2E5LC

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e5lC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2e5lC02
4NOZA 1WH9A 1N34C 4LFAC 2UXDC 2E5LC 2CXCA 1EGAA 1KKGA 4DUZC 4DR1C 3J80D 3T1HC 2XR1A 1N36C 4DR5C 5IT9D 1VLAA 2UXCC 4YHHC 4JI1C 1HNXC 2QL8A 2UXBC 3R9XA 4DR7C 2YCBA 1N33C 4LF7C 4B3TC 2F4VC 2E8FA 3J7AD 5IWAC 4MH4A 1IBKC 1HH2P 1IBLC 4DCVA 3J81D 2JMPA 2KZFA 4JI4C 1USPB 1USPA 2ZM6C 5LMUC 4B3RC 1ZB8A 1L2FA 1UKKA 2UUBC 4JI5C 3AF6A 4DR2C 4JI0C 4NXNC 4DUYC 3GKUA 2E8CA 1XNRC 1K0RA 1NYEA 2EGTA 1IBMC 4DR4C 3T1YC 4DV3C 1J5EC 4LF4C 2E8EA 3JAMD 4X64C 2DYJA 2PN2A 4X66C 4JI6C 1WF3A 4AQYC 4DCTA 3OTOC 1QWIA 4B3MC 1ML8A 1XMOC 4NXMC 4LF8C 4JI3C 3IEVA 2PT7G 2ONFA 1LQLA 2BJOA 4MTNA 4DV7C 4JV5C 1XMQC 4DV6C 4JYAC 2UUAC 2ATWA 4LFBC 1ZB9A 4DV2C 2E7GA 3LUSA 5FLXD 2UU9C 2HHHC 1HNZC 4JI8C 4DCSA 2VQFC 4LFCC 2D7VA 4LF9C 1XNQC 4GKJC 4X62C 2CY1A 2VQEC 1HNWC 1HR0C 4DV4C 3I07A 1JOSA 3CJEA 4KHPC 4DR3C 4JI2C 2ASBA 2UUCC 1N32C 5LMNC 2OPLB 2OPLA 3AF5A 4XX2A 1I94C 4BSZA 4JI7C 5BR8C 3EERA 4YY3C 4DV1C 4DCUA 2HJGA 1FJGC 3IEUA 5A2QD 4DV5C 1PA4A 4B3SC 1MKYA 4LF5C 4GKKC 4K0KC 4OX9C 4LF6C 1N2FA 3R9WA 4DR6C 4X65C 4DV0C
chains in the Genus database with same CATH superfamily
3E7WA 3IMLA 2MMAB 3B7WA 1N34C 4LFAC 2YWCA 2CU6A 1GPMA 1XRCA 2D27A 2OBVA 2P20A 3E7XA 3TDEA 3T1HC 2XR1A 4PHTA 1MXCA 2JNVA 5AE1A 3R9XA 4DR7C 4ISBA 4B3TC 2E8FA 4EATA 2V7BA 4G36A 3CQ3A 2QVYX 2KZFA 1PG3A 2ZTBA 2PROA 2ZM6C 3AY0A 1ZB8A 1UWDA 1FUGA 3GPCA 4JI0C 4DUYC 3PROC 1K0RA 1NYEA 1T5HX 1IBMC 5IFIA 1J5EC 4LF4C 4BCAA 4X64C 2PN2A 5AE2A 4K0BA 4BC7A 1QWIA 4B3MC 4NDNA 3IEVA 3CQ2A 4IZ6A 4D56A 5A1IA 3L95X 3KXWA 4JYAC 4LFBC 4DV2C 1HNZC 4PUHA 2CY1A 1HR0C 1JOSA 2AYAA 3VNRA 1N32C 2OPLA 4KTTA 4JI7C 5BR8C 4YY3C 1FJGC 4IR7A 4D4GA 3ETCA 5A2QD 1MDFA 5LCIA 4L4QA 3TR3A 3R9WA 4X65C 2D1QA 1V26A 4JM1A 2VZEA 2UXDC 2CXCA 5ADZA 5GTDA 3NPDA 3DAYA 1M6XA 4DR1C 4GS5A 3TQIA 1N36C 4RLFA 5IT9D 4YHHC 4JI1C 1HNXC 2QL8A 2YCBA 4LF7C 2F4VC 4RVOA 2QVXX 3J7AD 3VNSA 3RG2A 4DCVA 2JMPA 1PU1A 2P2FA 1XHJA 1USPB 1ULTA 1L2FA 1UKKA 4PUIA 2UUBC 4L7IA 4JI5C 4D4IA 4PZPA 4NXNC 3GKUA 2EGTA 4I9FA 1P7LA 1O93A 1XRAA 1TH5A 3JAMD 1BA3A 2QW0X 3CQ1A 3FCCA 4D57A 1V25A 4R1MA 1ML8A 4WV3A 4LF8C 2KDNA 4GXRA 2PT7G 4DV7C 2BJOA 4MTNA 2D28C 4JV5C 3LGXA 5A1GA 4RMNA 2ATWA 1ZB9A 2E7GA 3LUSA 2Y4OA 3LNOA 2VSQA 4LFCC 1XNQC 2D7VA 4X62C 2VQEC 3IPLA 5A19A 1O92A 4U5YD 4DV4C 3I07A 3CJEA 5BURA 4KHPC 3A9UA 4DR3C 2ASBA 3UOWA 1I94C 3EERA 2P2MA 5BSRA 2Y4NA 3IEUA 2P02A 4B3SC 4RM2A 4DG9A 4LF6C 4OX9C 4DV0C 2OO4A 4NOZA 1MDBA 5DV9A 1XDXA 2P2BA 4DUZC 1YJ7A 3RV2A 4OYCA 4LE5A 5JRHA 2P2QA 1VLAA 2UXBC 5KYTA 4HPVA 3UEBA 1IBKC 5K8FA 2Z51A 3TUFA 5T8SA 5LMUC 4L2ZA 4DR2C 4BBYA 1P4EC 2E8CA 1XS3A 3A9VA 4DR4C 2D1TA 2E8EA 3UX2A 3DLPX 4X66C 3K6RA 2ZZNA 3LNVA 3NI2A 4DCTA 1MXAA 5BSVA 4NXMC 4JI3C 3LAXA 5CZVA 1AMUA 2ZZMA 3UZ0A 1XMQC 4DV6C 1VEHA 2UUAC 4G1IA 3N54B 5BUSA 1PG4A 4WS9A 5FLXD 2DHMA 2UU9C 3S82A 1HNWC 4I9GA 2D1RA 4FUQA 4PROC 3PESA 4RVNA 5LMNC 2OPLB 4PUGA 2E0GA 3VNQA 4BSZA 5KEIA 4DV1C 2HJGA 4DG8A 3GR1A 5CZXA 4DV5C 1PA4A 4LF5C 3NYRA 4GKKC 3PBKA 4DR6C 4FUTA 3N2QA 2BH1X 5T8TA 1WH9A 3R44A 3A4IA 2E5LC 1EGAA 5BSTA 1KKGA 5BSUA 3J80D 4TPSB 1NY8A 3SO4A 2WP0C 4DR5C 2UXCC 2DPLA 2YX1A 1N33C 1YGTA 5IWAC 4MH4A 3G7SA 3EQ6A 1HH2P 1IBLC 3J81D 4GXQA 4JI4C 1USPA 4RM3A 3C5EA 3ETOA 4B3RC 3A25A 4BC9A 5H9UA 3AF6A 3L8CA 3CW8X 5E7QA 4KTVA 1XNRC 3DHVA 3I08A 3GR0A 2M5HA 2M5OA 1IB8A 4RLQA 4DV3C 4ODJA 3T1YC 1RG9A 2DYJA 3O2EA 1V60A 2KZ0A 3A26A 2D1SA 1P4EA 4JI6C 1WF3A 4AQYC 1T5DX 4R1LA 3OTOC 1O90A 3UX3A 2PG1E 1QM4A 2YWBA 4FTFA 4ZLPA 4OXIA 1XMOC 2Y27A 4R0MA 2WD9A 5K85A 2ONFA 5KYVA 3CW9A 1LQLA 1MXBA 1O9TA 1MD9A 1XRBA 4G37A 1LCIA 3NYQA 4JI8C 2NCLA 2HHHC 4DCSA 2VQFC 4GKJC 4LF9C 5BUQA 3FM7A 5BSWA 2MM9A 1WCJA 3FCEA 4JI2C 2UUCC 3AF5A 4XX2A 2P2JA 1FLOA 1RY2A 5BSMA 4DCUA 2MCQA 4ZJZA 3H2TA 1MKYA 2QVZX 4K0KC 1N2FA 1M6XC 5AE3A
chains in the Genus database with same CATH topology
3E7WA 3IMLA 3B7WA 1N34C 4LFAC 2YWCA 1GPMA 1XRCA 2D27A 2OBVA 2P20A 3E7XA 3TDEA 3T1HC 2XR1A 4PHTA 1MXCA 5AE1A 3R9XA 4DR7C 4ISBA 4B3TC 2E8FA 4EATA 2V7BA 4G36A 2QVYX 2KZFA 1PG3A 2PROA 2ZM6C 1ZB8A 1FUGA 3GPCA 4JI0C 4DUYC 3PROC 1K0RA 1NYEA 1T5HX 1IBMC 5IFIA 1J5EC 4LF4C 4BCAA 4X64C 2PN2A 5AE2A 4K0BA 4BC7A 1QWIA 4B3MC 4NDNA 3IEVA 4IZ6A 4D56A 5A1IA 3L95X 3KXWA 4JYAC 4LFBC 4DV2C 1HNZC 2CY1A 1HR0C 1JOSA 2AYAA 3VNRA 1N32C 2OPLA 4KTTA 4JI7C 5BR8C 4YY3C 1FJGC 4IR7A 4D4GA 3ETCA 5A2QD 1MDFA 4L4QA 3R9WA 4X65C 2D1QA 1V26A 4JM1A 2VZEA 2UXDC 2CXCA 5ADZA 5GTDA 3NPDA 3DAYA 4DR1C 4GS5A 3TQIA 1N36C 4RLFA 5IT9D 4YHHC 4JI1C 1HNXC 2QL8A 2YCBA 4LF7C 2F4VC 4RVOA 2QVXX 3J7AD 3VNSA 3RG2A 4DCVA 2JMPA 2P2FA 1USPB 1ULTA 1L2FA 1UKKA 2UUBC 4L7IA 4JI5C 4D4IA 4PZPA 4NXNC 3GKUA 2EGTA 4I9FA 1P7LA 1O93A 1XRAA 3JAMD 1BA3A 2QW0X 3FCCA 4D57A 1V25A 4R1MA 1ML8A 4WV3A 4LF8C 4GXRA 2PT7G 4DV7C 2BJOA 4MTNA 2D28C 4JV5C 3LGXA 5A1GA 4RMNA 2ATWA 1ZB9A 2E7GA 3LUSA 2Y4OA 2VSQA 4LFCC 1XNQC 2D7VA 4X62C 2VQEC 3IPLA 5A19A 1O92A 4U5YD 4DV4C 3I07A 3CJEA 5BURA 4KHPC 3A9UA 4DR3C 2ASBA 3UOWA 1I94C 3EERA 2P2MA 5BSRA 2Y4NA 3IEUA 2P02A 4B3SC 4RM2A 4DG9A 4LF6C 4OX9C 4DV0C 2OO4A 4NOZA 1MDBA 5DV9A 2P2BA 4DUZC 1YJ7A 3RV2A 4OYCA 4LE5A 5JRHA 2P2QA 1VLAA 2UXBC 5KYTA 4HPVA 1IBKC 5K8FA 3TUFA 5T8SA 5LMUC 4L2ZA 4DR2C 4BBYA 2E8CA 3A9VA 4DR4C 2D1TA 2E8EA 3DLPX 4X66C 3LNVA 3NI2A 4DCTA 1MXAA 5BSVA 4NXMC 4JI3C 3LAXA 5CZVA 1AMUA 3UZ0A 1XMQC 4DV6C 2UUAC 4G1IA 3N54B 5BUSA 1PG4A 4WS9A 5FLXD 2UU9C 3S82A 1HNWC 4I9GA 2D1RA 4FUQA 4PROC 3PESA 4RVNA 5LMNC 2OPLB 2E0GA 3VNQA 4BSZA 5KEIA 4DV1C 2HJGA 4DG8A 3GR1A 5CZXA 4DV5C 1PA4A 4LF5C 3NYRA 4GKKC 3PBKA 4DR6C 4FUTA 3N2QA 2BH1X 5T8TA 1WH9A 3R44A 3A4IA 2E5LC 1EGAA 5BSTA 1KKGA 5BSUA 3J80D 4TPSB 3SO4A 2WP0C 4DR5C 2UXCC 2DPLA 1N33C 5IWAC 4MH4A 3G7SA 3EQ6A 1HH2P 1IBLC 3J81D 4GXQA 4JI4C 1USPA 4RM3A 3C5EA 3ETOA 4B3RC 4BC9A 5H9UA 3AF6A 3L8CA 3CW8X 5E7QA 4KTVA 1XNRC 3DHVA 3I08A 3GR0A 4RLQA 4DV3C 4ODJA 3T1YC 1RG9A 2DYJA 2D1SA 4JI6C 1WF3A 4AQYC 1T5DX 4R1LA 3OTOC 1O90A 1QM4A 2YWBA 4FTFA 4ZLPA 4OXIA 1XMOC 2Y27A 4R0MA 2WD9A 5K85A 2ONFA 5KYVA 3CW9A 1LQLA 1MXBA 1O9TA 1MD9A 1XRBA 4G37A 1LCIA 3NYQA 4JI8C 2HHHC 4DCSA 2VQFC 4GKJC 4LF9C 5BUQA 5BSWA 3FCEA 4JI2C 2UUCC 3AF5A 4XX2A 2P2JA 1RY2A 5BSMA 4DCUA 4ZJZA 3H2TA 1MKYA 2QVZX 4K0KC 1N2FA 5AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  1WH9 A;  1N34 C;  4LFA C;  2UXD C;  2E5L C;  2CXC A;  1EGA A;  1KKG A;  4DUZ C;  4DR1 C;  3J80 D;  3T1H C;  2XR1 A;  1N36 C;  4DR5 C;  5IT9 D;  1VLA A;  2UXC C;  4YHH C;  4JI1 C;  1HNX C;  2QL8 A;  2UXB C;  3R9X A;  4DR7 C;  2YCB A;  1N33 C;  4LF7 C;  4B3T C;  2F4V C;  2E8F A;  3J7A D;  5IWA C;  4MH4 A;  1IBK C;  1HH2 P;  1IBL C;  4DCV A;  3J81 D;  2JMP A;  2KZF A;  4JI4 C;  1USP B;  1USP A;  2ZM6 C;  5LMU C;  4B3R C;  1ZB8 A;  1L2F A;  1UKK A;  2UUB C;  4JI5 C;  3AF6 A;  4DR2 C;  4JI0 C;  4NXN C;  4DUY C;  3GKU A;  2E8C A;  1XNR C;  1K0R A;  1NYE A;  2EGT A;  1IBM C;  4DR4 C;  3T1Y C;  4DV3 C;  1J5E C;  4LF4 C;  2E8E A;  3JAM D;  4X64 C;  2DYJ A;  2PN2 A;  4X66 C;  4JI6 C;  1WF3 A;  4AQY C;  4DCT A;  3OTO C;  1QWI A;  4B3M C;  1ML8 A;  1XMO C;  4NXM C;  4LF8 C;  4JI3 C;  3IEV A;  2PT7 G;  2ONF A;  1LQL A;  2BJO A;  4MTN A;  4DV7 C;  4JV5 C;  1XMQ C;  4DV6 C;  4JYA C;  2UUA C;  2ATW A;  4LFB C;  1ZB9 A;  4DV2 C;  2E7G A;  3LUS A;  5FLX D;  2UU9 C;  2HHH C;  1HNZ C;  4JI8 C;  4DCS A;  2VQF C;  4LFC C;  2D7V A;  4LF9 C;  1XNQ C;  4GKJ C;  4X62 C;  2CY1 A;  2VQE C;  1HNW C;  1HR0 C;  4DV4 C;  3I07 A;  1JOS A;  3CJE A;  4KHP C;  4DR3 C;  4JI2 C;  2ASB A;  2UUC C;  1N32 C;  5LMN C;  2OPL B;  2OPL A;  3AF5 A;  4XX2 A;  1I94 C;  4BSZ A;  4JI7 C;  5BR8 C;  3EER A;  4YY3 C;  4DV1 C;  4DCU A;  2HJG A;  1FJG C;  3IEU A;  5A2Q D;  4DV5 C;  1PA4 A;  4B3S C;  1MKY A;  4LF5 C;  4GKK C;  4K0K C;  4OX9 C;  4LF6 C;  1N2F A;  3R9W A;  4DR6 C;  4X65 C;  4DV0 C; 
#chains in the Genus database with same CATH topology
 3E7W A;  3IML A;  2MMA B;  3B7W A;  1N34 C;  4LFA C;  2YWC A;  2CU6 A;  1GPM A;  1XRC A;  2D27 A;  2OBV A;  2P20 A;  3E7X A;  3TDE A;  3T1H C;  2XR1 A;  4PHT A;  1MXC A;  2JNV A;  5AE1 A;  3R9X A;  4DR7 C;  4ISB A;  4B3T C;  2E8F A;  4EAT A;  2V7B A;  4G36 A;  3CQ3 A;  2QVY X;  2KZF A;  1PG3 A;  2ZTB A;  2PRO A;  2ZM6 C;  3AY0 A;  1ZB8 A;  1UWD A;  1FUG A;  3GPC A;  4JI0 C;  4DUY C;  3PRO C;  1K0R A;  1NYE A;  1T5H X;  1IBM C;  5IFI A;  1J5E C;  4LF4 C;  4BCA A;  4X64 C;  2PN2 A;  5AE2 A;  4K0B A;  4BC7 A;  1QWI A;  4B3M C;  4NDN A;  3IEV A;  3CQ2 A;  4IZ6 A;  4D56 A;  5A1I A;  3L95 X;  3KXW A;  4JYA C;  4LFB C;  4DV2 C;  1HNZ C;  4PUH A;  2CY1 A;  1HR0 C;  1JOS A;  2AYA A;  3VNR A;  1N32 C;  2OPL A;  4KTT A;  4JI7 C;  5BR8 C;  4YY3 C;  1FJG C;  4IR7 A;  4D4G A;  3ETC A;  5A2Q D;  1MDF A;  5LCI A;  4L4Q A;  3TR3 A;  3R9W A;  4X65 C;  2D1Q A;  1V26 A;  4JM1 A;  2VZE A;  2UXD C;  2CXC A;  5ADZ A;  5GTD A;  3NPD A;  3DAY A;  1M6X A;  4DR1 C;  4GS5 A;  3TQI A;  1N36 C;  4RLF A;  5IT9 D;  4YHH C;  4JI1 C;  1HNX C;  2QL8 A;  2YCB A;  4LF7 C;  2F4V C;  4RVO A;  2QVX X;  3J7A D;  3VNS A;  3RG2 A;  4DCV A;  2JMP A;  1PU1 A;  2P2F A;  1XHJ A;  1USP B;  1ULT A;  1L2F A;  1UKK A;  4PUI A;  2UUB C;  4L7I A;  4JI5 C;  4D4I A;  4PZP A;  4NXN C;  3GKU A;  2EGT A;  4I9F A;  1P7L A;  1O93 A;  1XRA A;  1TH5 A;  3JAM D;  1BA3 A;  2QW0 X;  3CQ1 A;  3FCC A;  4D57 A;  1V25 A;  4R1M A;  1ML8 A;  4WV3 A;  4LF8 C;  2KDN A;  4GXR A;  2PT7 G;  4DV7 C;  2BJO A;  4MTN A;  2D28 C;  4JV5 C;  3LGX A;  5A1G A;  4RMN A;  2ATW A;  1ZB9 A;  2E7G A;  3LUS A;  2Y4O A;  3LNO A;  2VSQ A;  4LFC C;  1XNQ C;  2D7V A;  4X62 C;  2VQE C;  3IPL A;  5A19 A;  1O92 A;  4U5Y D;  4DV4 C;  3I07 A;  3CJE A;  5BUR A;  4KHP C;  3A9U A;  4DR3 C;  2ASB A;  3UOW A;  1I94 C;  3EER A;  2P2M A;  5BSR A;  2Y4N A;  3IEU A;  2P02 A;  4B3S C;  4RM2 A;  4DG9 A;  4LF6 C;  4OX9 C;  4DV0 C;  2OO4 A;  4NOZ A;  1MDB A;  5DV9 A;  1XDX A;  2P2B A;  4DUZ C;  1YJ7 A;  3RV2 A;  4OYC A;  4LE5 A;  5JRH A;  2P2Q A;  1VLA A;  2UXB C;  5KYT A;  4HPV A;  3UEB A;  1IBK C;  5K8F A;  2Z51 A;  3TUF A;  5T8S A;  5LMU C;  4L2Z A;  4DR2 C;  4BBY A;  1P4E C;  2E8C A;  1XS3 A;  3A9V A;  4DR4 C;  2D1T A;  2E8E A;  3UX2 A;  3DLP X;  4X66 C;  3K6R A;  2ZZN A;  3LNV A;  3NI2 A;  4DCT A;  1MXA A;  5BSV A;  4NXM C;  4JI3 C;  3LAX A;  5CZV A;  1AMU A;  2ZZM A;  3UZ0 A;  1XMQ C;  4DV6 C;  1VEH A;  2UUA C;  4G1I A;  3N54 B;  5BUS A;  1PG4 A;  4WS9 A;  5FLX D;  2DHM A;  2UU9 C;  3S82 A;  1HNW C;  4I9G A;  2D1R A;  4FUQ A;  4PRO C;  3PES A;  4RVN A;  5LMN C;  2OPL B;  4PUG A;  2E0G A;  3VNQ A;  4BSZ A;  5KEI A;  4DV1 C;  2HJG A;  4DG8 A;  3GR1 A;  5CZX A;  4DV5 C;  1PA4 A;  4LF5 C;  3NYR A;  4GKK C;  3PBK A;  4DR6 C;  4FUT A;  3N2Q A;  2BH1 X;  5T8T A;  1WH9 A;  3R44 A;  3A4I A;  2E5L C;  1EGA A;  5BST A;  1KKG A;  5BSU A;  3J80 D;  4TPS B;  1NY8 A;  3SO4 A;  2WP0 C;  4DR5 C;  2UXC C;  2DPL A;  2YX1 A;  1N33 C;  1YGT A;  5IWA C;  4MH4 A;  3G7S A;  3EQ6 A;  1HH2 P;  1IBL C;  3J81 D;  4GXQ A;  4JI4 C;  1USP A;  4RM3 A;  3C5E A;  3ETO A;  4B3R C;  3A25 A;  4BC9 A;  5H9U A;  3AF6 A;  3L8C A;  3CW8 X;  5E7Q A;  4KTV A;  1XNR C;  3DHV A;  3I08 A;  3GR0 A;  2M5H A;  2M5O A;  1IB8 A;  4RLQ A;  4DV3 C;  4ODJ A;  3T1Y C;  1RG9 A;  2DYJ A;  3O2E A;  1V60 A;  2KZ0 A;  3A26 A;  2D1S A;  1P4E A;  4JI6 C;  1WF3 A;  4AQY C;  1T5D X;  4R1L A;  3OTO C;  1O90 A;  3UX3 A;  2PG1 E;  1QM4 A;  2YWB A;  4FTF A;  4ZLP A;  4OXI A;  1XMO C;  2Y27 A;  4R0M A;  2WD9 A;  5K85 A;  2ONF A;  5KYV A;  3CW9 A;  1LQL A;  1MXB A;  1O9T A;  1MD9 A;  1XRB A;  4G37 A;  1LCI A;  3NYQ A;  4JI8 C;  2NCL A;  2HHH C;  4DCS A;  2VQF C;  4GKJ C;  4LF9 C;  5BUQ A;  3FM7 A;  5BSW A;  2MM9 A;  1WCJ A;  3FCE A;  4JI2 C;  2UUC C;  3AF5 A;  4XX2 A;  2P2J A;  1FLO A;  1RY2 A;  5BSM A;  4DCU A;  2MCQ A;  4ZJZ A;  3H2T A;  1MKY A;  2QVZ X;  4K0K C;  1N2F A;  1M6X C;  5AE3 A; 
#chains in the Genus database with same CATH homology
 3E7W A;  3IML A;  3B7W A;  1N34 C;  4LFA C;  2YWC A;  1GPM A;  1XRC A;  2D27 A;  2OBV A;  2P20 A;  3E7X A;  3TDE A;  3T1H C;  2XR1 A;  4PHT A;  1MXC A;  5AE1 A;  3R9X A;  4DR7 C;  4ISB A;  4B3T C;  2E8F A;  4EAT A;  2V7B A;  4G36 A;  2QVY X;  2KZF A;  1PG3 A;  2PRO A;  2ZM6 C;  1ZB8 A;  1FUG A;  3GPC A;  4JI0 C;  4DUY C;  3PRO C;  1K0R A;  1NYE A;  1T5H X;  1IBM C;  5IFI A;  1J5E C;  4LF4 C;  4BCA A;  4X64 C;  2PN2 A;  5AE2 A;  4K0B A;  4BC7 A;  1QWI A;  4B3M C;  4NDN A;  3IEV A;  4IZ6 A;  4D56 A;  5A1I A;  3L95 X;  3KXW A;  4JYA C;  4LFB C;  4DV2 C;  1HNZ C;  2CY1 A;  1HR0 C;  1JOS A;  2AYA A;  3VNR A;  1N32 C;  2OPL A;  4KTT A;  4JI7 C;  5BR8 C;  4YY3 C;  1FJG C;  4IR7 A;  4D4G A;  3ETC A;  5A2Q D;  1MDF A;  4L4Q A;  3R9W A;  4X65 C;  2D1Q A;  1V26 A;  4JM1 A;  2VZE A;  2UXD C;  2CXC A;  5ADZ A;  5GTD A;  3NPD A;  3DAY A;  4DR1 C;  4GS5 A;  3TQI A;  1N36 C;  4RLF A;  5IT9 D;  4YHH C;  4JI1 C;  1HNX C;  2QL8 A;  2YCB A;  4LF7 C;  2F4V C;  4RVO A;  2QVX X;  3J7A D;  3VNS A;  3RG2 A;  4DCV A;  2JMP A;  2P2F A;  1USP B;  1ULT A;  1L2F A;  1UKK A;  2UUB C;  4L7I A;  4JI5 C;  4D4I A;  4PZP A;  4NXN C;  3GKU A;  2EGT A;  4I9F A;  1P7L A;  1O93 A;  1XRA A;  3JAM D;  1BA3 A;  2QW0 X;  3FCC A;  4D57 A;  1V25 A;  4R1M A;  1ML8 A;  4WV3 A;  4LF8 C;  4GXR A;  2PT7 G;  4DV7 C;  2BJO A;  4MTN A;  2D28 C;  4JV5 C;  3LGX A;  5A1G A;  4RMN A;  2ATW A;  1ZB9 A;  2E7G A;  3LUS A;  2Y4O A;  2VSQ A;  4LFC C;  1XNQ C;  2D7V A;  4X62 C;  2VQE C;  3IPL A;  5A19 A;  1O92 A;  4U5Y D;  4DV4 C;  3I07 A;  3CJE A;  5BUR A;  4KHP C;  3A9U A;  4DR3 C;  2ASB A;  3UOW A;  1I94 C;  3EER A;  2P2M A;  5BSR A;  2Y4N A;  3IEU A;  2P02 A;  4B3S C;  4RM2 A;  4DG9 A;  4LF6 C;  4OX9 C;  4DV0 C;  2OO4 A;  4NOZ A;  1MDB A;  5DV9 A;  2P2B A;  4DUZ C;  1YJ7 A;  3RV2 A;  4OYC A;  4LE5 A;  5JRH A;  2P2Q A;  1VLA A;  2UXB C;  5KYT A;  4HPV A;  1IBK C;  5K8F A;  3TUF A;  5T8S A;  5LMU C;  4L2Z A;  4DR2 C;  4BBY A;  2E8C A;  3A9V A;  4DR4 C;  2D1T A;  2E8E A;  3DLP X;  4X66 C;  3LNV A;  3NI2 A;  4DCT A;  1MXA A;  5BSV A;  4NXM C;  4JI3 C;  3LAX A;  5CZV A;  1AMU A;  3UZ0 A;  1XMQ C;  4DV6 C;  2UUA C;  4G1I A;  3N54 B;  5BUS A;  1PG4 A;  4WS9 A;  5FLX D;  2UU9 C;  3S82 A;  1HNW C;  4I9G A;  2D1R A;  4FUQ A;  4PRO C;  3PES A;  4RVN A;  5LMN C;  2OPL B;  2E0G A;  3VNQ A;  4BSZ A;  5KEI A;  4DV1 C;  2HJG A;  4DG8 A;  3GR1 A;  5CZX A;  4DV5 C;  1PA4 A;  4LF5 C;  3NYR A;  4GKK C;  3PBK A;  4DR6 C;  4FUT A;  3N2Q A;  2BH1 X;  5T8T A;  1WH9 A;  3R44 A;  3A4I A;  2E5L C;  1EGA A;  5BST A;  1KKG A;  5BSU A;  3J80 D;  4TPS B;  3SO4 A;  2WP0 C;  4DR5 C;  2UXC C;  2DPL A;  1N33 C;  5IWA C;  4MH4 A;  3G7S A;  3EQ6 A;  1HH2 P;  1IBL C;  3J81 D;  4GXQ A;  4JI4 C;  1USP A;  4RM3 A;  3C5E A;  3ETO A;  4B3R C;  4BC9 A;  5H9U A;  3AF6 A;  3L8C A;  3CW8 X;  5E7Q A;  4KTV A;  1XNR C;  3DHV A;  3I08 A;  3GR0 A;  4RLQ A;  4DV3 C;  4ODJ A;  3T1Y C;  1RG9 A;  2DYJ A;  2D1S A;  4JI6 C;  1WF3 A;  4AQY C;  1T5D X;  4R1L A;  3OTO C;  1O90 A;  1QM4 A;  2YWB A;  4FTF A;  4ZLP A;  4OXI A;  1XMO C;  2Y27 A;  4R0M A;  2WD9 A;  5K85 A;  2ONF A;  5KYV A;  3CW9 A;  1LQL A;  1MXB A;  1O9T A;  1MD9 A;  1XRB A;  4G37 A;  1LCI A;  3NYQ A;  4JI8 C;  2HHH C;  4DCS A;  2VQF C;  4GKJ C;  4LF9 C;  5BUQ A;  5BSW A;  3FCE A;  4JI2 C;  2UUC C;  3AF5 A;  4XX2 A;  2P2J A;  1RY2 A;  5BSM A;  4DCU A;  4ZJZ A;  3H2T A;  1MKY A;  2QVZ X;  4K0K C;  1N2F A;  5AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...