4LF9C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf9C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf9C02
4LFCC 3JAMD 4KHPC 4DR5C 4DR2C 4B3TC 2CXCA 1WF3A 2E8CA 1ZB9A 1N32C 1HR0C 4DV2C 4DR4C 4DUYC 1XNQC 1FJGC 2VQEC 4DCTA 4JI6C 5LMNC 3IEVA 2ONFA 2OPLA 4OX9C 2E7GA 4BSZA 1IBLC 4DCSA 3J81D 1ML8A 2E8EA 3CJEA 2ATWA 3EERA 4DV0C 5IWAC 3J7AD 2UXBC 2DYJA 4JI4C 4NOZA 4B3RC 1L2FA 2PT7G 4B3MC 4DR3C 5IT9D 1XMQC 1I94C 4LF7C 4DR7C 2PN2A 3AF5A 3T1HC 1HNWC 1QWIA 1WH9A 2EGTA 1LQLA 4LFAC 4NXMC 1K0RA 2CY1A 4DUZC 1UKKA 1J5EC 4LF9C 1HH2P 4X62C 2UXDC 4DV3C 2F4VC 2OPLB 3R9XA 4X64C 1XNRC 4GKJC 4DV6C 4B3SC 4DV5C 1MKYA 2E5LC 4LF6C 1N33C 2HHHC 4JV5C 1HNZC 3LUSA 2BJOA 1N36C 2UUAC 2HJGA 4DCVA 3IEUA 2JMPA 4NXNC 1ZB8A 2UUCC 4K0KC 1XMOC 3I07A 4JI7C 3AF6A 1N34C 2ZM6C 3T1YC 2UXCC 2ASBA 2D7VA 4YHHC 4DR1C 4GKKC 3R9WA 4DV4C 5BR8C 2E8FA 3OTOC 1USPB 5LMUC 2YCBA 4LF8C 1EGAA 5FLXD 4DR6C 4X65C 4LF4C 1JOSA 2KZFA 1KKGA 4MH4A 4YY3C 4X66C 1VLAA 1PA4A 4DV7C 3GKUA 1N2FA 4DV1C 4JI2C 4XX2A 4JI5C 5A2QD 2UU9C 4LF5C 3J80D 4JI8C 2QL8A 1HNXC 2UUBC 2VQFC 4JI0C 1NYEA 4JI3C 4DCUA 4MTNA 1USPA 1IBMC 1IBKC 4LFBC 4AQYC 4JYAC 2XR1A 4JI1C
chains in the Genus database with same CATH superfamily
1FLOA 4LFCC 1V60A 2Y4NA 3A9UA 2KZ0A 3UEBA 4RVOA 1HR0C 4DV2C 5DV9A 5T8SA 2VQEC 2QVYX 4D57A 5LMNC 3CQ3A 1IB8A 4NDNA 2ZTBA 4ODJA 1IBLC 2D1RA 2P2QA 1ML8A 3CJEA 1FUGA 1XRBA 3EERA 4KTVA 4DV0C 5KYVA 5LCIA 3DAYA 2P20A 3AY0A 4B3MC 1XMQC 4DR7C 1HNWC 3AF5A 1WH9A 3RG2A 1T5DX 4EATA 1J5EC 4HPVA 3L95X 2MMAB 1AMUA 4L4QA 1XNRC 2KDNA 4DV6C 3UZ0A 3GR1A 4PHTA 5A1GA 3TDEA 5JRHA 2HHHC 1NY8A 1XRAA 4RMNA 2D1SA 2BH1X 3PBKA 2UUCC 3I07A 4JI7C 4G36A 4JM1A 3LAXA 4YHHC 4RVNA 4BC9A 5A1IA 4DG9A 3SO4A 4FUQA 1QM4A 4LF8C 4GXQA 4DR6C 1PG3A 4R1LA 1ULTA 1KKGA 3E7WA 4MH4A 4YY3C 4X66C 2E0GA 4JI2C 4DV1C 4BC7A 2PG1E 3NI2A 5GTDA 3GPCA 5A2QD 4JI5C 2PROA 2MCQA 1M6XC 1USPA 4U5YD 3C5EA 1V26A 5CZXA 4JI1C 1XHJA 3JAMD 4KHPC 3B7WA 3G7SA 4PZPA 1YJ7A 2E8CA 5AE1A 3L8CA 5H9UA 3RV2A 1XNQC 2OO4A 4JI6C 2Y4OA 4OX9C 3J81D 1P4EC 2ATWA 3EQ6A 3N2QA 3VNSA 4D4GA 1I94C 3S82A 4LF7C 2EGTA 4WV3A 4OYCA 5BUSA 5BSUA 4DUZC 1HH2P 4DV3C 2D28C 1MXCA 2OPLB 5AE2A 3H2TA 3LGXA 3NYQA 4G1IA 2E5LC 4LF6C 4JV5C 3LUSA 2OBVA 2VZEA 4I9GA 1N36C 1WCJA 5BSWA 5K8FA 3NYRA 5A19A 4K0KC 2CU6A 3AF6A 3VNRA 3IMLA 1N34C 4PUIA 5BSTA 3T1YC 5T8TA 2D7VA 4LE5A 4DR1C 4GKKC 4DV4C 2P2BA 2E8FA 3CQ1A 1M6XA 3O2EA 3OTOC 3A26A 1EGAA 4X65C 5IFIA 1T5HX 3R44A 2KZFA 2QW0X 2Y27A 2P2MA 1PG4A 4KTTA 1PA4A 4RLFA 3FCEA 2D27A 4XX2A 4L7IA 2WD9A 2VQFC 4GS5A 4R0MA 2V7BA 4MTNA 5BSRA 4LFBC 2P2FA 4AQYC 2D1TA 4ZLPA 1XDXA 4B3TC 2CXCA 1N32C 3PESA 4DUYC 3UX2A 4DCTA 3IEVA 2ONFA 4PROC 1O9TA 2QVZX 2E7GA 4DCSA 3J7AD 5IWAC 1UWDA 1L2FA 4K0BA 3TR3A 2P2JA 4DR3C 4I9FA 5IT9D 3CQ2A 3T1HC 1QWIA 4LFAC 1LQLA 4NXMC 3GR0A 2AYAA 3NPDA 4WS9A 1UKKA 4X62C 3R9XA 5BSMA 4D4IA 4DV5C 1MKYA 4PUGA 4RM3A 4PUHA 5ADZA 1RG9A 2WP0C 1LCIA 2M5OA 4DCVA 3IEUA 2MM9A 4L2ZA 4NXNC 1XMOC 1XRCA 2ZM6C 2Z51A 1O93A 3R9WA 3TQIA 2JNVA 1GPMA 4GXRA 4G37A 1USPB 5LMUC 5FLXD 5AE3A 2DPLA 4RLQA 4TPSB 3DHVA 1VLAA 3DLPX 1N2FA 3UOWA 3J80D 4JI8C 1HNXC 4JI0C 1NYEA 1VEHA 4JI3C 4R1MA 4DCUA 3PROC 4D56A 3KXWA 1IBMC 4DR5C 4DR2C 4FUTA 1WF3A 1ZB9A 3A9VA 2ZZMA 1BA3A 5KYTA 4DR4C 3LNVA 4OXIA 1FJGC 2OPLA 5BUQA 5K85A 4BSZA 4DG8A 3K6RA 2E8EA 1MDBA 2UXBC 2DYJA 4JI4C 3LNOA 4NOZA 4B3RC 1YGTA 2PT7G 1O90A 3E7XA 2YX1A 2PN2A 3ETCA 5BURA 3ETOA 4BCAA 1K0RA 2CY1A 2ZZNA 1V25A 4LF9C 2UXDC 2D1QA 2F4VC 4X64C 3TUFA 4GKJC 3CW9A 4B3SC 1N33C 1XS3A 3VNQA 4ZJZA 1HNZC 2BJOA 3CW8X 2UUAC 2HJGA 2QVXX 2JMPA 1ZB8A 4FTFA 1TH5A 1P7LA 1P4EA 2VSQA 1MDFA 2UXCC 2ASBA 5E7QA 4RM2A 3FCCA 5BR8C 2YCBA 1MXBA 4LF4C 5BSVA 1PU1A 1JOSA 3A4IA 1O92A 2NCLA 3FM7A 5KEIA 1RY2A 3UX3A 4DV7C 4BBYA 3GKUA 2P02A 2YWCA 3I08A 2UU9C 4LF5C 2QL8A 4ISBA 2UUBC 4IR7A 3IPLA 3N54B 2YWBA 1MXAA 1MD9A 2M5HA 1IBKC 5CZVA 4IZ6A 4JYAC 3A25A 2XR1A 2DHMA
chains in the Genus database with same CATH topology
4LFCC 2Y4NA 3A9UA 4RVOA 1HR0C 4DV2C 5DV9A 5T8SA 2VQEC 2QVYX 4D57A 5LMNC 4NDNA 4ODJA 1IBLC 2D1RA 2P2QA 1ML8A 3CJEA 1FUGA 1XRBA 3EERA 4KTVA 4DV0C 5KYVA 3DAYA 2P20A 4B3MC 1XMQC 4DR7C 1HNWC 3AF5A 1WH9A 3RG2A 1T5DX 4EATA 1J5EC 4HPVA 3L95X 1AMUA 4L4QA 1XNRC 4DV6C 3UZ0A 3GR1A 4PHTA 5A1GA 3TDEA 5JRHA 2HHHC 1XRAA 4RMNA 2D1SA 2BH1X 3PBKA 2UUCC 3I07A 4JI7C 4G36A 4JM1A 3LAXA 4YHHC 4RVNA 4BC9A 5A1IA 4DG9A 3SO4A 4FUQA 1QM4A 4LF8C 4GXQA 4DR6C 1PG3A 4R1LA 1ULTA 1KKGA 3E7WA 4MH4A 4YY3C 4X66C 2E0GA 4JI2C 4DV1C 4BC7A 3NI2A 5GTDA 3GPCA 5A2QD 4JI5C 2PROA 1USPA 4U5YD 3C5EA 1V26A 5CZXA 4JI1C 3JAMD 4KHPC 3B7WA 3G7SA 4PZPA 1YJ7A 2E8CA 5AE1A 3L8CA 5H9UA 3RV2A 1XNQC 2OO4A 4JI6C 2Y4OA 4OX9C 3J81D 2ATWA 3EQ6A 3N2QA 3VNSA 4D4GA 1I94C 3S82A 4LF7C 2EGTA 4WV3A 4OYCA 5BUSA 5BSUA 4DUZC 1HH2P 4DV3C 2D28C 1MXCA 2OPLB 5AE2A 3H2TA 3LGXA 3NYQA 4G1IA 2E5LC 4LF6C 4JV5C 3LUSA 2OBVA 2VZEA 4I9GA 1N36C 5BSWA 5K8FA 3NYRA 5A19A 4K0KC 3AF6A 3VNRA 3IMLA 1N34C 3T1YC 5BSTA 5T8TA 2D7VA 4LE5A 4DR1C 4GKKC 4DV4C 2P2BA 2E8FA 3OTOC 1EGAA 4X65C 5IFIA 1T5HX 3R44A 2KZFA 2QW0X 2Y27A 2P2MA 1PG4A 4KTTA 1PA4A 4RLFA 3FCEA 2D27A 4XX2A 4L7IA 2WD9A 2VQFC 4GS5A 4R0MA 2V7BA 4MTNA 5BSRA 4LFBC 2P2FA 4AQYC 2D1TA 4ZLPA 4B3TC 2CXCA 1N32C 3PESA 4DUYC 4DCTA 3IEVA 2ONFA 4PROC 1O9TA 2QVZX 2E7GA 4DCSA 3J7AD 5IWAC 1L2FA 4K0BA 4DR3C 2P2JA 5IT9D 4I9FA 3T1HC 1QWIA 4LFAC 1LQLA 4NXMC 3GR0A 2AYAA 3NPDA 4WS9A 1UKKA 4X62C 3R9XA 5BSMA 4D4IA 4DV5C 1MKYA 4RM3A 5ADZA 1RG9A 2WP0C 1LCIA 4DCVA 3IEUA 4L2ZA 4NXNC 1XMOC 1XRCA 2ZM6C 1O93A 3R9WA 3TQIA 1GPMA 4GXRA 4G37A 1USPB 5LMUC 5FLXD 5AE3A 2DPLA 4RLQA 4TPSB 3DHVA 1VLAA 3DLPX 1N2FA 3UOWA 3J80D 4JI8C 1HNXC 4JI0C 1NYEA 4JI3C 4R1MA 4DCUA 3PROC 4D56A 3KXWA 1IBMC 4DR5C 4DR2C 4FUTA 1WF3A 1ZB9A 3A9VA 1BA3A 5KYTA 4DR4C 3LNVA 4OXIA 1FJGC 2OPLA 5BUQA 5K85A 4BSZA 4DG8A 2E8EA 1MDBA 2UXBC 2DYJA 4JI4C 4NOZA 4B3RC 2PT7G 1O90A 3E7XA 2PN2A 3ETCA 5BURA 3ETOA 4BCAA 1K0RA 2CY1A 1V25A 4LF9C 2UXDC 2D1QA 2F4VC 4X64C 3TUFA 4GKJC 3CW9A 4B3SC 1N33C 3VNQA 4ZJZA 1HNZC 2BJOA 3CW8X 2UUAC 2HJGA 2QVXX 2JMPA 1ZB8A 4FTFA 1P7LA 2VSQA 1MDFA 2UXCC 2ASBA 5E7QA 4RM2A 3FCCA 5BR8C 2YCBA 1MXBA 4LF4C 5BSVA 1JOSA 3A4IA 1O92A 5KEIA 1RY2A 4DV7C 4BBYA 3GKUA 2P02A 2YWCA 2UU9C 4LF5C 3I08A 2QL8A 4ISBA 2UUBC 4IR7A 3IPLA 3N54B 2YWBA 1MXAA 1MD9A 1IBKC 5CZVA 4IZ6A 4JYAC 2XR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC C;  3JAM D;  4KHP C;  4DR5 C;  4DR2 C;  4B3T C;  2CXC A;  1WF3 A;  2E8C A;  1ZB9 A;  1N32 C;  1HR0 C;  4DV2 C;  4DR4 C;  4DUY C;  1XNQ C;  1FJG C;  2VQE C;  4DCT A;  4JI6 C;  5LMN C;  3IEV A;  2ONF A;  2OPL A;  4OX9 C;  2E7G A;  4BSZ A;  1IBL C;  4DCS A;  3J81 D;  1ML8 A;  2E8E A;  3CJE A;  2ATW A;  3EER A;  4DV0 C;  5IWA C;  3J7A D;  2UXB C;  2DYJ A;  4JI4 C;  4NOZ A;  4B3R C;  1L2F A;  2PT7 G;  4B3M C;  4DR3 C;  5IT9 D;  1XMQ C;  1I94 C;  4LF7 C;  4DR7 C;  2PN2 A;  3AF5 A;  3T1H C;  1HNW C;  1QWI A;  1WH9 A;  2EGT A;  1LQL A;  4LFA C;  4NXM C;  1K0R A;  2CY1 A;  4DUZ C;  1UKK A;  1J5E C;  4LF9 C;  1HH2 P;  4X62 C;  2UXD C;  4DV3 C;  2F4V C;  2OPL B;  3R9X A;  4X64 C;  1XNR C;  4GKJ C;  4DV6 C;  4B3S C;  4DV5 C;  1MKY A;  2E5L C;  4LF6 C;  1N33 C;  2HHH C;  4JV5 C;  1HNZ C;  3LUS A;  2BJO A;  1N36 C;  2UUA C;  2HJG A;  4DCV A;  3IEU A;  2JMP A;  4NXN C;  1ZB8 A;  2UUC C;  4K0K C;  1XMO C;  3I07 A;  4JI7 C;  3AF6 A;  1N34 C;  2ZM6 C;  3T1Y C;  2UXC C;  2ASB A;  2D7V A;  4YHH C;  4DR1 C;  4GKK C;  3R9W A;  4DV4 C;  5BR8 C;  2E8F A;  3OTO C;  1USP B;  5LMU C;  2YCB A;  4LF8 C;  1EGA A;  5FLX D;  4DR6 C;  4X65 C;  4LF4 C;  1JOS A;  2KZF A;  1KKG A;  4MH4 A;  4YY3 C;  4X66 C;  1VLA A;  1PA4 A;  4DV7 C;  3GKU A;  1N2F A;  4DV1 C;  4JI2 C;  4XX2 A;  4JI5 C;  5A2Q D;  2UU9 C;  4LF5 C;  3J80 D;  4JI8 C;  2QL8 A;  1HNX C;  2UUB C;  2VQF C;  4JI0 C;  1NYE A;  4JI3 C;  4DCU A;  4MTN A;  1USP A;  1IBM C;  1IBK C;  4LFB C;  4AQY C;  4JYA C;  2XR1 A;  4JI1 C; 
#chains in the Genus database with same CATH topology
 1FLO A;  4LFC C;  1V60 A;  2Y4N A;  3A9U A;  2KZ0 A;  3UEB A;  4RVO A;  1HR0 C;  4DV2 C;  5DV9 A;  5T8S A;  2VQE C;  2QVY X;  4D57 A;  5LMN C;  3CQ3 A;  1IB8 A;  4NDN A;  2ZTB A;  4ODJ A;  1IBL C;  2D1R A;  2P2Q A;  1ML8 A;  3CJE A;  1FUG A;  1XRB A;  3EER A;  4KTV A;  4DV0 C;  5KYV A;  5LCI A;  3DAY A;  2P20 A;  3AY0 A;  4B3M C;  1XMQ C;  4DR7 C;  1HNW C;  3AF5 A;  1WH9 A;  3RG2 A;  1T5D X;  4EAT A;  1J5E C;  4HPV A;  3L95 X;  2MMA B;  1AMU A;  4L4Q A;  1XNR C;  2KDN A;  4DV6 C;  3UZ0 A;  3GR1 A;  4PHT A;  5A1G A;  3TDE A;  5JRH A;  2HHH C;  1NY8 A;  1XRA A;  4RMN A;  2D1S A;  2BH1 X;  3PBK A;  2UUC C;  3I07 A;  4JI7 C;  4G36 A;  4JM1 A;  3LAX A;  4YHH C;  4RVN A;  4BC9 A;  5A1I A;  4DG9 A;  3SO4 A;  4FUQ A;  1QM4 A;  4LF8 C;  4GXQ A;  4DR6 C;  1PG3 A;  4R1L A;  1ULT A;  1KKG A;  3E7W A;  4MH4 A;  4YY3 C;  4X66 C;  2E0G A;  4JI2 C;  4DV1 C;  4BC7 A;  2PG1 E;  3NI2 A;  5GTD A;  3GPC A;  5A2Q D;  4JI5 C;  2PRO A;  2MCQ A;  1M6X C;  1USP A;  4U5Y D;  3C5E A;  1V26 A;  5CZX A;  4JI1 C;  1XHJ A;  3JAM D;  4KHP C;  3B7W A;  3G7S A;  4PZP A;  1YJ7 A;  2E8C A;  5AE1 A;  3L8C A;  5H9U A;  3RV2 A;  1XNQ C;  2OO4 A;  4JI6 C;  2Y4O A;  4OX9 C;  3J81 D;  1P4E C;  2ATW A;  3EQ6 A;  3N2Q A;  3VNS A;  4D4G A;  1I94 C;  3S82 A;  4LF7 C;  2EGT A;  4WV3 A;  4OYC A;  5BUS A;  5BSU A;  4DUZ C;  1HH2 P;  4DV3 C;  2D28 C;  1MXC A;  2OPL B;  5AE2 A;  3H2T A;  3LGX A;  3NYQ A;  4G1I A;  2E5L C;  4LF6 C;  4JV5 C;  3LUS A;  2OBV A;  2VZE A;  4I9G A;  1N36 C;  1WCJ A;  5BSW A;  5K8F A;  3NYR A;  5A19 A;  4K0K C;  2CU6 A;  3AF6 A;  3VNR A;  3IML A;  1N34 C;  4PUI A;  5BST A;  3T1Y C;  5T8T A;  2D7V A;  4LE5 A;  4DR1 C;  4GKK C;  4DV4 C;  2P2B A;  2E8F A;  3CQ1 A;  1M6X A;  3O2E A;  3OTO C;  3A26 A;  1EGA A;  4X65 C;  5IFI A;  1T5H X;  3R44 A;  2KZF A;  2QW0 X;  2Y27 A;  2P2M A;  1PG4 A;  4KTT A;  1PA4 A;  4RLF A;  3FCE A;  2D27 A;  4XX2 A;  4L7I A;  2WD9 A;  2VQF C;  4GS5 A;  4R0M A;  2V7B A;  4MTN A;  5BSR A;  4LFB C;  2P2F A;  4AQY C;  2D1T A;  4ZLP A;  1XDX A;  4B3T C;  2CXC A;  1N32 C;  3PES A;  4DUY C;  3UX2 A;  4DCT A;  3IEV A;  2ONF A;  4PRO C;  1O9T A;  2QVZ X;  2E7G A;  4DCS A;  3J7A D;  5IWA C;  1UWD A;  1L2F A;  4K0B A;  3TR3 A;  2P2J A;  4DR3 C;  4I9F A;  5IT9 D;  3CQ2 A;  3T1H C;  1QWI A;  4LFA C;  1LQL A;  4NXM C;  3GR0 A;  2AYA A;  3NPD A;  4WS9 A;  1UKK A;  4X62 C;  3R9X A;  5BSM A;  4D4I A;  4DV5 C;  1MKY A;  4PUG A;  4RM3 A;  4PUH A;  5ADZ A;  1RG9 A;  2WP0 C;  1LCI A;  2M5O A;  4DCV A;  3IEU A;  2MM9 A;  4L2Z A;  4NXN C;  1XMO C;  1XRC A;  2ZM6 C;  2Z51 A;  1O93 A;  3R9W A;  3TQI A;  2JNV A;  1GPM A;  4GXR A;  4G37 A;  1USP B;  5LMU C;  5FLX D;  5AE3 A;  2DPL A;  4RLQ A;  4TPS B;  3DHV A;  1VLA A;  3DLP X;  1N2F A;  3UOW A;  3J80 D;  4JI8 C;  1HNX C;  4JI0 C;  1NYE A;  1VEH A;  4JI3 C;  4R1M A;  4DCU A;  3PRO C;  4D56 A;  3KXW A;  1IBM C;  4DR5 C;  4DR2 C;  4FUT A;  1WF3 A;  1ZB9 A;  3A9V A;  2ZZM A;  1BA3 A;  5KYT A;  4DR4 C;  3LNV A;  4OXI A;  1FJG C;  2OPL A;  5BUQ A;  5K85 A;  4BSZ A;  4DG8 A;  3K6R A;  2E8E A;  1MDB A;  2UXB C;  2DYJ A;  4JI4 C;  3LNO A;  4NOZ A;  4B3R C;  1YGT A;  2PT7 G;  1O90 A;  3E7X A;  2YX1 A;  2PN2 A;  3ETC A;  5BUR A;  3ETO A;  4BCA A;  1K0R A;  2CY1 A;  2ZZN A;  1V25 A;  4LF9 C;  2UXD C;  2D1Q A;  2F4V C;  4X64 C;  3TUF A;  4GKJ C;  3CW9 A;  4B3S C;  1N33 C;  1XS3 A;  3VNQ A;  4ZJZ A;  1HNZ C;  2BJO A;  3CW8 X;  2UUA C;  2HJG A;  2QVX X;  2JMP A;  1ZB8 A;  4FTF A;  1TH5 A;  1P7L A;  1P4E A;  2VSQ A;  1MDF A;  2UXC C;  2ASB A;  5E7Q A;  4RM2 A;  3FCC A;  5BR8 C;  2YCB A;  1MXB A;  4LF4 C;  5BSV A;  1PU1 A;  1JOS A;  3A4I A;  1O92 A;  2NCL A;  3FM7 A;  5KEI A;  1RY2 A;  3UX3 A;  4DV7 C;  4BBY A;  3GKU A;  2P02 A;  2YWC A;  3I08 A;  2UU9 C;  4LF5 C;  2QL8 A;  4ISB A;  2UUB C;  4IR7 A;  3IPL A;  3N54 B;  2YWB A;  1MXA A;  1MD9 A;  2M5H A;  1IBK C;  5CZV A;  4IZ6 A;  4JYA C;  3A25 A;  2XR1 A;  2DHM A; 
#chains in the Genus database with same CATH homology
 4LFC C;  2Y4N A;  3A9U A;  4RVO A;  1HR0 C;  4DV2 C;  5DV9 A;  5T8S A;  2VQE C;  2QVY X;  4D57 A;  5LMN C;  4NDN A;  4ODJ A;  1IBL C;  2D1R A;  2P2Q A;  1ML8 A;  3CJE A;  1FUG A;  1XRB A;  3EER A;  4KTV A;  4DV0 C;  5KYV A;  3DAY A;  2P20 A;  4B3M C;  1XMQ C;  4DR7 C;  1HNW C;  3AF5 A;  1WH9 A;  3RG2 A;  1T5D X;  4EAT A;  1J5E C;  4HPV A;  3L95 X;  1AMU A;  4L4Q A;  1XNR C;  4DV6 C;  3UZ0 A;  3GR1 A;  4PHT A;  5A1G A;  3TDE A;  5JRH A;  2HHH C;  1XRA A;  4RMN A;  2D1S A;  2BH1 X;  3PBK A;  2UUC C;  3I07 A;  4JI7 C;  4G36 A;  4JM1 A;  3LAX A;  4YHH C;  4RVN A;  4BC9 A;  5A1I A;  4DG9 A;  3SO4 A;  4FUQ A;  1QM4 A;  4LF8 C;  4GXQ A;  4DR6 C;  1PG3 A;  4R1L A;  1ULT A;  1KKG A;  3E7W A;  4MH4 A;  4YY3 C;  4X66 C;  2E0G A;  4JI2 C;  4DV1 C;  4BC7 A;  3NI2 A;  5GTD A;  3GPC A;  5A2Q D;  4JI5 C;  2PRO A;  1USP A;  4U5Y D;  3C5E A;  1V26 A;  5CZX A;  4JI1 C;  3JAM D;  4KHP C;  3B7W A;  3G7S A;  4PZP A;  1YJ7 A;  2E8C A;  5AE1 A;  3L8C A;  5H9U A;  3RV2 A;  1XNQ C;  2OO4 A;  4JI6 C;  2Y4O A;  4OX9 C;  3J81 D;  2ATW A;  3EQ6 A;  3N2Q A;  3VNS A;  4D4G A;  1I94 C;  3S82 A;  4LF7 C;  2EGT A;  4WV3 A;  4OYC A;  5BUS A;  5BSU A;  4DUZ C;  1HH2 P;  4DV3 C;  2D28 C;  1MXC A;  2OPL B;  5AE2 A;  3H2T A;  3LGX A;  3NYQ A;  4G1I A;  2E5L C;  4LF6 C;  4JV5 C;  3LUS A;  2OBV A;  2VZE A;  4I9G A;  1N36 C;  5BSW A;  5K8F A;  3NYR A;  5A19 A;  4K0K C;  3AF6 A;  3VNR A;  3IML A;  1N34 C;  3T1Y C;  5BST A;  5T8T A;  2D7V A;  4LE5 A;  4DR1 C;  4GKK C;  4DV4 C;  2P2B A;  2E8F A;  3OTO C;  1EGA A;  4X65 C;  5IFI A;  1T5H X;  3R44 A;  2KZF A;  2QW0 X;  2Y27 A;  2P2M A;  1PG4 A;  4KTT A;  1PA4 A;  4RLF A;  3FCE A;  2D27 A;  4XX2 A;  4L7I A;  2WD9 A;  2VQF C;  4GS5 A;  4R0M A;  2V7B A;  4MTN A;  5BSR A;  4LFB C;  2P2F A;  4AQY C;  2D1T A;  4ZLP A;  4B3T C;  2CXC A;  1N32 C;  3PES A;  4DUY C;  4DCT A;  3IEV A;  2ONF A;  4PRO C;  1O9T A;  2QVZ X;  2E7G A;  4DCS A;  3J7A D;  5IWA C;  1L2F A;  4K0B A;  4DR3 C;  2P2J A;  5IT9 D;  4I9F A;  3T1H C;  1QWI A;  4LFA C;  1LQL A;  4NXM C;  3GR0 A;  2AYA A;  3NPD A;  4WS9 A;  1UKK A;  4X62 C;  3R9X A;  5BSM A;  4D4I A;  4DV5 C;  1MKY A;  4RM3 A;  5ADZ A;  1RG9 A;  2WP0 C;  1LCI A;  4DCV A;  3IEU A;  4L2Z A;  4NXN C;  1XMO C;  1XRC A;  2ZM6 C;  1O93 A;  3R9W A;  3TQI A;  1GPM A;  4GXR A;  4G37 A;  1USP B;  5LMU C;  5FLX D;  5AE3 A;  2DPL A;  4RLQ A;  4TPS B;  3DHV A;  1VLA A;  3DLP X;  1N2F A;  3UOW A;  3J80 D;  4JI8 C;  1HNX C;  4JI0 C;  1NYE A;  4JI3 C;  4R1M A;  4DCU A;  3PRO C;  4D56 A;  3KXW A;  1IBM C;  4DR5 C;  4DR2 C;  4FUT A;  1WF3 A;  1ZB9 A;  3A9V A;  1BA3 A;  5KYT A;  4DR4 C;  3LNV A;  4OXI A;  1FJG C;  2OPL A;  5BUQ A;  5K85 A;  4BSZ A;  4DG8 A;  2E8E A;  1MDB A;  2UXB C;  2DYJ A;  4JI4 C;  4NOZ A;  4B3R C;  2PT7 G;  1O90 A;  3E7X A;  2PN2 A;  3ETC A;  5BUR A;  3ETO A;  4BCA A;  1K0R A;  2CY1 A;  1V25 A;  4LF9 C;  2UXD C;  2D1Q A;  2F4V C;  4X64 C;  3TUF A;  4GKJ C;  3CW9 A;  4B3S C;  1N33 C;  3VNQ A;  4ZJZ A;  1HNZ C;  2BJO A;  3CW8 X;  2UUA C;  2HJG A;  2QVX X;  2JMP A;  1ZB8 A;  4FTF A;  1P7L A;  2VSQ A;  1MDF A;  2UXC C;  2ASB A;  5E7Q A;  4RM2 A;  3FCC A;  5BR8 C;  2YCB A;  1MXB A;  4LF4 C;  5BSV A;  1JOS A;  3A4I A;  1O92 A;  5KEI A;  1RY2 A;  4DV7 C;  4BBY A;  3GKU A;  2P02 A;  2YWC A;  2UU9 C;  4LF5 C;  3I08 A;  2QL8 A;  4ISB A;  2UUB C;  4IR7 A;  3IPL A;  3N54 B;  2YWB A;  1MXA A;  1MD9 A;  1IBK C;  5CZV A;  4IZ6 A;  4JYA C;  2XR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...