4LF9C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf9C02
4NXNC 2UXCC 2UXBC 4KHPC 2UUAC 4DCUA 4JI3C 1HNZC 2YCBA 4K0KC 5IWAC 3IEUA 4X62C 3T1YC 1IBLC 1HNXC 5LMNC 1EGAA 4OX9C 5LMUC 2VQFC 1N36C 4B3SC 1VLAA 3J7AD 4DCVA 4LFCC 2XR1A 1XMOC 1K0RA 4JI8C 4LF4C 1USPB 4NXMC 4JI1C 4YHHC 3J80D 2E5LC 1L2FA 4LFBC 2OPLB 1N32C 4BSZA 2JMPA 2UU9C 2CXCA 2E8EA 4DUZC 1XNRC 4X66C 4JI7C 1WF3A 4DR5C 1N34C 4JI2C 4LF5C 2D7VA 2HJGA 1ZB8A 1KKGA 1ZB9A 2ATWA 3IEVA 2DYJA 5A2QD 4DUYC 4DR7C 1HH2P 4LF7C 3EERA 4B3MC 4MH4A 1LQLA 3J81D 3AF6A 1J5EC 2E8FA 4X65C 3R9XA 4JYAC 4JI6C 1PA4A 3JAMD 4JV5C 4DV4C 2KZFA 4MTNA 1USPA 4DCTA 4LF9C 2UUCC 1WH9A 4YY3C 1I94C 4JI4C 2ZM6C 4DR3C 1N33C 3OTOC 5FLXD 4GKJC 4DCSA 4GKKC 1ML8A 1IBMC 2F4VC 4B3RC 2OPLA 4DR2C 4DV1C 2HHHC 1JOSA 4DV0C 2CY1A 1HNWC 2E8CA 4DV3C 3CJEA 2ONFA 3AF5A 4XX2A 2VQEC 1FJGC 4DR6C 3I07A 4AQYC 1XMQC 3GKUA 4DV2C 1QWIA 2UXDC 5IT9D 4NOZA 1IBKC 2PT7G 3R9WA 2UUBC 1N2FA 2E7GA 4LF8C 2QL8A 2PN2A 5BR8C 1XNQC 4DR4C 1NYEA 4DV5C 4JI0C 2ASBA 4LFAC 3T1HC 1HR0C 4B3TC 4DV6C 4LF6C 1UKKA 3LUSA 4DV7C 1MKYA 4JI5C 4X64C 2EGTA 4DR1C 2BJOA
chains in the Genus database with same CATH superfamily
4KHPC 5A1GA 2DHMA 3IEUA 1RG9A 3TUFA 5LMNC 1EGAA 2AYAA 5LMUC 1FUGA 2XR1A 3NPDA 1FLOA 5BSMA 2E5LC 3TDEA 1XRBA 1L2FA 2OPLB 2JMPA 1BA3A 2WD9A 4JI7C 4ZLPA 4JI2C 3RV2A 3N54B 3A9UA 2OBVA 4RLQA 4L4QA 4DR7C 4ISBA 3FM7A 3EERA 4B3MC 5AE3A 4MH4A 3J81D 1XRAA 2E8FA 3R9XA 3JAMD 4JV5C 2KZFA 1USPA 1WH9A 3TQIA 4YY3C 3PESA 2ZM6C 1WCJA 4DR3C 4GKJC 1IBMC 4B3RC 5H9UA 3PBKA 3IPLA 2QVXX 1XRCA 4WV3A 5JRHA 3I07A 5BSTA 5ADZA 1XMQC 1PG3A 4R1MA 4FUTA 2UXDC 5IT9D 2VZEA 2PT7G 2Y4OA 2JNVA 2VSQA 3SO4A 2QL8A 2PN2A 3TR3A 4PZPA 1NYEA 2QVYX 4D57A 4D4IA 3DLPX 1M6XC 3LGXA 2P2FA 5BSUA 3ETOA 4X64C 3FCEA 2MMAB 1YGTA 2UUAC 1HNZC 4K0KC 5IWAC 3VNRA 5CZXA 4I9FA 3T1YC 3E7WA 4B3SC 4DCVA 1K0RA 1QM4A 3O2EA 4LF4C 4NXMC 2BH1X 4YHHC 3J80D 4RVNA 4K0BA 2KDNA 4BSZA 3L95X 4RM3A 1MDBA 2CXCA 4DUZC 3A26A 4G36A 2Y27A 1V26A 1WF3A 4DG9A 4BC7A 2CU6A 4BBYA 2HJGA 3I08A 5T8TA 5BUSA 1KKGA 4IZ6A 5KYVA 2ATWA 2P2MA 2QW0X 4OXIA 1LQLA 1T5DX 4HPVA 4TPSB 4X65C 4LF9C 3N2QA 1P7LA 1I94C 3CW9A 3GPCA 5BUQA 1N33C 1MXAA 2P2JA 3G7SA 1YJ7A 2M5HA 3B7WA 4BC9A 3CQ2A 2HHHC 1JOSA 1V25A 2D27A 2Y4NA 4OYCA 1MDFA 5IFIA 3E7XA 3UOWA 4DR6C 2QVZX 4WS9A 1IBKC 4L7IA 4LE5A 1N2FA 2D1TA 2E7GA 2V7BA 4DR4C 2D1SA 2D28C 4DV5C 4JI0C 3GR0A 4LFAC 2PROA 1HR0C 3EQ6A 1XHJA 5BSVA 2WP0C 3A4IA 2P2QA 2D1QA 3CQ3A 2P20A 3GR1A 2UXBC 4ZJZA 2YCBA 1HNXC 2M5OA 4OX9C 2VQFC 3C5EA 4GXQA 3J7AD 4LFCC 1XMOC 4BCAA 4R0MA 4LFBC 1N32C 3UX3A 3CW8X 2E8EA 5CZVA 3LAXA 4DR5C 4KTVA 1N34C 2P02A 4LF5C 2D7VA 1ZB9A 3IEVA 1T5HX 4DUYC 1IB8A 3K6RA 3AF6A 2P2BA 4JYAC 4PROC 1PA4A 4MTNA 4JI4C 3S82A 3ETCA 2DPLA 1LCIA 3NYQA 3OTOC 2KZ0A 5FLXD 4PHTA 4DCSA 1VEHA 1ML8A 2F4VC 3UEBA 4D4GA 3A25A 5BSWA 4RVOA 4DR2C 3LNOA 5AE1A 1O9TA 3A9VA 4DV0C 1HNWC 2E8CA 4DG8A 3RG2A 3CJEA 3AF5A 4XX2A 2VQEC 1M6XA 3UZ0A 1O90A 4AQYC 3GKUA 4NOZA 4RLFA 3R9WA 3DAYA 4JM1A 4FUQA 4D56A 2ASBA 3T1HC 1MXCA 3FCCA 3DHVA 4PUGA 4B3TC 4R1LA 4LF6C 3LUSA 4DV7C 5KEIA 4G1IA 4ODJA 4JI5C 2D1RA 5AE2A 3UX2A 5A19A 4U5YD 3CQ1A 2EGTA 2BJOA 1UWDA 4NXNC 2UXCC 4DCUA 4JI3C 4NDNA 3L8CA 3H2TA 3R44A 4L2ZA 4PUHA 5GTDA 4X62C 5BURA 1IBLC 1NY8A 4GXRA 2PG1E 1N36C 1XS3A 1VLAA 4JI8C 3VNQA 1GPMA 1USPB 1O93A 4EATA 4JI1C 1P4EC 2UU9C 5K8FA 1MD9A 1XNRC 4X66C 3AY0A 4KTTA 2YX1A 2MCQA 1V60A 2MM9A 1AMUA 1TH5A 1ZB8A 3KXWA 2DYJA 5A2QD 3NI2A 2YWCA 1HH2P 4LF7C 4RMNA 4IR7A 1J5EC 4JI6C 5K85A 4DV4C 4DCTA 2UUCC 1PU1A 4I9GA 5A1IA 5T8SA 2Z51A 4G37A 1PG4A 4GKKC 1MXBA 5DV9A 2OO4A 2OPLA 4PUIA 4DV1C 1O92A 1P4EA 5E7QA 1ULTA 2CY1A 1XDXA 4DV3C 3LNVA 2NCLA 2ONFA 2E0GA 2YWBA 1FJGC 1RY2A 3PROC 4DV2C 1QWIA 2ZTBA 4FTFA 2UUBC 4LF8C 2ZZNA 5BR8C 3IMLA 1XNQC 3VNSA 4DV6C 5KYTA 1UKKA 5BSRA 3NYRA 1MKYA 2ZZMA 4RM2A 4GS5A 4DR1C 5LCIA
chains in the Genus database with same CATH topology
4KHPC 5A1GA 3IEUA 1RG9A 3TUFA 5LMNC 1EGAA 2AYAA 5LMUC 1FUGA 2XR1A 3NPDA 5BSMA 2E5LC 3TDEA 1XRBA 1L2FA 2OPLB 2JMPA 1BA3A 2WD9A 4JI7C 4ZLPA 4JI2C 3RV2A 3N54B 3A9UA 2OBVA 4RLQA 4L4QA 4DR7C 4ISBA 3EERA 4B3MC 5AE3A 4MH4A 3J81D 1XRAA 2E8FA 3R9XA 3JAMD 4JV5C 2KZFA 1USPA 1WH9A 3TQIA 4YY3C 3PESA 2ZM6C 4DR3C 4GKJC 1IBMC 4B3RC 5H9UA 3PBKA 3IPLA 2QVXX 1XRCA 4WV3A 5JRHA 3I07A 5BSTA 5ADZA 1XMQC 1PG3A 4R1MA 4FUTA 2UXDC 5IT9D 2VZEA 2PT7G 2Y4OA 2VSQA 3SO4A 2QL8A 2PN2A 4PZPA 1NYEA 2QVYX 4D57A 4D4IA 3DLPX 3LGXA 2P2FA 5BSUA 3ETOA 4X64C 3FCEA 2UUAC 1HNZC 4K0KC 5IWAC 3VNRA 5CZXA 4I9FA 3T1YC 3E7WA 4B3SC 4DCVA 1K0RA 1QM4A 4LF4C 4NXMC 2BH1X 4YHHC 3J80D 4RVNA 4K0BA 4BSZA 3L95X 4RM3A 1MDBA 2CXCA 4DUZC 4G36A 2Y27A 1V26A 1WF3A 4DG9A 4BC7A 4BBYA 2HJGA 3I08A 5T8TA 5BUSA 1KKGA 4IZ6A 5KYVA 2ATWA 2P2MA 2QW0X 4OXIA 1LQLA 1T5DX 4HPVA 4TPSB 4X65C 4LF9C 3N2QA 1P7LA 1I94C 3CW9A 3GPCA 5BUQA 1N33C 1MXAA 2P2JA 3G7SA 1YJ7A 3B7WA 4BC9A 2HHHC 1JOSA 1V25A 2D27A 2Y4NA 4OYCA 1MDFA 5IFIA 3E7XA 3UOWA 4DR6C 2QVZX 4WS9A 1IBKC 4L7IA 4LE5A 1N2FA 2D1TA 2E7GA 2V7BA 4DR4C 2D1SA 2D28C 4DV5C 4JI0C 3GR0A 4LFAC 2PROA 1HR0C 3EQ6A 5BSVA 2WP0C 3A4IA 2P2QA 2D1QA 2P20A 3GR1A 2UXBC 4ZJZA 2YCBA 1HNXC 4OX9C 2VQFC 3C5EA 4GXQA 3J7AD 4LFCC 1XMOC 4BCAA 4R0MA 4LFBC 1N32C 3CW8X 2E8EA 5CZVA 3LAXA 4DR5C 4KTVA 1N34C 2P02A 4LF5C 2D7VA 1ZB9A 3IEVA 1T5HX 4DUYC 3AF6A 2P2BA 4JYAC 4PROC 1PA4A 4MTNA 4JI4C 3S82A 3ETCA 2DPLA 1LCIA 3NYQA 3OTOC 5FLXD 4PHTA 4DCSA 1ML8A 2F4VC 4D4GA 5BSWA 4RVOA 4DR2C 5AE1A 1O9TA 3A9VA 4DV0C 1HNWC 2E8CA 4DG8A 3RG2A 3CJEA 3AF5A 4XX2A 2VQEC 3UZ0A 1O90A 4AQYC 3GKUA 4NOZA 4RLFA 3R9WA 3DAYA 4JM1A 4FUQA 4D56A 2ASBA 3T1HC 1MXCA 3FCCA 3DHVA 4B3TC 4R1LA 4LF6C 3LUSA 4DV7C 5KEIA 4G1IA 4ODJA 4JI5C 2D1RA 5AE2A 5A19A 4U5YD 2EGTA 2BJOA 4NXNC 2UXCC 4DCUA 4JI3C 4NDNA 3L8CA 3H2TA 3R44A 4L2ZA 5GTDA 4X62C 5BURA 1IBLC 4GXRA 1N36C 1VLAA 4JI8C 3VNQA 1GPMA 1USPB 1O93A 4EATA 4JI1C 2UU9C 5K8FA 1MD9A 1XNRC 4X66C 4KTTA 1AMUA 1ZB8A 3KXWA 2DYJA 5A2QD 3NI2A 2YWCA 1HH2P 4LF7C 4RMNA 4IR7A 1J5EC 4JI6C 5K85A 4DV4C 4DCTA 2UUCC 4I9GA 5A1IA 5T8SA 4G37A 1PG4A 4GKKC 1MXBA 5DV9A 2OO4A 2OPLA 4DV1C 1O92A 5E7QA 1ULTA 2CY1A 4DV3C 3LNVA 2ONFA 2E0GA 2YWBA 1FJGC 1RY2A 3PROC 4DV2C 1QWIA 4FTFA 2UUBC 4LF8C 5BR8C 3IMLA 1XNQC 3VNSA 4DV6C 5KYTA 1UKKA 5BSRA 3NYRA 1MKYA 4RM2A 4GS5A 4DR1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN C;  2UXC C;  2UXB C;  4KHP C;  2UUA C;  4DCU A;  4JI3 C;  1HNZ C;  2YCB A;  4K0K C;  5IWA C;  3IEU A;  4X62 C;  3T1Y C;  1IBL C;  1HNX C;  5LMN C;  1EGA A;  4OX9 C;  5LMU C;  2VQF C;  1N36 C;  4B3S C;  1VLA A;  3J7A D;  4DCV A;  4LFC C;  2XR1 A;  1XMO C;  1K0R A;  4JI8 C;  4LF4 C;  1USP B;  4NXM C;  4JI1 C;  4YHH C;  3J80 D;  2E5L C;  1L2F A;  4LFB C;  2OPL B;  1N32 C;  4BSZ A;  2JMP A;  2UU9 C;  2CXC A;  2E8E A;  4DUZ C;  1XNR C;  4X66 C;  4JI7 C;  1WF3 A;  4DR5 C;  1N34 C;  4JI2 C;  4LF5 C;  2D7V A;  2HJG A;  1ZB8 A;  1KKG A;  1ZB9 A;  2ATW A;  3IEV A;  2DYJ A;  5A2Q D;  4DUY C;  4DR7 C;  1HH2 P;  4LF7 C;  3EER A;  4B3M C;  4MH4 A;  1LQL A;  3J81 D;  3AF6 A;  1J5E C;  2E8F A;  4X65 C;  3R9X A;  4JYA C;  4JI6 C;  1PA4 A;  3JAM D;  4JV5 C;  4DV4 C;  2KZF A;  4MTN A;  1USP A;  4DCT A;  4LF9 C;  2UUC C;  1WH9 A;  4YY3 C;  1I94 C;  4JI4 C;  2ZM6 C;  4DR3 C;  1N33 C;  3OTO C;  5FLX D;  4GKJ C;  4DCS A;  4GKK C;  1ML8 A;  1IBM C;  2F4V C;  4B3R C;  2OPL A;  4DR2 C;  4DV1 C;  2HHH C;  1JOS A;  4DV0 C;  2CY1 A;  1HNW C;  2E8C A;  4DV3 C;  3CJE A;  2ONF A;  3AF5 A;  4XX2 A;  2VQE C;  1FJG C;  4DR6 C;  3I07 A;  4AQY C;  1XMQ C;  3GKU A;  4DV2 C;  1QWI A;  2UXD C;  5IT9 D;  4NOZ A;  1IBK C;  2PT7 G;  3R9W A;  2UUB C;  1N2F A;  2E7G A;  4LF8 C;  2QL8 A;  2PN2 A;  5BR8 C;  1XNQ C;  4DR4 C;  1NYE A;  4DV5 C;  4JI0 C;  2ASB A;  4LFA C;  3T1H C;  1HR0 C;  4B3T C;  4DV6 C;  4LF6 C;  1UKK A;  3LUS A;  4DV7 C;  1MKY A;  4JI5 C;  4X64 C;  2EGT A;  4DR1 C;  2BJO A; 
#chains in the Genus database with same CATH topology
 4KHP C;  5A1G A;  2DHM A;  3IEU A;  1RG9 A;  3TUF A;  5LMN C;  1EGA A;  2AYA A;  5LMU C;  1FUG A;  2XR1 A;  3NPD A;  1FLO A;  5BSM A;  2E5L C;  3TDE A;  1XRB A;  1L2F A;  2OPL B;  2JMP A;  1BA3 A;  2WD9 A;  4JI7 C;  4ZLP A;  4JI2 C;  3RV2 A;  3N54 B;  3A9U A;  2OBV A;  4RLQ A;  4L4Q A;  4DR7 C;  4ISB A;  3FM7 A;  3EER A;  4B3M C;  5AE3 A;  4MH4 A;  3J81 D;  1XRA A;  2E8F A;  3R9X A;  3JAM D;  4JV5 C;  2KZF A;  1USP A;  1WH9 A;  3TQI A;  4YY3 C;  3PES A;  2ZM6 C;  1WCJ A;  4DR3 C;  4GKJ C;  1IBM C;  4B3R C;  5H9U A;  3PBK A;  3IPL A;  2QVX X;  1XRC A;  4WV3 A;  5JRH A;  3I07 A;  5BST A;  5ADZ A;  1XMQ C;  1PG3 A;  4R1M A;  4FUT A;  2UXD C;  5IT9 D;  2VZE A;  2PT7 G;  2Y4O A;  2JNV A;  2VSQ A;  3SO4 A;  2QL8 A;  2PN2 A;  3TR3 A;  4PZP A;  1NYE A;  2QVY X;  4D57 A;  4D4I A;  3DLP X;  1M6X C;  3LGX A;  2P2F A;  5BSU A;  3ETO A;  4X64 C;  3FCE A;  2MMA B;  1YGT A;  2UUA C;  1HNZ C;  4K0K C;  5IWA C;  3VNR A;  5CZX A;  4I9F A;  3T1Y C;  3E7W A;  4B3S C;  4DCV A;  1K0R A;  1QM4 A;  3O2E A;  4LF4 C;  4NXM C;  2BH1 X;  4YHH C;  3J80 D;  4RVN A;  4K0B A;  2KDN A;  4BSZ A;  3L95 X;  4RM3 A;  1MDB A;  2CXC A;  4DUZ C;  3A26 A;  4G36 A;  2Y27 A;  1V26 A;  1WF3 A;  4DG9 A;  4BC7 A;  2CU6 A;  4BBY A;  2HJG A;  3I08 A;  5T8T A;  5BUS A;  1KKG A;  4IZ6 A;  5KYV A;  2ATW A;  2P2M A;  2QW0 X;  4OXI A;  1LQL A;  1T5D X;  4HPV A;  4TPS B;  4X65 C;  4LF9 C;  3N2Q A;  1P7L A;  1I94 C;  3CW9 A;  3GPC A;  5BUQ A;  1N33 C;  1MXA A;  2P2J A;  3G7S A;  1YJ7 A;  2M5H A;  3B7W A;  4BC9 A;  3CQ2 A;  2HHH C;  1JOS A;  1V25 A;  2D27 A;  2Y4N A;  4OYC A;  1MDF A;  5IFI A;  3E7X A;  3UOW A;  4DR6 C;  2QVZ X;  4WS9 A;  1IBK C;  4L7I A;  4LE5 A;  1N2F A;  2D1T A;  2E7G A;  2V7B A;  4DR4 C;  2D1S A;  2D28 C;  4DV5 C;  4JI0 C;  3GR0 A;  4LFA C;  2PRO A;  1HR0 C;  3EQ6 A;  1XHJ A;  5BSV A;  2WP0 C;  3A4I A;  2P2Q A;  2D1Q A;  3CQ3 A;  2P20 A;  3GR1 A;  2UXB C;  4ZJZ A;  2YCB A;  1HNX C;  2M5O A;  4OX9 C;  2VQF C;  3C5E A;  4GXQ A;  3J7A D;  4LFC C;  1XMO C;  4BCA A;  4R0M A;  4LFB C;  1N32 C;  3UX3 A;  3CW8 X;  2E8E A;  5CZV A;  3LAX A;  4DR5 C;  4KTV A;  1N34 C;  2P02 A;  4LF5 C;  2D7V A;  1ZB9 A;  3IEV A;  1T5H X;  4DUY C;  1IB8 A;  3K6R A;  3AF6 A;  2P2B A;  4JYA C;  4PRO C;  1PA4 A;  4MTN A;  4JI4 C;  3S82 A;  3ETC A;  2DPL A;  1LCI A;  3NYQ A;  3OTO C;  2KZ0 A;  5FLX D;  4PHT A;  4DCS A;  1VEH A;  1ML8 A;  2F4V C;  3UEB A;  4D4G A;  3A25 A;  5BSW A;  4RVO A;  4DR2 C;  3LNO A;  5AE1 A;  1O9T A;  3A9V A;  4DV0 C;  1HNW C;  2E8C A;  4DG8 A;  3RG2 A;  3CJE A;  3AF5 A;  4XX2 A;  2VQE C;  1M6X A;  3UZ0 A;  1O90 A;  4AQY C;  3GKU A;  4NOZ A;  4RLF A;  3R9W A;  3DAY A;  4JM1 A;  4FUQ A;  4D56 A;  2ASB A;  3T1H C;  1MXC A;  3FCC A;  3DHV A;  4PUG A;  4B3T C;  4R1L A;  4LF6 C;  3LUS A;  4DV7 C;  5KEI A;  4G1I A;  4ODJ A;  4JI5 C;  2D1R A;  5AE2 A;  3UX2 A;  5A19 A;  4U5Y D;  3CQ1 A;  2EGT A;  2BJO A;  1UWD A;  4NXN C;  2UXC C;  4DCU A;  4JI3 C;  4NDN A;  3L8C A;  3H2T A;  3R44 A;  4L2Z A;  4PUH A;  5GTD A;  4X62 C;  5BUR A;  1IBL C;  1NY8 A;  4GXR A;  2PG1 E;  1N36 C;  1XS3 A;  1VLA A;  4JI8 C;  3VNQ A;  1GPM A;  1USP B;  1O93 A;  4EAT A;  4JI1 C;  1P4E C;  2UU9 C;  5K8F A;  1MD9 A;  1XNR C;  4X66 C;  3AY0 A;  4KTT A;  2YX1 A;  2MCQ A;  1V60 A;  2MM9 A;  1AMU A;  1TH5 A;  1ZB8 A;  3KXW A;  2DYJ A;  5A2Q D;  3NI2 A;  2YWC A;  1HH2 P;  4LF7 C;  4RMN A;  4IR7 A;  1J5E C;  4JI6 C;  5K85 A;  4DV4 C;  4DCT A;  2UUC C;  1PU1 A;  4I9G A;  5A1I A;  5T8S A;  2Z51 A;  4G37 A;  1PG4 A;  4GKK C;  1MXB A;  5DV9 A;  2OO4 A;  2OPL A;  4PUI A;  4DV1 C;  1O92 A;  1P4E A;  5E7Q A;  1ULT A;  2CY1 A;  1XDX A;  4DV3 C;  3LNV A;  2NCL A;  2ONF A;  2E0G A;  2YWB A;  1FJG C;  1RY2 A;  3PRO C;  4DV2 C;  1QWI A;  2ZTB A;  4FTF A;  2UUB C;  4LF8 C;  2ZZN A;  5BR8 C;  3IML A;  1XNQ C;  3VNS A;  4DV6 C;  5KYT A;  1UKK A;  5BSR A;  3NYR A;  1MKY A;  2ZZM A;  4RM2 A;  4GS5 A;  4DR1 C;  5LCI A; 
#chains in the Genus database with same CATH homology
 4KHP C;  5A1G A;  3IEU A;  1RG9 A;  3TUF A;  5LMN C;  1EGA A;  2AYA A;  5LMU C;  1FUG A;  2XR1 A;  3NPD A;  5BSM A;  2E5L C;  3TDE A;  1XRB A;  1L2F A;  2OPL B;  2JMP A;  1BA3 A;  2WD9 A;  4JI7 C;  4ZLP A;  4JI2 C;  3RV2 A;  3N54 B;  3A9U A;  2OBV A;  4RLQ A;  4L4Q A;  4DR7 C;  4ISB A;  3EER A;  4B3M C;  5AE3 A;  4MH4 A;  3J81 D;  1XRA A;  2E8F A;  3R9X A;  3JAM D;  4JV5 C;  2KZF A;  1USP A;  1WH9 A;  3TQI A;  4YY3 C;  3PES A;  2ZM6 C;  4DR3 C;  4GKJ C;  1IBM C;  4B3R C;  5H9U A;  3PBK A;  3IPL A;  2QVX X;  1XRC A;  4WV3 A;  5JRH A;  3I07 A;  5BST A;  5ADZ A;  1XMQ C;  1PG3 A;  4R1M A;  4FUT A;  2UXD C;  5IT9 D;  2VZE A;  2PT7 G;  2Y4O A;  2VSQ A;  3SO4 A;  2QL8 A;  2PN2 A;  4PZP A;  1NYE A;  2QVY X;  4D57 A;  4D4I A;  3DLP X;  3LGX A;  2P2F A;  5BSU A;  3ETO A;  4X64 C;  3FCE A;  2UUA C;  1HNZ C;  4K0K C;  5IWA C;  3VNR A;  5CZX A;  4I9F A;  3T1Y C;  3E7W A;  4B3S C;  4DCV A;  1K0R A;  1QM4 A;  4LF4 C;  4NXM C;  2BH1 X;  4YHH C;  3J80 D;  4RVN A;  4K0B A;  4BSZ A;  3L95 X;  4RM3 A;  1MDB A;  2CXC A;  4DUZ C;  4G36 A;  2Y27 A;  1V26 A;  1WF3 A;  4DG9 A;  4BC7 A;  4BBY A;  2HJG A;  3I08 A;  5T8T A;  5BUS A;  1KKG A;  4IZ6 A;  5KYV A;  2ATW A;  2P2M A;  2QW0 X;  4OXI A;  1LQL A;  1T5D X;  4HPV A;  4TPS B;  4X65 C;  4LF9 C;  3N2Q A;  1P7L A;  1I94 C;  3CW9 A;  3GPC A;  5BUQ A;  1N33 C;  1MXA A;  2P2J A;  3G7S A;  1YJ7 A;  3B7W A;  4BC9 A;  2HHH C;  1JOS A;  1V25 A;  2D27 A;  2Y4N A;  4OYC A;  1MDF A;  5IFI A;  3E7X A;  3UOW A;  4DR6 C;  2QVZ X;  4WS9 A;  1IBK C;  4L7I A;  4LE5 A;  1N2F A;  2D1T A;  2E7G A;  2V7B A;  4DR4 C;  2D1S A;  2D28 C;  4DV5 C;  4JI0 C;  3GR0 A;  4LFA C;  2PRO A;  1HR0 C;  3EQ6 A;  5BSV A;  2WP0 C;  3A4I A;  2P2Q A;  2D1Q A;  2P20 A;  3GR1 A;  2UXB C;  4ZJZ A;  2YCB A;  1HNX C;  4OX9 C;  2VQF C;  3C5E A;  4GXQ A;  3J7A D;  4LFC C;  1XMO C;  4BCA A;  4R0M A;  4LFB C;  1N32 C;  3CW8 X;  2E8E A;  5CZV A;  3LAX A;  4DR5 C;  4KTV A;  1N34 C;  2P02 A;  4LF5 C;  2D7V A;  1ZB9 A;  3IEV A;  1T5H X;  4DUY C;  3AF6 A;  2P2B A;  4JYA C;  4PRO C;  1PA4 A;  4MTN A;  4JI4 C;  3S82 A;  3ETC A;  2DPL A;  1LCI A;  3NYQ A;  3OTO C;  5FLX D;  4PHT A;  4DCS A;  1ML8 A;  2F4V C;  4D4G A;  5BSW A;  4RVO A;  4DR2 C;  5AE1 A;  1O9T A;  3A9V A;  4DV0 C;  1HNW C;  2E8C A;  4DG8 A;  3RG2 A;  3CJE A;  3AF5 A;  4XX2 A;  2VQE C;  3UZ0 A;  1O90 A;  4AQY C;  3GKU A;  4NOZ A;  4RLF A;  3R9W A;  3DAY A;  4JM1 A;  4FUQ A;  4D56 A;  2ASB A;  3T1H C;  1MXC A;  3FCC A;  3DHV A;  4B3T C;  4R1L A;  4LF6 C;  3LUS A;  4DV7 C;  5KEI A;  4G1I A;  4ODJ A;  4JI5 C;  2D1R A;  5AE2 A;  5A19 A;  4U5Y D;  2EGT A;  2BJO A;  4NXN C;  2UXC C;  4DCU A;  4JI3 C;  4NDN A;  3L8C A;  3H2T A;  3R44 A;  4L2Z A;  5GTD A;  4X62 C;  5BUR A;  1IBL C;  4GXR A;  1N36 C;  1VLA A;  4JI8 C;  3VNQ A;  1GPM A;  1USP B;  1O93 A;  4EAT A;  4JI1 C;  2UU9 C;  5K8F A;  1MD9 A;  1XNR C;  4X66 C;  4KTT A;  1AMU A;  1ZB8 A;  3KXW A;  2DYJ A;  5A2Q D;  3NI2 A;  2YWC A;  1HH2 P;  4LF7 C;  4RMN A;  4IR7 A;  1J5E C;  4JI6 C;  5K85 A;  4DV4 C;  4DCT A;  2UUC C;  4I9G A;  5A1I A;  5T8S A;  4G37 A;  1PG4 A;  4GKK C;  1MXB A;  5DV9 A;  2OO4 A;  2OPL A;  4DV1 C;  1O92 A;  5E7Q A;  1ULT A;  2CY1 A;  4DV3 C;  3LNV A;  2ONF A;  2E0G A;  2YWB A;  1FJG C;  1RY2 A;  3PRO C;  4DV2 C;  1QWI A;  4FTF A;  2UUB C;  4LF8 C;  5BR8 C;  3IML A;  1XNQ C;  3VNS A;  4DV6 C;  5KYT A;  1UKK A;  5BSR A;  3NYR A;  1MKY A;  4RM2 A;  4GS5 A;  4DR1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...