2E5LC

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e5lC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2e5lC02
1EGAA 4JV5C 4JI2C 3R9XA 5LMNC 5IT9D 4DR4C 4LF7C 1ZB9A 1JOSA 3LUSA 2BJOA 3T1HC 4DCVA 4JI7C 2UUAC 4DUZC 4X65C 1WF3A 1N36C 3OTOC 4DR1C 4DV1C 1USPA 1XMOC 4NXMC 2ATWA 4JI3C 4BSZA 2E8EA 4DV2C 1XNQC 4XX2A 1FJGC 2UU9C 4JI0C 4DCSA 3J80D 3AF6A 1I94C 5FLXD 4DV3C 1PA4A 4OX9C 1ZB8A 1N2FA 4LF5C 4X66C 1XMQC 1HNXC 2EGTA 2QL8A 2OPLA 4LFAC 4DV0C 4DV5C 2PN2A 4DV4C 3T1YC 2ASBA 4B3RC 4MTNA 1LQLA 2HJGA 4LFCC 1MKYA 4DUYC 1UKKA 4GKKC 1J5EC 1XNRC 4JI6C 3R9WA 4DCUA 3I07A 2HHHC 4B3MC 1N34C 2CY1A 1N32C 1KKGA 4DR6C 4DV7C 4JYAC 4GKJC 1ML8A 1K0RA 4LF6C 1WH9A 2E8CA 2JMPA 2DYJA 1QWIA 2ONFA 4X62C 4LF8C 1IBKC 4JI1C 1L2FA 1HNZC 3GKUA 4X64C 4LF4C 4DR7C 2E8FA 2UXBC 2D7VA 4KHPC 4NXNC 3J81D 1IBLC 5LMUC 4DV6C 4JI5C 2XR1A 3J7AD 2UXDC 1NYEA 1VLAA 4MH4A 3CJEA 4DCTA 1HNWC 1HH2P 2VQEC 2E5LC 2ZM6C 2UUCC 4B3SC 3IEVA 2OPLB 4K0KC 4DR2C 2YCBA 1USPB 2UXCC 1IBMC 2PT7G 3JAMD 4YY3C 5BR8C 3EERA 4JI8C 1N33C 3AF5A 5A2QD 4DR3C 2F4VC 4LF9C 3IEUA 2UUBC 4B3TC 4YHHC 4JI4C 5IWAC 4NOZA 4AQYC 4LFBC 2E7GA 2CXCA 1HR0C 4DR5C 2VQFC 2KZFA
chains in the Genus database with same CATH superfamily
1EGAA 1IB8A 4JI2C 2WP0C 4EATA 3R9XA 4PUHA 5LMNC 4GXQA 2BJOA 4GXRA 4DCVA 4KTVA 1MXAA 2UUAC 5E7QA 1WF3A 5T8SA 4R0MA 2WD9A 4NXMC 2ATWA 3FCCA 3LGXA 1XNQC 5BSUA 1P7LA 2PG1E 4TPSB 4DV3C 3L95X 3VNRA 4LF5C 3O2EA 1XMQC 4L7IA 2EGTA 1LCIA 2NCLA 4PUIA 2D1QA 4PHTA 4ISBA 4DV4C 1ULTA 4MTNA 2D1TA 3CQ2A 2E0GA 1MKYA 4L2ZA 2KDNA 1YJ7A 1O92A 2P2QA 1XNRC 1XS3A 3TQIA 1KKGA 4DR6C 2QVYX 4DV7C 4D56A 3GR0A 1PG4A 2DYJA 1IBKC 4JI1C 1HNZC 3GKUA 1AMUA 1TH5A 3IPLA 2D7VA 3VNSA 4KHPC 3A9VA 5GTDA 2XR1A 4G37A 5T8TA 4MH4A 3CJEA 1HNWC 1PU1A 4FUQA 4RLQA 2OPLB 3G7SA 2VZEA 2UXCC 2PT7G 2JNVA 4YY3C 2P02A 2F4VC 2CU6A 1M6XC 1BA3A 4GS5A 4NOZA 4AQYC 4LFBC 3NPDA 4I9FA 3E7WA 4JV5C 2P20A 2DPLA 5BSWA 1ZB9A 1JOSA 3TDEA 4LE5A 4DUZC 4X65C 2P2BA 3NYRA 1RG9A 3CW8X 5BURA 1XMOC 4RM2A 4JI3C 4BSZA 4DV2C 3UX3A 1FJGC 3CQ1A 4DCSA 5FLXD 3LNOA 1PA4A 1V60A 4PZPA 1MDBA 4FTFA 2QL8A 4WS9A 2PN2A 1UWDA 2PROA 1LQLA 4LFCC 4DUYC 3A25A 4JI6C 5A19A 4DCUA 5AE2A 2HHHC 4B3MC 1N34C 2VSQA 2CY1A 1N32C 5K85A 4GKJC 2E8CA 1QWIA 4D4IA 4X62C 1XHJA 4LF8C 3CQ3A 3TUFA 4FUTA 1P4EC 5AE1A 3J81D 1XRCA 4DV6C 4JI5C 3EQ6A 4OXIA 3J7AD 2UXDC 3ETOA 1VLAA 4RMNA 2VQEC 2E5LC 2ZM6C 5CZXA 5BUQA 4B3SC 3N54B 2OO4A 3E7XA 1IBMC 5KYVA 3JAMD 5BR8C 4R1MA 3AF5A 4LF9C 3IEUA 1FLOA 4YHHC 5CZVA 4JI4C 3GPCA 3A4IA 1HR0C 4DR5C 3DLPX 2P2JA 3UX2A 5BSRA 2Z51A 3N2QA 3FM7A 3DHVA 3VNQA 4DR4C 4LF7C 4ODJA 1NY8A 3LUSA 3PESA 3I08A 1N36C 4G1IA 3OTOC 4DR1C 3PBKA 2Y4NA 4I9GA 4BC9A 2E8EA 4HPVA 2UU9C 4JI0C 2YWCA 3NI2A 3AF6A 3S82A 3K6RA 2Y4OA 3UOWA 3LAXA 1ZB8A 4X66C 3AY0A 2YX1A 1HNXC 4IR7A 3FCEA 4DV0C 4DV5C 3T1YC 2M5OA 2QVXX 5BSTA 2MM9A 2HJGA 1YGTA 5KYTA 5A1IA 1J5EC 4L4QA 2ZZNA 4BCAA 4RVOA 3ETCA 2MMAB 1MDFA 1QM4A 3R44A 1WH9A 2YWBA 4RLFA 2ONFA 3B7WA 2Y27A 2D1RA 1RY2A 1L2FA 3DAYA 1XRAA 4LF4C 2UXBC 3NYQA 3TR3A 5KEIA 4NXNC 4BC7A 5LMUC 2ZTBA 2P2MA 1NYEA 1GPMA 4DCTA 5BSMA 3H2TA 5JRHA 1HH2P 2UUCC 3IEVA 3UZ0A 4DR2C 2QW0X 2YCBA 4RM3A 3EERA 1N33C 3PROC 4NDNA 3A26A 2UUBC 4RVNA 3IMLA 3LNVA 5ADZA 2E7GA 3L8CA 2VQFC 2BH1X 2KZFA 3KXWA 4DG8A 5IT9D 5LCIA 3T1HC 4JI7C 4PUGA 2M5HA 2P2FA 3C5EA 1O93A 1MD9A 4DV1C 1USPA 4R1LA 5K8FA 1FUGA 1VEHA 3RV2A 4XX2A 2D28C 5H9UA 1V26A 1O90A 3J80D 1I94C 4ZJZA 1XDXA 2DHMA 3GR1A 4OX9C 1N2FA 5IFIA 5DV9A 4BBYA 2OPLA 2AYAA 4LFAC 1O9TA 2ASBA 4B3RC 2KZ0A 2D1SA 1UKKA 1WCJA 2D27A 4GKKC 1T5HX 3A9UA 3R9WA 3I07A 2ZZMA 1T5DX 1PG3A 3CW9A 4JYAC 1ML8A 1K0RA 2OBVA 4LF6C 2QVZX 4DG9A 2JMPA 1MXBA 1M6XA 4D4GA 5AE3A 4U5YD 4X64C 4DR7C 2E8FA 4OYCA 3RG2A 1IBLC 4KTTA 5A1GA 4G36A 5BSVA 4ZLPA 1XRBA 1V25A 4K0KC 1USPB 5BUSA 2V7BA 4JI8C 5A2QD 4DR3C 4IZ6A 1P4EA 4JM1A 3SO4A 4B3TC 4K0BA 2MCQA 5IWAC 4D57A 1MXCA 2CXCA 4WV3A 4PROC 3UEBA
chains in the Genus database with same CATH topology
1EGAA 4JI2C 2WP0C 4EATA 3R9XA 5LMNC 4GXQA 2BJOA 4GXRA 4DCVA 4KTVA 1MXAA 2UUAC 5E7QA 1WF3A 5T8SA 4R0MA 2WD9A 4NXMC 2ATWA 3FCCA 3LGXA 1XNQC 5BSUA 1P7LA 4TPSB 4DV3C 3L95X 3VNRA 4LF5C 1XMQC 4L7IA 2EGTA 1LCIA 2D1QA 4PHTA 4ISBA 4DV4C 1ULTA 4MTNA 2D1TA 2E0GA 1MKYA 4L2ZA 2P2QA 1YJ7A 1O92A 1XNRC 3TQIA 1KKGA 4DR6C 2QVYX 4DV7C 4D56A 3GR0A 1PG4A 2DYJA 1IBKC 4JI1C 1HNZC 3GKUA 1AMUA 3IPLA 2D7VA 3VNSA 4KHPC 3A9VA 5GTDA 2XR1A 4G37A 5T8TA 4MH4A 3CJEA 1HNWC 4FUQA 4RLQA 2OPLB 3G7SA 2VZEA 2UXCC 2PT7G 4YY3C 2P02A 2F4VC 1BA3A 4GS5A 4NOZA 4AQYC 4LFBC 3NPDA 4I9FA 3E7WA 4JV5C 2P20A 2DPLA 5BSWA 1ZB9A 1JOSA 3TDEA 4LE5A 4DUZC 4X65C 2P2BA 3NYRA 1RG9A 3CW8X 5BURA 1XMOC 4RM2A 4JI3C 4BSZA 4DV2C 1FJGC 4DCSA 5FLXD 1PA4A 4PZPA 1MDBA 4FTFA 2QL8A 4WS9A 2PN2A 2PROA 1LQLA 4LFCC 4DUYC 4JI6C 5A19A 4DCUA 5AE2A 2HHHC 4B3MC 1N34C 2VSQA 2CY1A 1N32C 5K85A 4GKJC 2E8CA 1QWIA 4D4IA 4X62C 4LF8C 3TUFA 4FUTA 5AE1A 3J81D 1XRCA 4DV6C 4JI5C 3EQ6A 4OXIA 3J7AD 2UXDC 3ETOA 1VLAA 2E5LC 2VQEC 4RMNA 5CZXA 5BUQA 2ZM6C 4B3SC 3N54B 2OO4A 3E7XA 1IBMC 5KYVA 3JAMD 5BR8C 4R1MA 3AF5A 4LF9C 3IEUA 4YHHC 5CZVA 4JI4C 3GPCA 3A4IA 1HR0C 4DR5C 3DLPX 2P2JA 5BSRA 3N2QA 3DHVA 3VNQA 4DR4C 4LF7C 4ODJA 3LUSA 3PESA 3I08A 1N36C 4G1IA 3OTOC 4DR1C 3PBKA 2Y4NA 4I9GA 4BC9A 2E8EA 4HPVA 2UU9C 4JI0C 2YWCA 3NI2A 3AF6A 3S82A 2Y4OA 3UOWA 3LAXA 1ZB8A 4X66C 1HNXC 4IR7A 3FCEA 4DV0C 4DV5C 3T1YC 2QVXX 5BSTA 2HJGA 5KYTA 5A1IA 1J5EC 4L4QA 4BCAA 4RVOA 3ETCA 1MDFA 1QM4A 3R44A 1WH9A 2YWBA 4RLFA 2ONFA 3B7WA 2Y27A 2D1RA 1RY2A 1L2FA 3DAYA 1XRAA 4LF4C 2UXBC 3NYQA 5KEIA 4NXNC 4BC7A 5LMUC 2P2MA 1NYEA 1GPMA 4DCTA 5BSMA 3H2TA 5JRHA 1HH2P 2UUCC 3IEVA 3UZ0A 4DR2C 2QW0X 2YCBA 4RM3A 3EERA 1N33C 3PROC 4NDNA 2UUBC 4RVNA 3IMLA 3LNVA 5ADZA 2E7GA 3L8CA 2BH1X 2VQFC 2KZFA 3KXWA 4DG8A 5IT9D 3T1HC 4JI7C 2P2FA 3C5EA 1O93A 1MD9A 4DV1C 1USPA 4R1LA 5K8FA 1FUGA 3RV2A 4XX2A 2D28C 5H9UA 1V26A 1O90A 3J80D 1I94C 4ZJZA 3GR1A 4OX9C 1N2FA 5IFIA 5DV9A 4BBYA 2OPLA 4LFAC 2AYAA 1O9TA 2ASBA 4B3RC 2D1SA 1UKKA 2D27A 4GKKC 1T5HX 3A9UA 3R9WA 3I07A 1T5DX 1PG3A 3CW9A 4JYAC 1ML8A 1K0RA 2OBVA 4LF6C 2QVZX 4DG9A 2JMPA 1MXBA 4D4GA 5AE3A 4U5YD 4X64C 4DR7C 2E8FA 4OYCA 3RG2A 1IBLC 4KTTA 5A1GA 4G36A 5BSVA 4ZLPA 1XRBA 1V25A 4K0KC 1USPB 5BUSA 2V7BA 4JI8C 5A2QD 4DR3C 4IZ6A 4JM1A 3SO4A 4B3TC 4K0BA 5IWAC 4D57A 1MXCA 2CXCA 4WV3A 4PROC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EGA A;  4JV5 C;  4JI2 C;  3R9X A;  5LMN C;  5IT9 D;  4DR4 C;  4LF7 C;  1ZB9 A;  1JOS A;  3LUS A;  2BJO A;  3T1H C;  4DCV A;  4JI7 C;  2UUA C;  4DUZ C;  4X65 C;  1WF3 A;  1N36 C;  3OTO C;  4DR1 C;  4DV1 C;  1USP A;  1XMO C;  4NXM C;  2ATW A;  4JI3 C;  4BSZ A;  2E8E A;  4DV2 C;  1XNQ C;  4XX2 A;  1FJG C;  2UU9 C;  4JI0 C;  4DCS A;  3J80 D;  3AF6 A;  1I94 C;  5FLX D;  4DV3 C;  1PA4 A;  4OX9 C;  1ZB8 A;  1N2F A;  4LF5 C;  4X66 C;  1XMQ C;  1HNX C;  2EGT A;  2QL8 A;  2OPL A;  4LFA C;  4DV0 C;  4DV5 C;  2PN2 A;  4DV4 C;  3T1Y C;  2ASB A;  4B3R C;  4MTN A;  1LQL A;  2HJG A;  4LFC C;  1MKY A;  4DUY C;  1UKK A;  4GKK C;  1J5E C;  1XNR C;  4JI6 C;  3R9W A;  4DCU A;  3I07 A;  2HHH C;  4B3M C;  1N34 C;  2CY1 A;  1N32 C;  1KKG A;  4DR6 C;  4DV7 C;  4JYA C;  4GKJ C;  1ML8 A;  1K0R A;  4LF6 C;  1WH9 A;  2E8C A;  2JMP A;  2DYJ A;  1QWI A;  2ONF A;  4X62 C;  4LF8 C;  1IBK C;  4JI1 C;  1L2F A;  1HNZ C;  3GKU A;  4X64 C;  4LF4 C;  4DR7 C;  2E8F A;  2UXB C;  2D7V A;  4KHP C;  4NXN C;  3J81 D;  1IBL C;  5LMU C;  4DV6 C;  4JI5 C;  2XR1 A;  3J7A D;  2UXD C;  1NYE A;  1VLA A;  4MH4 A;  3CJE A;  4DCT A;  1HNW C;  1HH2 P;  2VQE C;  2E5L C;  2ZM6 C;  2UUC C;  4B3S C;  3IEV A;  2OPL B;  4K0K C;  4DR2 C;  2YCB A;  1USP B;  2UXC C;  1IBM C;  2PT7 G;  3JAM D;  4YY3 C;  5BR8 C;  3EER A;  4JI8 C;  1N33 C;  3AF5 A;  5A2Q D;  4DR3 C;  2F4V C;  4LF9 C;  3IEU A;  2UUB C;  4B3T C;  4YHH C;  4JI4 C;  5IWA C;  4NOZ A;  4AQY C;  4LFB C;  2E7G A;  2CXC A;  1HR0 C;  4DR5 C;  2VQF C;  2KZF A; 
#chains in the Genus database with same CATH topology
 1EGA A;  1IB8 A;  4JI2 C;  2WP0 C;  4EAT A;  3R9X A;  4PUH A;  5LMN C;  4GXQ A;  2BJO A;  4GXR A;  4DCV A;  4KTV A;  1MXA A;  2UUA C;  5E7Q A;  1WF3 A;  5T8S A;  4R0M A;  2WD9 A;  4NXM C;  2ATW A;  3FCC A;  3LGX A;  1XNQ C;  5BSU A;  1P7L A;  2PG1 E;  4TPS B;  4DV3 C;  3L95 X;  3VNR A;  4LF5 C;  3O2E A;  1XMQ C;  4L7I A;  2EGT A;  1LCI A;  2NCL A;  4PUI A;  2D1Q A;  4PHT A;  4ISB A;  4DV4 C;  1ULT A;  4MTN A;  2D1T A;  3CQ2 A;  2E0G A;  1MKY A;  4L2Z A;  2KDN A;  1YJ7 A;  1O92 A;  2P2Q A;  1XNR C;  1XS3 A;  3TQI A;  1KKG A;  4DR6 C;  2QVY X;  4DV7 C;  4D56 A;  3GR0 A;  1PG4 A;  2DYJ A;  1IBK C;  4JI1 C;  1HNZ C;  3GKU A;  1AMU A;  1TH5 A;  3IPL A;  2D7V A;  3VNS A;  4KHP C;  3A9V A;  5GTD A;  2XR1 A;  4G37 A;  5T8T A;  4MH4 A;  3CJE A;  1HNW C;  1PU1 A;  4FUQ A;  4RLQ A;  2OPL B;  3G7S A;  2VZE A;  2UXC C;  2PT7 G;  2JNV A;  4YY3 C;  2P02 A;  2F4V C;  2CU6 A;  1M6X C;  1BA3 A;  4GS5 A;  4NOZ A;  4AQY C;  4LFB C;  3NPD A;  4I9F A;  3E7W A;  4JV5 C;  2P20 A;  2DPL A;  5BSW A;  1ZB9 A;  1JOS A;  3TDE A;  4LE5 A;  4DUZ C;  4X65 C;  2P2B A;  3NYR A;  1RG9 A;  3CW8 X;  5BUR A;  1XMO C;  4RM2 A;  4JI3 C;  4BSZ A;  4DV2 C;  3UX3 A;  1FJG C;  3CQ1 A;  4DCS A;  5FLX D;  3LNO A;  1PA4 A;  1V60 A;  4PZP A;  1MDB A;  4FTF A;  2QL8 A;  4WS9 A;  2PN2 A;  1UWD A;  2PRO A;  1LQL A;  4LFC C;  4DUY C;  3A25 A;  4JI6 C;  5A19 A;  4DCU A;  5AE2 A;  2HHH C;  4B3M C;  1N34 C;  2VSQ A;  2CY1 A;  1N32 C;  5K85 A;  4GKJ C;  2E8C A;  1QWI A;  4D4I A;  4X62 C;  1XHJ A;  4LF8 C;  3CQ3 A;  3TUF A;  4FUT A;  1P4E C;  5AE1 A;  3J81 D;  1XRC A;  4DV6 C;  4JI5 C;  3EQ6 A;  4OXI A;  3J7A D;  2UXD C;  3ETO A;  1VLA A;  4RMN A;  2VQE C;  2E5L C;  2ZM6 C;  5CZX A;  5BUQ A;  4B3S C;  3N54 B;  2OO4 A;  3E7X A;  1IBM C;  5KYV A;  3JAM D;  5BR8 C;  4R1M A;  3AF5 A;  4LF9 C;  3IEU A;  1FLO A;  4YHH C;  5CZV A;  4JI4 C;  3GPC A;  3A4I A;  1HR0 C;  4DR5 C;  3DLP X;  2P2J A;  3UX2 A;  5BSR A;  2Z51 A;  3N2Q A;  3FM7 A;  3DHV A;  3VNQ A;  4DR4 C;  4LF7 C;  4ODJ A;  1NY8 A;  3LUS A;  3PES A;  3I08 A;  1N36 C;  4G1I A;  3OTO C;  4DR1 C;  3PBK A;  2Y4N A;  4I9G A;  4BC9 A;  2E8E A;  4HPV A;  2UU9 C;  4JI0 C;  2YWC A;  3NI2 A;  3AF6 A;  3S82 A;  3K6R A;  2Y4O A;  3UOW A;  3LAX A;  1ZB8 A;  4X66 C;  3AY0 A;  2YX1 A;  1HNX C;  4IR7 A;  3FCE A;  4DV0 C;  4DV5 C;  3T1Y C;  2M5O A;  2QVX X;  5BST A;  2MM9 A;  2HJG A;  1YGT A;  5KYT A;  5A1I A;  1J5E C;  4L4Q A;  2ZZN A;  4BCA A;  4RVO A;  3ETC A;  2MMA B;  1MDF A;  1QM4 A;  3R44 A;  1WH9 A;  2YWB A;  4RLF A;  2ONF A;  3B7W A;  2Y27 A;  2D1R A;  1RY2 A;  1L2F A;  3DAY A;  1XRA A;  4LF4 C;  2UXB C;  3NYQ A;  3TR3 A;  5KEI A;  4NXN C;  4BC7 A;  5LMU C;  2ZTB A;  2P2M A;  1NYE A;  1GPM A;  4DCT A;  5BSM A;  3H2T A;  5JRH A;  1HH2 P;  2UUC C;  3IEV A;  3UZ0 A;  4DR2 C;  2QW0 X;  2YCB A;  4RM3 A;  3EER A;  1N33 C;  3PRO C;  4NDN A;  3A26 A;  2UUB C;  4RVN A;  3IML A;  3LNV A;  5ADZ A;  2E7G A;  3L8C A;  2VQF C;  2BH1 X;  2KZF A;  3KXW A;  4DG8 A;  5IT9 D;  5LCI A;  3T1H C;  4JI7 C;  4PUG A;  2M5H A;  2P2F A;  3C5E A;  1O93 A;  1MD9 A;  4DV1 C;  1USP A;  4R1L A;  5K8F A;  1FUG A;  1VEH A;  3RV2 A;  4XX2 A;  2D28 C;  5H9U A;  1V26 A;  1O90 A;  3J80 D;  1I94 C;  4ZJZ A;  1XDX A;  2DHM A;  3GR1 A;  4OX9 C;  1N2F A;  5IFI A;  5DV9 A;  4BBY A;  2OPL A;  2AYA A;  4LFA C;  1O9T A;  2ASB A;  4B3R C;  2KZ0 A;  2D1S A;  1UKK A;  1WCJ A;  2D27 A;  4GKK C;  1T5H X;  3A9U A;  3R9W A;  3I07 A;  2ZZM A;  1T5D X;  1PG3 A;  3CW9 A;  4JYA C;  1ML8 A;  1K0R A;  2OBV A;  4LF6 C;  2QVZ X;  4DG9 A;  2JMP A;  1MXB A;  1M6X A;  4D4G A;  5AE3 A;  4U5Y D;  4X64 C;  4DR7 C;  2E8F A;  4OYC A;  3RG2 A;  1IBL C;  4KTT A;  5A1G A;  4G36 A;  5BSV A;  4ZLP A;  1XRB A;  1V25 A;  4K0K C;  1USP B;  5BUS A;  2V7B A;  4JI8 C;  5A2Q D;  4DR3 C;  4IZ6 A;  1P4E A;  4JM1 A;  3SO4 A;  4B3T C;  4K0B A;  2MCQ A;  5IWA C;  4D57 A;  1MXC A;  2CXC A;  4WV3 A;  4PRO C;  3UEB A; 
#chains in the Genus database with same CATH homology
 1EGA A;  4JI2 C;  2WP0 C;  4EAT A;  3R9X A;  5LMN C;  4GXQ A;  2BJO A;  4GXR A;  4DCV A;  4KTV A;  1MXA A;  2UUA C;  5E7Q A;  1WF3 A;  5T8S A;  4R0M A;  2WD9 A;  4NXM C;  2ATW A;  3FCC A;  3LGX A;  1XNQ C;  5BSU A;  1P7L A;  4TPS B;  4DV3 C;  3L95 X;  3VNR A;  4LF5 C;  1XMQ C;  4L7I A;  2EGT A;  1LCI A;  2D1Q A;  4PHT A;  4ISB A;  4DV4 C;  1ULT A;  4MTN A;  2D1T A;  2E0G A;  1MKY A;  4L2Z A;  2P2Q A;  1YJ7 A;  1O92 A;  1XNR C;  3TQI A;  1KKG A;  4DR6 C;  2QVY X;  4DV7 C;  4D56 A;  3GR0 A;  1PG4 A;  2DYJ A;  1IBK C;  4JI1 C;  1HNZ C;  3GKU A;  1AMU A;  3IPL A;  2D7V A;  3VNS A;  4KHP C;  3A9V A;  5GTD A;  2XR1 A;  4G37 A;  5T8T A;  4MH4 A;  3CJE A;  1HNW C;  4FUQ A;  4RLQ A;  2OPL B;  3G7S A;  2VZE A;  2UXC C;  2PT7 G;  4YY3 C;  2P02 A;  2F4V C;  1BA3 A;  4GS5 A;  4NOZ A;  4AQY C;  4LFB C;  3NPD A;  4I9F A;  3E7W A;  4JV5 C;  2P20 A;  2DPL A;  5BSW A;  1ZB9 A;  1JOS A;  3TDE A;  4LE5 A;  4DUZ C;  4X65 C;  2P2B A;  3NYR A;  1RG9 A;  3CW8 X;  5BUR A;  1XMO C;  4RM2 A;  4JI3 C;  4BSZ A;  4DV2 C;  1FJG C;  4DCS A;  5FLX D;  1PA4 A;  4PZP A;  1MDB A;  4FTF A;  2QL8 A;  4WS9 A;  2PN2 A;  2PRO A;  1LQL A;  4LFC C;  4DUY C;  4JI6 C;  5A19 A;  4DCU A;  5AE2 A;  2HHH C;  4B3M C;  1N34 C;  2VSQ A;  2CY1 A;  1N32 C;  5K85 A;  4GKJ C;  2E8C A;  1QWI A;  4D4I A;  4X62 C;  4LF8 C;  3TUF A;  4FUT A;  5AE1 A;  3J81 D;  1XRC A;  4DV6 C;  4JI5 C;  3EQ6 A;  4OXI A;  3J7A D;  2UXD C;  3ETO A;  1VLA A;  2E5L C;  2VQE C;  4RMN A;  5CZX A;  5BUQ A;  2ZM6 C;  4B3S C;  3N54 B;  2OO4 A;  3E7X A;  1IBM C;  5KYV A;  3JAM D;  5BR8 C;  4R1M A;  3AF5 A;  4LF9 C;  3IEU A;  4YHH C;  5CZV A;  4JI4 C;  3GPC A;  3A4I A;  1HR0 C;  4DR5 C;  3DLP X;  2P2J A;  5BSR A;  3N2Q A;  3DHV A;  3VNQ A;  4DR4 C;  4LF7 C;  4ODJ A;  3LUS A;  3PES A;  3I08 A;  1N36 C;  4G1I A;  3OTO C;  4DR1 C;  3PBK A;  2Y4N A;  4I9G A;  4BC9 A;  2E8E A;  4HPV A;  2UU9 C;  4JI0 C;  2YWC A;  3NI2 A;  3AF6 A;  3S82 A;  2Y4O A;  3UOW A;  3LAX A;  1ZB8 A;  4X66 C;  1HNX C;  4IR7 A;  3FCE A;  4DV0 C;  4DV5 C;  3T1Y C;  2QVX X;  5BST A;  2HJG A;  5KYT A;  5A1I A;  1J5E C;  4L4Q A;  4BCA A;  4RVO A;  3ETC A;  1MDF A;  1QM4 A;  3R44 A;  1WH9 A;  2YWB A;  4RLF A;  2ONF A;  3B7W A;  2Y27 A;  2D1R A;  1RY2 A;  1L2F A;  3DAY A;  1XRA A;  4LF4 C;  2UXB C;  3NYQ A;  5KEI A;  4NXN C;  4BC7 A;  5LMU C;  2P2M A;  1NYE A;  1GPM A;  4DCT A;  5BSM A;  3H2T A;  5JRH A;  1HH2 P;  2UUC C;  3IEV A;  3UZ0 A;  4DR2 C;  2QW0 X;  2YCB A;  4RM3 A;  3EER A;  1N33 C;  3PRO C;  4NDN A;  2UUB C;  4RVN A;  3IML A;  3LNV A;  5ADZ A;  2E7G A;  3L8C A;  2BH1 X;  2VQF C;  2KZF A;  3KXW A;  4DG8 A;  5IT9 D;  3T1H C;  4JI7 C;  2P2F A;  3C5E A;  1O93 A;  1MD9 A;  4DV1 C;  1USP A;  4R1L A;  5K8F A;  1FUG A;  3RV2 A;  4XX2 A;  2D28 C;  5H9U A;  1V26 A;  1O90 A;  3J80 D;  1I94 C;  4ZJZ A;  3GR1 A;  4OX9 C;  1N2F A;  5IFI A;  5DV9 A;  4BBY A;  2OPL A;  4LFA C;  2AYA A;  1O9T A;  2ASB A;  4B3R C;  2D1S A;  1UKK A;  2D27 A;  4GKK C;  1T5H X;  3A9U A;  3R9W A;  3I07 A;  1T5D X;  1PG3 A;  3CW9 A;  4JYA C;  1ML8 A;  1K0R A;  2OBV A;  4LF6 C;  2QVZ X;  4DG9 A;  2JMP A;  1MXB A;  4D4G A;  5AE3 A;  4U5Y D;  4X64 C;  4DR7 C;  2E8F A;  4OYC A;  3RG2 A;  1IBL C;  4KTT A;  5A1G A;  4G36 A;  5BSV A;  4ZLP A;  1XRB A;  1V25 A;  4K0K C;  1USP B;  5BUS A;  2V7B A;  4JI8 C;  5A2Q D;  4DR3 C;  4IZ6 A;  4JM1 A;  3SO4 A;  4B3T C;  4K0B A;  5IWA C;  4D57 A;  1MXC A;  2CXC A;  4WV3 A;  4PRO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...