4LF9C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf9C02
4X62C 2XR1A 2E5LC 4JI6C 5IT9D 2OPLB 1IBKC 2DYJA 3CJEA 3R9XA 1HNWC 1QWIA 1HNZC 2UU9C 4B3MC 4DCUA 4DV3C 2PN2A 2YCBA 2ASBA 4DV1C 1UKKA 3I07A 5IWAC 5BR8C 4DR3C 4JI8C 4LF6C 3IEVA 4DV5C 2CXCA 1N33C 3T1YC 3LUSA 3AF6A 2ONFA 2UUCC 2CY1A 4JI0C 4DR5C 4DCSA 2E7GA 4AQYC 1L2FA 4DR6C 2ZM6C 3J7AD 2E8CA 1PA4A 4X65C 1XMQC 2OPLA 3J81D 4DV6C 4DV0C 1J5EC 3T1HC 4DR4C 5LMNC 2JMPA 4DV7C 1USPB 4KHPC 4B3SC 4NXMC 1N36C 2UXCC 1K0RA 4K0KC 1JOSA 5LMUC 4LF9C 1EGAA 1ZB8A 4MTNA 1N2FA 1XNQC 1NYEA 4DUZC 4LF4C 2UXDC 4DUYC 2UXBC 4JI1C 2HJGA 4DCVA 2BJOA 2PT7G 1I94C 3EERA 2VQFC 4LFCC 2UUBC 1LQLA 4JV5C 1WH9A 1WF3A 2EGTA 2F4VC 4GKKC 1IBMC 1VLAA 1N34C 2KZFA 4JI7C 1HNXC 3J80D 3GKUA 4JI2C 2D7VA 4X64C 4GKJC 5A2QD 2E8FA 1FJGC 4DV4C 1XNRC 4NOZA 1XMOC 4B3TC 3AF5A 1HH2P 3IEUA 2QL8A 4JI4C 4DCTA 3R9WA 4B3RC 4JYAC 2ATWA 3JAMD 4BSZA 4YHHC 4NXNC 1ZB9A 1KKGA 1IBLC 4LF5C 1USPA 4JI5C 1HR0C 2UUAC 1MKYA 4DR1C 5FLXD 4YY3C 4MH4A 4DV2C 4OX9C 4DR7C 4XX2A 2HHHC 2VQEC 4LFAC 4JI3C 4LFBC 1ML8A 1N32C 3OTOC 4LF8C 4LF7C 4DR2C 2E8EA 4X66C
chains in the Genus database with same CATH superfamily
2E5LC 3A26A 4JI6C 3ETOA 5BSRA 2DYJA 5BSUA 3RG2A 1XDXA 3C5EA 4B3MC 4PUGA 4JM1A 1ULTA 3LGXA 2YCBA 1UKKA 5BR8C 3B7WA 4NDNA 2D28C 1N33C 3T1YC 4WV3A 3AF6A 4RMNA 2CY1A 4DR6C 1L2FA 1O9TA 3J7AD 1PA4A 4DV6C 4RVNA 2QVYX 3T1HC 2P2FA 5LMNC 3SO4A 1M6XA 2ZTBA 4RLQA 1N36C 2BH1X 4GXQA 5T8SA 2NCLA 1JOSA 5JRHA 3CQ3A 1ZB8A 4PUIA 3VNRA 4FUTA 3IPLA 4LF4C 2QVZX 1GPMA 3E7WA 2HJGA 3CW8X 5BUQA 2P02A 2P2JA 3N2QA 5K8FA 2PG1E 5K85A 2EGTA 3NYRA 4RVOA 2D27A 1FUGA 2DHMA 4GKJC 2E8FA 4DV4C 1XNRC 2MMAB 3GR1A 4RM2A 4I9FA 3I08A 1P7LA 5H9UA 2VZEA 2JNVA 3LNOA 3TUFA 3TR3A 4G1IA 4BSZA 4NXNC 1USPA 3AY0A 1MKYA 5FLXD 4D4IA 5AE3A 2M5OA 1MDFA 3GR0A 4JI3C 2Y4NA 5BUSA 1ML8A 3OTOC 2PROA 2OPLB 2DPLA 2VSQA 4OYCA 3R9XA 1HNZC 3A9UA 4HPVA 4DV3C 2PN2A 1V26A 4R0MA 1XRAA 4DV1C 2ASBA 3I07A 2YWBA 1MXAA 4DR3C 4JI8C 4RLFA 2Y4OA 3UOWA 2ONFA 5BURA 4BCAA 4K0BA 4GS5A 4JI0C 2E8CA 3UX3A 4X65C 2OPLA 3J81D 1J5EC 3UX2A 1T5DX 4BC7A 3CQ1A 1K0RA 3FCCA 3PBKA 1UWDA 1EGAA 3H2TA 4PHTA 1XS3A 4JI1C 5BSWA 1XHJA 2PT7G 5IFIA 4ODJA 4JV5C 1FLOA 4GKKC 3GPCA 2KZFA 4D57A 2P2BA 1HNXC 3GKUA 2D7VA 4X64C 3A9VA 2QW0X 4L7IA 1V25A 2YX1A 3IEUA 3R9WA 2D1TA 4B3RC 5CZXA 3ETCA 1KKGA 4RM3A 4LF5C 1HR0C 4BBYA 4DR1C 4YY3C 1P4EC 4DV2C 4OX9C 4DR7C 4XX2A 2HHHC 4LFAC 4LFBC 1XRBA 2MM9A 4X62C 2XR1A 4PZPA 5IT9D 3CJEA 1HNWC 1QWIA 1TH5A 3S82A 4DCUA 3FCEA 2MCQA 1RG9A 5AE1A 3TDEA 4LF6C 3IEVA 3O2EA 2CXCA 3PESA 2CU6A 3LUSA 5DV9A 4KTVA 2UUCC 4ZLPA 4ZJZA 4DCSA 5LCIA 5BSMA 2D1QA 1XMQC 3DAYA 2AYAA 4DV7C 4TPSB 1WCJA 4OXIA 4NXMC 3CW9A 2OBVA 5GTDA 5T8TA 1XRCA 5AE2A 2P2QA 2KZ0A 3K6RA 5LMUC 4LF9C 3EQ6A 4MTNA 1XNQC 1NYEA 4IZ6A 4DUZC 2UXBC 1M6XC 4DCVA 4DG9A 2BJOA 3DHVA 2YWCA 4LFCC 2UUBC 3UEBA 5ADZA 2V7BA 1T5HX 1IB8A 4PUHA 3R44A 1AMUA 1N34C 4I9GA 3VNSA 1VEHA 5A2QD 5BSVA 1BA3A 1FJGC 3G7SA 3NYQA 3RV2A 4NOZA 4R1MA 2KDNA 1XMOC 4BC9A 4L2ZA 4PROC 4GXRA 4IR7A 4B3TC 4FTFA 5BSTA 1O93A 5E7QA 3JAMD 5A1GA 3IMLA 4YHHC 1IBLC 2Z51A 2ZZNA 1O92A 5KEIA 1QM4A 2P2MA 1YGTA 2VQEC 2QVXX 3VNQA 1NY8A 1MDBA 3A4IA 1V60A 4DG8A 4LF8C 3FM7A 3KXWA 1IBKC 5KYTA 2UU9C 3DLPX 3A25A 5A1IA 4EATA 1PU1A 5IWAC 1RY2A 3PROC 4DV5C 4R1LA 3UZ0A 3NI2A 1O90A 4DR5C 2E7GA 4G36A 4AQYC 2ZM6C 4LE5A 3LNVA 4DV0C 4L4QA 1MD9A 4DR4C 2JMPA 2M5HA 1USPB 4KHPC 4D56A 3L8CA 2WD9A 1YJ7A 4B3SC 2UXCC 4K0KC 3L95X 4D4GA 1MXCA 2D1RA 1N2FA 2UXDC 4DUYC 5KYVA 1I94C 5CZVA 3EERA 2VQFC 1PG4A 1PG3A 1LQLA 2E0GA 1WH9A 3LAXA 1WF3A 2F4VC 1IBMC 1VLAA 3E7XA 4JI7C 4ISBA 3J80D 3TQIA 4FUQA 4JI2C 4WS9A 1P4EA 2WP0C 2OO4A 4G37A 3AF5A 1HH2P 2QL8A 4JI4C 2ZZMA 3N54B 4DCTA 4JYAC 2Y27A 2ATWA 2P20A 1ZB9A 1LCIA 4JI5C 3CQ2A 4U5YD 2UUAC 1MXBA 4MH4A 3NPDA 4KTTA 2D1SA 1N32C 5A19A 4LF7C 4DR2C 2E8EA 4X66C
chains in the Genus database with same CATH topology
2E5LC 4JI6C 3ETOA 5BSRA 2DYJA 5BSUA 3RG2A 3C5EA 4B3MC 4JM1A 1ULTA 3LGXA 2YCBA 1UKKA 5BR8C 3B7WA 4NDNA 2D28C 1N33C 3T1YC 4WV3A 3AF6A 4RMNA 2CY1A 4DR6C 1L2FA 1O9TA 3J7AD 1PA4A 4DV6C 4RVNA 2QVYX 3T1HC 2P2FA 5LMNC 3SO4A 4RLQA 1N36C 2BH1X 4GXQA 5T8SA 1JOSA 5JRHA 1ZB8A 3VNRA 4FUTA 3IPLA 4LF4C 2QVZX 1GPMA 3E7WA 2HJGA 3CW8X 5BUQA 2P02A 2P2JA 3N2QA 5K8FA 5K85A 2EGTA 3NYRA 4RVOA 2D27A 1FUGA 4GKJC 2E8FA 4DV4C 1XNRC 3GR1A 4RM2A 4I9FA 3I08A 1P7LA 5H9UA 2VZEA 3TUFA 4G1IA 4BSZA 4NXNC 1USPA 1MKYA 5FLXD 4D4IA 5AE3A 1MDFA 3GR0A 4JI3C 2Y4NA 5BUSA 1ML8A 3OTOC 2PROA 2OPLB 2DPLA 2VSQA 4OYCA 3R9XA 1HNZC 3A9UA 4HPVA 4DV3C 2PN2A 1V26A 4R0MA 1XRAA 4DV1C 2ASBA 3I07A 2YWBA 1MXAA 4DR3C 4JI8C 4RLFA 2Y4OA 3UOWA 2ONFA 5BURA 4BCAA 4K0BA 4GS5A 4JI0C 2E8CA 4X65C 2OPLA 3J81D 1J5EC 1T5DX 4BC7A 1K0RA 3FCCA 3PBKA 1EGAA 3H2TA 4PHTA 4JI1C 5BSWA 2PT7G 5IFIA 4ODJA 4JV5C 4GKKC 3GPCA 2KZFA 4D57A 2P2BA 1HNXC 3GKUA 2D7VA 4X64C 3A9VA 2QW0X 4L7IA 1V25A 3IEUA 3R9WA 2D1TA 4B3RC 5CZXA 3ETCA 1KKGA 4RM3A 4LF5C 1HR0C 4BBYA 4DR1C 4YY3C 4OX9C 4DV2C 4DR7C 4XX2A 2HHHC 4LFAC 4LFBC 1XRBA 4X62C 2XR1A 4PZPA 5IT9D 3CJEA 1HNWC 1QWIA 3S82A 4DCUA 3FCEA 1RG9A 5AE1A 3TDEA 4LF6C 3IEVA 2CXCA 3PESA 3LUSA 5DV9A 4KTVA 2UUCC 4ZLPA 4ZJZA 4DCSA 5BSMA 2D1QA 1XMQC 3DAYA 2AYAA 4DV7C 4TPSB 4OXIA 4NXMC 3CW9A 2OBVA 5GTDA 5T8TA 1XRCA 5AE2A 2P2QA 5LMUC 4LF9C 3EQ6A 4MTNA 1XNQC 1NYEA 4IZ6A 4DUZC 2UXBC 4DCVA 4DG9A 2BJOA 3DHVA 2YWCA 4LFCC 2UUBC 5ADZA 2V7BA 1T5HX 3R44A 1AMUA 1N34C 4I9GA 3VNSA 5A2QD 5BSVA 1BA3A 1FJGC 3G7SA 3NYQA 3RV2A 4NOZA 4R1MA 1XMOC 4BC9A 4L2ZA 4PROC 4GXRA 4IR7A 4B3TC 4FTFA 5BSTA 1O93A 5E7QA 3JAMD 5A1GA 3IMLA 4YHHC 1IBLC 1O92A 5KEIA 1QM4A 2P2MA 2VQEC 2QVXX 3VNQA 3A4IA 1MDBA 4DG8A 4LF8C 3KXWA 1IBKC 5KYTA 2UU9C 3DLPX 5A1IA 4EATA 5IWAC 1RY2A 3PROC 4DV5C 4R1LA 3UZ0A 3NI2A 1O90A 4DR5C 2E7GA 4G36A 4AQYC 2ZM6C 4LE5A 3LNVA 4DV0C 4L4QA 1MD9A 4DR4C 2JMPA 1USPB 4KHPC 4D56A 3L8CA 2WD9A 1YJ7A 4B3SC 2UXCC 4K0KC 3L95X 4D4GA 1MXCA 2D1RA 1N2FA 2UXDC 4DUYC 5KYVA 1I94C 5CZVA 3EERA 2VQFC 1PG4A 1PG3A 1LQLA 2E0GA 1WH9A 3LAXA 1WF3A 2F4VC 1IBMC 1VLAA 3E7XA 4JI7C 4ISBA 3J80D 3TQIA 4FUQA 4JI2C 4WS9A 2WP0C 2OO4A 4G37A 3AF5A 1HH2P 2QL8A 4JI4C 3N54B 4DCTA 4JYAC 2Y27A 2ATWA 2P20A 1ZB9A 1LCIA 4JI5C 4U5YD 2UUAC 1MXBA 4MH4A 3NPDA 4KTTA 2D1SA 1N32C 5A19A 4LF7C 4DR2C 2E8EA 4X66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 C;  2XR1 A;  2E5L C;  4JI6 C;  5IT9 D;  2OPL B;  1IBK C;  2DYJ A;  3CJE A;  3R9X A;  1HNW C;  1QWI A;  1HNZ C;  2UU9 C;  4B3M C;  4DCU A;  4DV3 C;  2PN2 A;  2YCB A;  2ASB A;  4DV1 C;  1UKK A;  3I07 A;  5IWA C;  5BR8 C;  4DR3 C;  4JI8 C;  4LF6 C;  3IEV A;  4DV5 C;  2CXC A;  1N33 C;  3T1Y C;  3LUS A;  3AF6 A;  2ONF A;  2UUC C;  2CY1 A;  4JI0 C;  4DR5 C;  4DCS A;  2E7G A;  4AQY C;  1L2F A;  4DR6 C;  2ZM6 C;  3J7A D;  2E8C A;  1PA4 A;  4X65 C;  1XMQ C;  2OPL A;  3J81 D;  4DV6 C;  4DV0 C;  1J5E C;  3T1H C;  4DR4 C;  5LMN C;  2JMP A;  4DV7 C;  1USP B;  4KHP C;  4B3S C;  4NXM C;  1N36 C;  2UXC C;  1K0R A;  4K0K C;  1JOS A;  5LMU C;  4LF9 C;  1EGA A;  1ZB8 A;  4MTN A;  1N2F A;  1XNQ C;  1NYE A;  4DUZ C;  4LF4 C;  2UXD C;  4DUY C;  2UXB C;  4JI1 C;  2HJG A;  4DCV A;  2BJO A;  2PT7 G;  1I94 C;  3EER A;  2VQF C;  4LFC C;  2UUB C;  1LQL A;  4JV5 C;  1WH9 A;  1WF3 A;  2EGT A;  2F4V C;  4GKK C;  1IBM C;  1VLA A;  1N34 C;  2KZF A;  4JI7 C;  1HNX C;  3J80 D;  3GKU A;  4JI2 C;  2D7V A;  4X64 C;  4GKJ C;  5A2Q D;  2E8F A;  1FJG C;  4DV4 C;  1XNR C;  4NOZ A;  1XMO C;  4B3T C;  3AF5 A;  1HH2 P;  3IEU A;  2QL8 A;  4JI4 C;  4DCT A;  3R9W A;  4B3R C;  4JYA C;  2ATW A;  3JAM D;  4BSZ A;  4YHH C;  4NXN C;  1ZB9 A;  1KKG A;  1IBL C;  4LF5 C;  1USP A;  4JI5 C;  1HR0 C;  2UUA C;  1MKY A;  4DR1 C;  5FLX D;  4YY3 C;  4MH4 A;  4DV2 C;  4OX9 C;  4DR7 C;  4XX2 A;  2HHH C;  2VQE C;  4LFA C;  4JI3 C;  4LFB C;  1ML8 A;  1N32 C;  3OTO C;  4LF8 C;  4LF7 C;  4DR2 C;  2E8E A;  4X66 C; 
#chains in the Genus database with same CATH topology
 2E5L C;  3A26 A;  4JI6 C;  3ETO A;  5BSR A;  2DYJ A;  5BSU A;  3RG2 A;  1XDX A;  3C5E A;  4B3M C;  4PUG A;  4JM1 A;  1ULT A;  3LGX A;  2YCB A;  1UKK A;  5BR8 C;  3B7W A;  4NDN A;  2D28 C;  1N33 C;  3T1Y C;  4WV3 A;  3AF6 A;  4RMN A;  2CY1 A;  4DR6 C;  1L2F A;  1O9T A;  3J7A D;  1PA4 A;  4DV6 C;  4RVN A;  2QVY X;  3T1H C;  2P2F A;  5LMN C;  3SO4 A;  1M6X A;  2ZTB A;  4RLQ A;  1N36 C;  2BH1 X;  4GXQ A;  5T8S A;  2NCL A;  1JOS A;  5JRH A;  3CQ3 A;  1ZB8 A;  4PUI A;  3VNR A;  4FUT A;  3IPL A;  4LF4 C;  2QVZ X;  1GPM A;  3E7W A;  2HJG A;  3CW8 X;  5BUQ A;  2P02 A;  2P2J A;  3N2Q A;  5K8F A;  2PG1 E;  5K85 A;  2EGT A;  3NYR A;  4RVO A;  2D27 A;  1FUG A;  2DHM A;  4GKJ C;  2E8F A;  4DV4 C;  1XNR C;  2MMA B;  3GR1 A;  4RM2 A;  4I9F A;  3I08 A;  1P7L A;  5H9U A;  2VZE A;  2JNV A;  3LNO A;  3TUF A;  3TR3 A;  4G1I A;  4BSZ A;  4NXN C;  1USP A;  3AY0 A;  1MKY A;  5FLX D;  4D4I A;  5AE3 A;  2M5O A;  1MDF A;  3GR0 A;  4JI3 C;  2Y4N A;  5BUS A;  1ML8 A;  3OTO C;  2PRO A;  2OPL B;  2DPL A;  2VSQ A;  4OYC A;  3R9X A;  1HNZ C;  3A9U A;  4HPV A;  4DV3 C;  2PN2 A;  1V26 A;  4R0M A;  1XRA A;  4DV1 C;  2ASB A;  3I07 A;  2YWB A;  1MXA A;  4DR3 C;  4JI8 C;  4RLF A;  2Y4O A;  3UOW A;  2ONF A;  5BUR A;  4BCA A;  4K0B A;  4GS5 A;  4JI0 C;  2E8C A;  3UX3 A;  4X65 C;  2OPL A;  3J81 D;  1J5E C;  3UX2 A;  1T5D X;  4BC7 A;  3CQ1 A;  1K0R A;  3FCC A;  3PBK A;  1UWD A;  1EGA A;  3H2T A;  4PHT A;  1XS3 A;  4JI1 C;  5BSW A;  1XHJ A;  2PT7 G;  5IFI A;  4ODJ A;  4JV5 C;  1FLO A;  4GKK C;  3GPC A;  2KZF A;  4D57 A;  2P2B A;  1HNX C;  3GKU A;  2D7V A;  4X64 C;  3A9V A;  2QW0 X;  4L7I A;  1V25 A;  2YX1 A;  3IEU A;  3R9W A;  2D1T A;  4B3R C;  5CZX A;  3ETC A;  1KKG A;  4RM3 A;  4LF5 C;  1HR0 C;  4BBY A;  4DR1 C;  4YY3 C;  1P4E C;  4DV2 C;  4OX9 C;  4DR7 C;  4XX2 A;  2HHH C;  4LFA C;  4LFB C;  1XRB A;  2MM9 A;  4X62 C;  2XR1 A;  4PZP A;  5IT9 D;  3CJE A;  1HNW C;  1QWI A;  1TH5 A;  3S82 A;  4DCU A;  3FCE A;  2MCQ A;  1RG9 A;  5AE1 A;  3TDE A;  4LF6 C;  3IEV A;  3O2E A;  2CXC A;  3PES A;  2CU6 A;  3LUS A;  5DV9 A;  4KTV A;  2UUC C;  4ZLP A;  4ZJZ A;  4DCS A;  5LCI A;  5BSM A;  2D1Q A;  1XMQ C;  3DAY A;  2AYA A;  4DV7 C;  4TPS B;  1WCJ A;  4OXI A;  4NXM C;  3CW9 A;  2OBV A;  5GTD A;  5T8T A;  1XRC A;  5AE2 A;  2P2Q A;  2KZ0 A;  3K6R A;  5LMU C;  4LF9 C;  3EQ6 A;  4MTN A;  1XNQ C;  1NYE A;  4IZ6 A;  4DUZ C;  2UXB C;  1M6X C;  4DCV A;  4DG9 A;  2BJO A;  3DHV A;  2YWC A;  4LFC C;  2UUB C;  3UEB A;  5ADZ A;  2V7B A;  1T5H X;  1IB8 A;  4PUH A;  3R44 A;  1AMU A;  1N34 C;  4I9G A;  3VNS A;  1VEH A;  5A2Q D;  5BSV A;  1BA3 A;  1FJG C;  3G7S A;  3NYQ A;  3RV2 A;  4NOZ A;  4R1M A;  2KDN A;  1XMO C;  4BC9 A;  4L2Z A;  4PRO C;  4GXR A;  4IR7 A;  4B3T C;  4FTF A;  5BST A;  1O93 A;  5E7Q A;  3JAM D;  5A1G A;  3IML A;  4YHH C;  1IBL C;  2Z51 A;  2ZZN A;  1O92 A;  5KEI A;  1QM4 A;  2P2M A;  1YGT A;  2VQE C;  2QVX X;  3VNQ A;  1NY8 A;  1MDB A;  3A4I A;  1V60 A;  4DG8 A;  4LF8 C;  3FM7 A;  3KXW A;  1IBK C;  5KYT A;  2UU9 C;  3DLP X;  3A25 A;  5A1I A;  4EAT A;  1PU1 A;  5IWA C;  1RY2 A;  3PRO C;  4DV5 C;  4R1L A;  3UZ0 A;  3NI2 A;  1O90 A;  4DR5 C;  2E7G A;  4G36 A;  4AQY C;  2ZM6 C;  4LE5 A;  3LNV A;  4DV0 C;  4L4Q A;  1MD9 A;  4DR4 C;  2JMP A;  2M5H A;  1USP B;  4KHP C;  4D56 A;  3L8C A;  2WD9 A;  1YJ7 A;  4B3S C;  2UXC C;  4K0K C;  3L95 X;  4D4G A;  1MXC A;  2D1R A;  1N2F A;  2UXD C;  4DUY C;  5KYV A;  1I94 C;  5CZV A;  3EER A;  2VQF C;  1PG4 A;  1PG3 A;  1LQL A;  2E0G A;  1WH9 A;  3LAX A;  1WF3 A;  2F4V C;  1IBM C;  1VLA A;  3E7X A;  4JI7 C;  4ISB A;  3J80 D;  3TQI A;  4FUQ A;  4JI2 C;  4WS9 A;  1P4E A;  2WP0 C;  2OO4 A;  4G37 A;  3AF5 A;  1HH2 P;  2QL8 A;  4JI4 C;  2ZZM A;  3N54 B;  4DCT A;  4JYA C;  2Y27 A;  2ATW A;  2P20 A;  1ZB9 A;  1LCI A;  4JI5 C;  3CQ2 A;  4U5Y D;  2UUA C;  1MXB A;  4MH4 A;  3NPD A;  4KTT A;  2D1S A;  1N32 C;  5A19 A;  4LF7 C;  4DR2 C;  2E8E A;  4X66 C; 
#chains in the Genus database with same CATH homology
 2E5L C;  4JI6 C;  3ETO A;  5BSR A;  2DYJ A;  5BSU A;  3RG2 A;  3C5E A;  4B3M C;  4JM1 A;  1ULT A;  3LGX A;  2YCB A;  1UKK A;  5BR8 C;  3B7W A;  4NDN A;  2D28 C;  1N33 C;  3T1Y C;  4WV3 A;  3AF6 A;  4RMN A;  2CY1 A;  4DR6 C;  1L2F A;  1O9T A;  3J7A D;  1PA4 A;  4DV6 C;  4RVN A;  2QVY X;  3T1H C;  2P2F A;  5LMN C;  3SO4 A;  4RLQ A;  1N36 C;  2BH1 X;  4GXQ A;  5T8S A;  1JOS A;  5JRH A;  1ZB8 A;  3VNR A;  4FUT A;  3IPL A;  4LF4 C;  2QVZ X;  1GPM A;  3E7W A;  2HJG A;  3CW8 X;  5BUQ A;  2P02 A;  2P2J A;  3N2Q A;  5K8F A;  5K85 A;  2EGT A;  3NYR A;  4RVO A;  2D27 A;  1FUG A;  4GKJ C;  2E8F A;  4DV4 C;  1XNR C;  3GR1 A;  4RM2 A;  4I9F A;  3I08 A;  1P7L A;  5H9U A;  2VZE A;  3TUF A;  4G1I A;  4BSZ A;  4NXN C;  1USP A;  1MKY A;  5FLX D;  4D4I A;  5AE3 A;  1MDF A;  3GR0 A;  4JI3 C;  2Y4N A;  5BUS A;  1ML8 A;  3OTO C;  2PRO A;  2OPL B;  2DPL A;  2VSQ A;  4OYC A;  3R9X A;  1HNZ C;  3A9U A;  4HPV A;  4DV3 C;  2PN2 A;  1V26 A;  4R0M A;  1XRA A;  4DV1 C;  2ASB A;  3I07 A;  2YWB A;  1MXA A;  4DR3 C;  4JI8 C;  4RLF A;  2Y4O A;  3UOW A;  2ONF A;  5BUR A;  4BCA A;  4K0B A;  4GS5 A;  4JI0 C;  2E8C A;  4X65 C;  2OPL A;  3J81 D;  1J5E C;  1T5D X;  4BC7 A;  1K0R A;  3FCC A;  3PBK A;  1EGA A;  3H2T A;  4PHT A;  4JI1 C;  5BSW A;  2PT7 G;  5IFI A;  4ODJ A;  4JV5 C;  4GKK C;  3GPC A;  2KZF A;  4D57 A;  2P2B A;  1HNX C;  3GKU A;  2D7V A;  4X64 C;  3A9V A;  2QW0 X;  4L7I A;  1V25 A;  3IEU A;  3R9W A;  2D1T A;  4B3R C;  5CZX A;  3ETC A;  1KKG A;  4RM3 A;  4LF5 C;  1HR0 C;  4BBY A;  4DR1 C;  4YY3 C;  4OX9 C;  4DV2 C;  4DR7 C;  4XX2 A;  2HHH C;  4LFA C;  4LFB C;  1XRB A;  4X62 C;  2XR1 A;  4PZP A;  5IT9 D;  3CJE A;  1HNW C;  1QWI A;  3S82 A;  4DCU A;  3FCE A;  1RG9 A;  5AE1 A;  3TDE A;  4LF6 C;  3IEV A;  2CXC A;  3PES A;  3LUS A;  5DV9 A;  4KTV A;  2UUC C;  4ZLP A;  4ZJZ A;  4DCS A;  5BSM A;  2D1Q A;  1XMQ C;  3DAY A;  2AYA A;  4DV7 C;  4TPS B;  4OXI A;  4NXM C;  3CW9 A;  2OBV A;  5GTD A;  5T8T A;  1XRC A;  5AE2 A;  2P2Q A;  5LMU C;  4LF9 C;  3EQ6 A;  4MTN A;  1XNQ C;  1NYE A;  4IZ6 A;  4DUZ C;  2UXB C;  4DCV A;  4DG9 A;  2BJO A;  3DHV A;  2YWC A;  4LFC C;  2UUB C;  5ADZ A;  2V7B A;  1T5H X;  3R44 A;  1AMU A;  1N34 C;  4I9G A;  3VNS A;  5A2Q D;  5BSV A;  1BA3 A;  1FJG C;  3G7S A;  3NYQ A;  3RV2 A;  4NOZ A;  4R1M A;  1XMO C;  4BC9 A;  4L2Z A;  4PRO C;  4GXR A;  4IR7 A;  4B3T C;  4FTF A;  5BST A;  1O93 A;  5E7Q A;  3JAM D;  5A1G A;  3IML A;  4YHH C;  1IBL C;  1O92 A;  5KEI A;  1QM4 A;  2P2M A;  2VQE C;  2QVX X;  3VNQ A;  3A4I A;  1MDB A;  4DG8 A;  4LF8 C;  3KXW A;  1IBK C;  5KYT A;  2UU9 C;  3DLP X;  5A1I A;  4EAT A;  5IWA C;  1RY2 A;  3PRO C;  4DV5 C;  4R1L A;  3UZ0 A;  3NI2 A;  1O90 A;  4DR5 C;  2E7G A;  4G36 A;  4AQY C;  2ZM6 C;  4LE5 A;  3LNV A;  4DV0 C;  4L4Q A;  1MD9 A;  4DR4 C;  2JMP A;  1USP B;  4KHP C;  4D56 A;  3L8C A;  2WD9 A;  1YJ7 A;  4B3S C;  2UXC C;  4K0K C;  3L95 X;  4D4G A;  1MXC A;  2D1R A;  1N2F A;  2UXD C;  4DUY C;  5KYV A;  1I94 C;  5CZV A;  3EER A;  2VQF C;  1PG4 A;  1PG3 A;  1LQL A;  2E0G A;  1WH9 A;  3LAX A;  1WF3 A;  2F4V C;  1IBM C;  1VLA A;  3E7X A;  4JI7 C;  4ISB A;  3J80 D;  3TQI A;  4FUQ A;  4JI2 C;  4WS9 A;  2WP0 C;  2OO4 A;  4G37 A;  3AF5 A;  1HH2 P;  2QL8 A;  4JI4 C;  3N54 B;  4DCT A;  4JYA C;  2Y27 A;  2ATW A;  2P20 A;  1ZB9 A;  1LCI A;  4JI5 C;  4U5Y D;  2UUA C;  1MXB A;  4MH4 A;  3NPD A;  4KTT A;  2D1S A;  1N32 C;  5A19 A;  4LF7 C;  4DR2 C;  2E8E A;  4X66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...