  1QWI A;  3I07 A;  4DCU A;  4LFC C;  5BR8 C;  4YY3 C;  4JI4 C;  4JI5 C;  4JI3 C;  1USP A;  4DUY C;  3R9X A;  4BSZ A;  4DV7 C;  2ONF A;  4NOZ A;  4LFA C;  1IBK C;  4DR1 C;  3IEU A;  3T1H C;  4LF7 C;  2CXC A;  2HHH C;  5IWA C;  1N2F A;  1N34 C;  2XR1 A;  4NXN C;  2UUC C;  5FLX D;  4JI6 C; 
#chains in the Genus database with same CATH topology
 5GTD A;  4DV5 C;  2OPL A;  3VNQ A;  3S82 A;  3LUS A;  1FLO A;  3NI2 A;  4MTN A;  4RM3 A;  4BCA A;  2PN2 A;  4GXR A;  2D1S A;  5LMU C;  1P7L A;  3UX3 A;  5KYT A;  1XDX A;  4DR7 C;  2EGT A;  2KZ0 A;  1FJG C;  3UZ0 A;  3FM7 A;  1MXC A;  4EAT A;  4KTT A;  4OX9 C;  3UOW A;  1J5E C;  1MDF A;  4JM1 A;  2YCB A;  4JYA C;  4DUZ C;  3OTO C;  4LFB C;  2CU6 A;  1WCJ A;  5K8F A;  4D57 A;  3I08 A;  4PHT A;  5BUS A;  2P2M A;  4B3S C;  3LNO A;  1GPM A;  4PUH A;  3CW9 A;  5BSU A;  5IT9 D;  1MXB A;  3DLP X;  1XHJ A;  2D1T A;  4NDN A;  1XRB A;  2VQF C;  4DR2 C;  5A2Q D;  5AE1 A;  4DV1 C;  3VNS A;  1ML8 A;  3IPL A;  2VSQ A;  2MCQ A;  2ZZN A;  2MMA B;  4B3R C;  1IB8 A;  4PUG A;  4DR4 C;  2D1R A;  4YY3 C;  3LGX A;  4JI5 C;  5CZX A;  4D4G A;  5BUR A;  4BSZ A;  1IBK C;  2ZTB A;  3CW8 X;  2D27 A;  3FCE A;  3E7X A;  1N34 C;  2XR1 A;  3PBK A;  4BC9 A;  5BUQ A;  4BBY A;  3B7W A;  4G1I A;  3EQ6 A;  3RV2 A;  4GKJ C;  3GKU A;  1BA3 A;  3L8C A;  4X66 C;  1O92 A;  1V25 A;  2VQE C;  3ETC A;  3UX2 A;  4JI7 C;  2UUB C;  1LQL A;  4PZP A;  3AY0 A;  1V26 A;  2OPL B;  1XS3 A;  4FUQ A;  4KTV A;  5BSW A;  3AF5 A;  1ZB8 A;  4ZLP A;  4HPV A;  4K0B A;  2D7V A;  2E0G A;  1P4E C;  1K0R A;  1UWD A;  2ATW A;  2MM9 A;  4R0M A;  4GS5 A;  3K6R A;  4DCT A;  2OO4 A;  4K0K C;  1ULT A;  2WD9 A;  3ETO A;  1XNQ C;  5E7Q A;  2UXD C;  1HNZ C;  4XX2 A;  1M6X C;  2QL8 A;  1XNR C;  4DV6 C;  2E8F A;  5A1G A;  4L7I A;  1XMQ C;  1HR0 C;  5A19 A;  4G36 A;  4IZ6 A;  4DG8 A;  3A9U A;  1XMO C;  4B3T C;  5IFI A;  1N32 C;  2KZF A;  4I9F A;  4ISB A;  3GPC A;  2UUA C;  1NY8 A;  4D4I A;  5T8S A;  4RMN A;  4L2Z A;  1QWI A;  3I07 A;  4DCU A;  5ADZ A;  4JI4 C;  3GR1 A;  2P2F A;  1USP A;  4FTF A;  3CQ3 A;  1RG9 A;  2D28 C;  2D1Q A;  4ODJ A;  2P2J A;  2ONF A;  3TDE A;  4DR1 C;  4D56 A;  3T1H C;  2OBV A;  5A1I A;  4GXQ A;  3RG2 A;  4OYC A;  3A25 A;  2DYJ A;  4DV2 C;  3NYR A;  3N2Q A;  3SO4 A;  4R1L A;  1L2F A;  1PA4 A;  1T5D X;  1O93 A;  4JI8 C;  1N36 C;  5BST A;  1P4E A;  4X64 C;  2DPL A;  2E8E A;  5JRH A;  3FCC A;  1UKK A;  2AYA A;  2P2Q A;  3T1Y C;  1NYE A;  4RVN A;  3AF6 A;  2E7G A;  1T5H X;  4FUT A;  3H2T A;  4ZJZ A;  3PRO C;  5DV9 A;  5T8T A;  4JI1 C;  5LMN C;  1M6X A;  4DR6 C;  2WP0 C;  1N33 C;  2YWB A;  2BH1 X;  3R9W A;  2UXB C;  5CZV A;  5K85 A;  4RM2 A;  1MD9 A;  4DCS A;  1RY2 A;  4LF6 C;  1PU1 A;  2M5H A;  3CQ1 A;  3J7A D;  2M5O A;  2UU9 C;  1FUG A;  3TUF A;  1KKG A;  1MDB A;  4KHP C;  4RLF A;  2F4V C;  2ZM6 C;  4X62 C;  5LCI A;  5BSM A;  2UXC C;  1HH2 P;  3GR0 A;  2Z51 A;  2YX1 A;  2CY1 A;  4DG9 A;  4DCV A;  2PT7 G;  1IBM C;  4DR3 C;  5BSR A;  1XRA A;  2JNV A;  2QW0 X;  4JI3 C;  2V7B A;  3A4I A;  4NOZ A;  4LFA C;  3IEU A;  5AE3 A;  4LF7 C;  2CXC A;  2HHH C;  3G7S A;  5BSV A;  1TH5 A;  5IWA C;  2P02 A;  2UUC C;  4PRO C;  5FLX D;  3LNV A;  1YGT A;  1WH9 A;  2JMP A;  1USP B;  2E8C A;  4LF4 C;  2ASB A;  4WS9 A;  2Y4N A;  4GKK C;  2KDN A;  4TPS B;  4PUI A;  4B3M C;  4AQY C;  2PG1 E;  4RLQ A;  4LF9 C;  4DV3 C;  1LCI A;  3PES A;  4X65 C;  3CJE A;  1JOS A;  1ZB9 A;  2HJG A;  4WV3 A;  1O90 A;  2P20 A;  4IR7 A;  3TR3 A;  1XRC A;  4DV0 C;  4MH4 A;  3A9V A;  2Y4O A;  3JAM D;  3C5E A;  1IBL C;  4DV4 C;  2BJO A;  2PRO A;  3EER A;  3O2E A;  3KXW A;  4OXI A;  1WF3 A;  4L4Q A;  2QVY X;  3DHV A;  5KEI A;  2DHM A;  1AMU A;  4YHH C;  3J80 D;  3R44 A;  1YJ7 A;  1EGA A;  5KYV A;  4U5Y D;  2VZE A;  4I9G A;  3LAX A;  4NXM C;  3NYQ A;  2Y27 A;  3J81 D;  1HNX C;  4JI0 C;  5H9U A;  2QVX X;  1HNW C;  3CQ2 A;  1MKY A;  2QVZ X;  3IEV A;  3A26 A;  4R1M A;  1O9T A;  1PG4 A;  4DR5 C;  2E5L C;  4LE5 A;  3TQI A;  2ZZM A;  4JV5 C;  1VLA A;  4LF8 C;  3DAY A;  4RVO A;  2NCL A;  1V60 A;  4LF5 C;  1PG3 A;  4JI2 C;  1QM4 A;  3N54 B;  1VEH A;  1I94 C;  4LFC C;  3IML A;  5BR8 C;  4G37 A;  4DUY C;  3R9X A;  5AE2 A;  3UEB A;  3VNR A;  3NPD A;  4DV7 C;  1MXA A;  3E7W A;  2YWC A;  3L95 X;  1N2F A;  4NXN C;  4BC7 A;  4JI6 C;  2P2B A; 
#chains in the Genus database with same CATH homology
 5GTD A;  4DV5 C;  2OPL A;  3VNQ A;  3S82 A;  3LUS A;  3NI2 A;  4MTN A;  4RM3 A;  4BCA A;  2PN2 A;  4GXR A;  2D1S A;  5LMU C;  1P7L A;  5KYT A;  4DR7 C;  2EGT A;  1FJG C;  3UZ0 A;  1MXC A;  4EAT A;  4KTT A;  4OX9 C;  3UOW A;  1J5E C;  1MDF A;  4JM1 A;  2YCB A;  4JYA C;  4DUZ C;  3OTO C;  4LFB C;  5K8F A;  4D57 A;  3I08 A;  4PHT A;  5BUS A;  2P2M A;  4B3S C;  1GPM A;  3CW9 A;  5BSU A;  5IT9 D;  1MXB A;  3DLP X;  2D1T A;  4NDN A;  1XRB A;  2VQF C;  4DR2 C;  5A2Q D;  5AE1 A;  4DV1 C;  3VNS A;  1ML8 A;  3IPL A;  2VSQ A;  4B3R C;  4DR4 C;  2D1R A;  4YY3 C;  3LGX A;  4JI5 C;  5CZX A;  4D4G A;  5BUR A;  4BSZ A;  1IBK C;  3CW8 X;  2D27 A;  3FCE A;  3E7X A;  1N34 C;  2XR1 A;  3PBK A;  4BC9 A;  5BUQ A;  4BBY A;  3B7W A;  4G1I A;  3EQ6 A;  3RV2 A;  4GKJ C;  3GKU A;  1BA3 A;  3L8C A;  4X66 C;  1O92 A;  1V25 A;  2VQE C;  3ETC A;  4JI7 C;  2UUB C;  1LQL A;  4PZP A;  1V26 A;  2OPL B;  4FUQ A;  4KTV A;  5BSW A;  3AF5 A;  1ZB8 A;  4ZLP A;  4HPV A;  4K0B A;  2D7V A;  2E0G A;  1K0R A;  2ATW A;  4R0M A;  4GS5 A;  4DCT A;  2OO4 A;  4K0K C;  1ULT A;  2WD9 A;  3ETO A;  1XNQ C;  5E7Q A;  2UXD C;  1HNZ C;  4XX2 A;  2QL8 A;  1XNR C;  4DV6 C;  2E8F A;  5A1G A;  4L7I A;  1XMQ C;  1HR0 C;  5A19 A;  4G36 A;  4IZ6 A;  4DG8 A;  3A9U A;  1XMO C;  4B3T C;  5IFI A;  1N32 C;  2KZF A;  4I9F A;  4ISB A;  3GPC A;  2UUA C;  4D4I A;  5T8S A;  4RMN A;  4L2Z A;  1QWI A;  3I07 A;  4DCU A;  5ADZ A;  4JI4 C;  3GR1 A;  2P2F A;  1USP A;  4FTF A;  1RG9 A;  2D28 C;  2D1Q A;  4ODJ A;  2P2J A;  2ONF A;  3TDE A;  4DR1 C;  4D56 A;  3T1H C;  2OBV A;  5A1I A;  4GXQ A;  3RG2 A;  4OYC A;  2DYJ A;  4DV2 C;  3NYR A;  3N2Q A;  3SO4 A;  4R1L A;  1L2F A;  1PA4 A;  1T5D X;  1O93 A;  4JI8 C;  1N36 C;  5BST A;  4X64 C;  2DPL A;  2E8E A;  5JRH A;  3FCC A;  1UKK A;  2AYA A;  2P2Q A;  3T1Y C;  1NYE A;  4RVN A;  3AF6 A;  2E7G A;  1T5H X;  4FUT A;  3H2T A;  4ZJZ A;  3PRO C;  5DV9 A;  5T8T A;  4JI1 C;  5LMN C;  4DR6 C;  2WP0 C;  1N33 C;  2YWB A;  2BH1 X;  3R9W A;  2UXB C;  5CZV A;  5K85 A;  4RM2 A;  1MD9 A;  4DCS A;  1RY2 A;  4LF6 C;  3J7A D;  2UU9 C;  1FUG A;  3TUF A;  1KKG A;  1MDB A;  4KHP C;  4RLF A;  2F4V C;  2ZM6 C;  4X62 C;  5BSM A;  2UXC C;  1HH2 P;  3GR0 A;  2CY1 A;  4DG9 A;  4DCV A;  2PT7 G;  1IBM C;  4DR3 C;  5BSR A;  1XRA A;  2QW0 X;  4JI3 C;  2V7B A;  3A4I A;  4NOZ A;  4LFA C;  3IEU A;  5AE3 A;  4LF7 C;  2CXC A;  2HHH C;  3G7S A;  5BSV A;  5IWA C;  2P02 A;  2UUC C;  4PRO C;  5FLX D;  3LNV A;  1WH9 A;  2JMP A;  1USP B;  2E8C A;  4LF4 C;  2ASB A;  4WS9 A;  2Y4N A;  4GKK C;  4B3M C;  4TPS B;  4AQY C;  4RLQ A;  4LF9 C;  4DV3 C;  1LCI A;  3PES A;  4X65 C;  3CJE A;  1JOS A;  1ZB9 A;  2HJG A;  4WV3 A;  1O90 A;  2P20 A;  4IR7 A;  1XRC A;  4DV0 C;  4MH4 A;  3A9V A;  2Y4O A;  3JAM D;  3C5E A;  1IBL C;  4DV4 C;  2BJO A;  2PRO A;  3EER A;  3KXW A;  4OXI A;  1WF3 A;  4L4Q A;  2QVY X;  3DHV A;  5KEI A;  1AMU A;  4YHH C;  3J80 D;  3R44 A;  1YJ7 A;  1EGA A;  5KYV A;  4U5Y D;  2VZE A;  4I9G A;  3LAX A;  4NXM C;  3NYQ A;  2Y27 A;  3J81 D;  1HNX C;  4JI0 C;  5H9U A;  2QVX X;  1HNW C;  1MKY A;  2QVZ X;  3IEV A;  4R1M A;  1O9T A;  1PG4 A;  4DR5 C;  2E5L C;  4LE5 A;  3TQI A;  4JV5 C;  1VLA A;  4LF8 C;  3DAY A;  4RVO A;  4LF5 C;  1PG3 A;  4JI2 C;  1QM4 A;  3N54 B;  1I94 C;  4LFC C;  3IML A;  5BR8 C;  4G37 A;  4DUY C;  3R9X A;  5AE2 A;  3VNR A;  3NPD A;  4DV7 C;  1MXA A;  3E7W A;  2YWC A;  3L95 X;  1N2F A;  4NXN C;  4BC7 A;  4JI6 C;  2P2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...