2E5LC

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e5lC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2e5lC02
4DV7C 1FJGC 2PT7G 4JI0C 1IBKC 2E8FA 4XX2A 1MKYA 4DUYC 4DCVA 4DR4C 2F4VC 2UXBC 4JI5C 1ML8A 4JI4C 3EERA 1ZB8A 1LQLA 4DR6C 1QWIA 4DV2C 1USPA 1NYEA 2HHHC 5LMUC 2XR1A 1XMOC 4DR7C 1HR0C 3IEVA 1JOSA 2CXCA 2YCBA 4LF7C 4K0KC 2E8CA 3J80D 4JYAC 4DV4C 3JAMD 2ATWA 2KZFA 1K0RA 4X66C 4LFCC 1J5EC 2ZM6C 5FLXD 2HJGA 1HNXC 2D7VA 4B3TC 1XMQC 5IT9D 1WH9A 3CJEA 4DV6C 3R9XA 4X65C 4DV1C 5BR8C 4DR3C 4X62C 4NXNC 2E7GA 3AF5A 3I07A 4LFAC 1XNRC 5A2QD 2UUCC 4GKKC 4LFBC 4NXMC 4AQYC 4LF5C 3GKUA 1VLAA 4B3MC 4DCTA 4YY3C 1HH2P 3T1YC 4DR5C 1HNWC 1N33C 1PA4A 1EGAA 1I94C 2ONFA 3LUSA 1N36C 1N32C 3OTOC 2CY1A 4JI3C 2UU9C 4JI1C 3J7AD 1ZB9A 2PN2A 4OX9C 4LF9C 4JI2C 4DCUA 2UUAC 2DYJA 2VQEC 4DV5C 4DR2C 2OPLA 4LF8C 3IEUA 1L2FA 4YHHC 1WF3A 2QL8A 4X64C 4BSZA 2OPLB 4DUZC 4LF6C 3R9WA 1N34C 4MTNA 4LF4C 1N2FA 3J81D 4GKJC 5LMNC 4JV5C 4DV0C 2EGTA 1USPB 4DR1C 1XNQC 4JI6C 4JI8C 5IWAC 1UKKA 2VQFC 4B3SC 4B3RC 2BJOA 2E8EA 3T1HC 4MH4A 2E5LC 4JI7C 2UXCC 2UUBC 4NOZA 1IBMC 4DCSA 4KHPC 2UXDC 1KKGA 1IBLC 4DV3C 3AF6A 1HNZC 2ASBA 2JMPA
chains in the Genus database with same CATH superfamily
2P2JA 1O93A 1IBKC 2E8FA 4XX2A 2V7BA 4DUYC 3E7XA 4DCVA 2DHMA 4JI5C 1P4EC 2P2BA 1LQLA 1ZB8A 1NY8A 3UX2A 1NYEA 5DV9A 5LMUC 3IEVA 1JOSA 1WCJA 2E8CA 3J80D 2P2MA 3A9UA 4LFCC 2QVYX 4HPVA 2D27A 1V26A 5LCIA 2Y27A 3LNOA 4DV6C 3R9XA 4DV1C 2DPLA 4PROC 2QVZX 4DG8A 4LFAC 1XNRC 3R44A 3GKUA 1VLAA 4B3MC 4DCTA 4U5YD 3PBKA 2PROA 4FUTA 5K85A 3FCCA 3CQ2A 2QW0X 4JM1A 4OYCA 1N36C 2CY1A 1GPMA 2P02A 5T8TA 4EATA 4DCUA 2UUAC 1IB8A 2QL8A 2OPLB 5BSRA 4LF6C 3A4IA 1MXBA 3PROC 2ZZMA 4FUQA 4JI8C 1UKKA 4B3SC 2KZ0A 1ULTA 1XRBA 2UUBC 3I08A 1KKGA 4DV3C 4ISBA 1RG9A 2ASBA 2P20A 3ETCA 4TPSB 5A1IA 1FJGC 1UWDA 4JI0C 2VSQA 5BSWA 3A9VA 5AE3A 4DR6C 5ADZA 1USPA 2HHHC 4L7IA 4PUHA 1XMOC 1V25A 3IMLA 1HR0C 2YCBA 1RY2A 5T8SA 4K0KC 1YJ7A 3JAMD 2ZZNA 1P7LA 5BSTA 2MMAB 1MD9A 3E7WA 5FLXD 5A19A 2D7VA 4GXRA 5IT9D 4I9FA 3TDEA 3LAXA 1M6XC 1WH9A 5K8FA 3CJEA 3DLPX 4R0MA 4X65C 5IFIA 4DR3C 2NCLA 2E7GA 3N54B 4LFBC 2M5HA 4NXMC 1T5HX 4AQYC 4LF5C 1T5DX 4YY3C 1HH2P 3T1YC 3RV2A 1HNWC 2D1TA 1M6XA 2YWBA 3EQ6A 3OTOC 4I9GA 4DG9A 2VZEA 3A25A 4RM3A 2DYJA 3SO4A 2JNVA 4DV5C 4ODJA 4DR2C 1MDFA 1L2FA 4YHHC 1MXCA 4RM2A 2OBVA 4DUZC 3R9WA 4MTNA 4LF4C 3VNQA 4DV0C 3H2TA 4DR1C 4OXIA 3UOWA 4B3RC 5BUSA 2QVXX 2UXCC 5BSVA 3DAYA 3NYQA 4NOZA 2MCQA 4DCSA 2UXDC 1XS3A 1O9TA 4PZPA 2P2FA 2JMPA 3KXWA 2MM9A 4BCAA 4L4QA 1V60A 5E7QA 4GS5A 3IPLA 4DR4C 4WS9A 2D1QA 2UXBC 3AY0A 1QWIA 1MXAA 5H9UA 4DV2C 3K6RA 4D4IA 3A26A 1MDBA 3UZ0A 2WP0C 5KEIA 4DR7C 4PHTA 2ZTBA 4PUGA 4JYAC 4DV4C 2PG1E 2ATWA 3TQIA 2Y4NA 1XRAA 2HJGA 3UX3A 3CW9A 1XMQC 5AE1A 3PESA 3NI2A 5BSUA 4X62C 3AF5A 1PU1A 3I07A 4WV3A 4GKKC 4L2ZA 1AMUA 3G7SA 4R1LA 1N33C 3O2EA 3VNSA 1EGAA 1I94C 3FM7A 3LGXA 3LUSA 3VNRA 3TR3A 2UU9C 4JI1C 4ZJZA 2PN2A 4D4GA 4JI2C 3CQ1A 3CW8X 2OPLA 4IZ6A 3IEUA 1QM4A 4BSZA 2OO4A 3B7WA 4G37A 1N2FA 5LMNC 1USPB 1XNQC 3GPCA 4RLFA 5IWAC 1LCIA 3TUFA 2VQFC 2E8EA 3T1HC 2Y4OA 5BUQA 4MH4A 4NDNA 1VEHA 2E5LC 4JI7C 1P4EA 1IBMC 1IBLC 2M5OA 1HNZC 4DV7C 4D56A 2PT7G 5A1GA 1MKYA 2KDNA 4R1MA 4IR7A 2F4VC 5CZVA 1ML8A 4BC9A 4JI4C 3EERA 2AYAA 1FUGA 3S82A 4BBYA 4RVOA 3DHVA 2YWCA 4K0BA 1BA3A 2BH1X 4RMNA 2XR1A 4KTTA 2CXCA 3NPDA 5BSMA 4KTVA 4LF7C 1O90A 2P2QA 2KZFA 3N2QA 1K0RA 3CQ3A 4X66C 4D57A 1J5EC 2ZM6C 3GR1A 3RG2A 1HNXC 4B3TC 1FLOA 1O92A 3C5EA 5AE2A 1PG3A 5JRHA 5BR8C 1XHJA 1PG4A 4NXNC 4RVNA 2CU6A 3NYRA 3L8CA 5A2QD 2UUCC 4G1IA 4LE5A 4DR5C 4FTFA 4RLQA 1PA4A 5KYTA 2E0GA 5BURA 4BC7A 2ONFA 4G36A 5CZXA 3UEBA 1N32C 4JI3C 5KYVA 3J7AD 1XDXA 1ZB9A 4OX9C 4LF9C 2YX1A 3LNVA 1XRCA 2D28C 5GTDA 3FCEA 2VQEC 1YGTA 4LF8C 1WF3A 4X64C 1N34C 2WD9A 2Z51A 4PUIA 2D1SA 3J81D 4JV5C 4GKJC 2D1RA 2EGTA 4JI6C 3L95X 3ETOA 2BJOA 4ZLPA 3GR0A 1TH5A 4KHPC 4GXQA 3AF6A
chains in the Genus database with same CATH topology
2P2JA 1O93A 1IBKC 2E8FA 4XX2A 2V7BA 4DUYC 3E7XA 4DCVA 4JI5C 2P2BA 1LQLA 1ZB8A 1NYEA 5DV9A 5LMUC 3IEVA 1JOSA 2E8CA 3J80D 2P2MA 3A9UA 4LFCC 2QVYX 4HPVA 2D27A 1V26A 2Y27A 4DV6C 3R9XA 4DV1C 2DPLA 4PROC 2QVZX 4DG8A 4LFAC 1XNRC 3R44A 3GKUA 1VLAA 4B3MC 4DCTA 4U5YD 3PBKA 2PROA 4FUTA 5K85A 3FCCA 2QW0X 4JM1A 4OYCA 1N36C 2CY1A 1GPMA 2P02A 5T8TA 4EATA 4DCUA 2UUAC 2QL8A 2OPLB 5BSRA 4LF6C 3A4IA 1MXBA 3PROC 4FUQA 4JI8C 1UKKA 4B3SC 1ULTA 1XRBA 2UUBC 3I08A 1KKGA 4DV3C 4ISBA 1RG9A 2ASBA 2P20A 3ETCA 4TPSB 5A1IA 1FJGC 4JI0C 2VSQA 5BSWA 3A9VA 5AE3A 4DR6C 5ADZA 1USPA 2HHHC 4L7IA 1XMOC 1V25A 3IMLA 1HR0C 2YCBA 1RY2A 5T8SA 4K0KC 1YJ7A 3JAMD 1P7LA 5BSTA 1MD9A 3E7WA 5FLXD 5A19A 2D7VA 4GXRA 5IT9D 4I9FA 3TDEA 3LAXA 1WH9A 5K8FA 3CJEA 3DLPX 4R0MA 4X65C 5IFIA 4DR3C 2E7GA 3N54B 4LFBC 4NXMC 4AQYC 1T5HX 4LF5C 1T5DX 4YY3C 1HH2P 3T1YC 3RV2A 1HNWC 2D1TA 2YWBA 3EQ6A 3OTOC 4I9GA 4DG9A 2VZEA 4RM3A 2DYJA 3SO4A 4DV5C 4ODJA 4DR2C 1MDFA 1L2FA 4YHHC 1MXCA 4RM2A 2OBVA 4DUZC 3R9WA 4MTNA 4LF4C 3VNQA 4DV0C 3H2TA 4DR1C 4OXIA 3UOWA 4B3RC 5BUSA 2QVXX 2UXCC 5BSVA 3DAYA 3NYQA 4NOZA 4DCSA 2UXDC 1O9TA 4PZPA 2JMPA 2P2FA 3KXWA 4BCAA 4L4QA 5E7QA 4GS5A 3IPLA 4DR4C 4WS9A 2D1QA 2UXBC 1QWIA 1MXAA 5H9UA 4DV2C 4D4IA 1MDBA 3UZ0A 2WP0C 5KEIA 4DR7C 4PHTA 4JYAC 4DV4C 2ATWA 3TQIA 2Y4NA 1XRAA 2HJGA 3CW9A 1XMQC 3PESA 5AE1A 3NI2A 5BSUA 4X62C 3AF5A 3I07A 4WV3A 4GKKC 4L2ZA 1AMUA 3G7SA 4R1LA 1N33C 3VNSA 1EGAA 1I94C 3LGXA 3LUSA 3VNRA 2UU9C 4JI1C 4ZJZA 2PN2A 4D4GA 4JI2C 3CW8X 2OPLA 4IZ6A 3IEUA 1QM4A 4BSZA 2OO4A 3B7WA 4G37A 1N2FA 5LMNC 1USPB 1XNQC 3GPCA 4RLFA 5IWAC 1LCIA 3TUFA 2VQFC 2E8EA 3T1HC 2Y4OA 5BUQA 4MH4A 4NDNA 2E5LC 4JI7C 1IBMC 1IBLC 1HNZC 4DV7C 4D56A 2PT7G 5A1GA 1MKYA 4R1MA 4IR7A 2F4VC 5CZVA 1ML8A 4BC9A 4JI4C 3EERA 2AYAA 1FUGA 3S82A 4BBYA 4RVOA 3DHVA 2YWCA 4K0BA 1BA3A 2BH1X 4RMNA 2XR1A 4KTTA 2CXCA 3NPDA 5BSMA 4KTVA 4LF7C 1O90A 2P2QA 2KZFA 3N2QA 1K0RA 4X66C 4D57A 1J5EC 2ZM6C 3GR1A 3RG2A 1HNXC 4B3TC 1O92A 3C5EA 5AE2A 1PG3A 5JRHA 5BR8C 1PG4A 4NXNC 4RVNA 3NYRA 3L8CA 5A2QD 2UUCC 4G1IA 4LE5A 4DR5C 4FTFA 4RLQA 1PA4A 5KYTA 2E0GA 5BURA 4BC7A 2ONFA 4G36A 5CZXA 1N32C 4JI3C 5KYVA 3J7AD 1ZB9A 4OX9C 4LF9C 3LNVA 1XRCA 2D28C 5GTDA 3FCEA 2VQEC 4LF8C 1WF3A 4X64C 1N34C 2WD9A 2D1SA 3J81D 4JV5C 4GKJC 2D1RA 2EGTA 4JI6C 3L95X 3ETOA 2BJOA 4ZLPA 3GR0A 4KHPC 4GXQA 3AF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 C;  1FJG C;  2PT7 G;  4JI0 C;  1IBK C;  2E8F A;  4XX2 A;  1MKY A;  4DUY C;  4DCV A;  4DR4 C;  2F4V C;  2UXB C;  4JI5 C;  1ML8 A;  4JI4 C;  3EER A;  1ZB8 A;  1LQL A;  4DR6 C;  1QWI A;  4DV2 C;  1USP A;  1NYE A;  2HHH C;  5LMU C;  2XR1 A;  1XMO C;  4DR7 C;  1HR0 C;  3IEV A;  1JOS A;  2CXC A;  2YCB A;  4LF7 C;  4K0K C;  2E8C A;  3J80 D;  4JYA C;  4DV4 C;  3JAM D;  2ATW A;  2KZF A;  1K0R A;  4X66 C;  4LFC C;  1J5E C;  2ZM6 C;  5FLX D;  2HJG A;  1HNX C;  2D7V A;  4B3T C;  1XMQ C;  5IT9 D;  1WH9 A;  3CJE A;  4DV6 C;  3R9X A;  4X65 C;  4DV1 C;  5BR8 C;  4DR3 C;  4X62 C;  4NXN C;  2E7G A;  3AF5 A;  3I07 A;  4LFA C;  1XNR C;  5A2Q D;  2UUC C;  4GKK C;  4LFB C;  4NXM C;  4AQY C;  4LF5 C;  3GKU A;  1VLA A;  4B3M C;  4DCT A;  4YY3 C;  1HH2 P;  3T1Y C;  4DR5 C;  1HNW C;  1N33 C;  1PA4 A;  1EGA A;  1I94 C;  2ONF A;  3LUS A;  1N36 C;  1N32 C;  3OTO C;  2CY1 A;  4JI3 C;  2UU9 C;  4JI1 C;  3J7A D;  1ZB9 A;  2PN2 A;  4OX9 C;  4LF9 C;  4JI2 C;  4DCU A;  2UUA C;  2DYJ A;  2VQE C;  4DV5 C;  4DR2 C;  2OPL A;  4LF8 C;  3IEU A;  1L2F A;  4YHH C;  1WF3 A;  2QL8 A;  4X64 C;  4BSZ A;  2OPL B;  4DUZ C;  4LF6 C;  3R9W A;  1N34 C;  4MTN A;  4LF4 C;  1N2F A;  3J81 D;  4GKJ C;  5LMN C;  4JV5 C;  4DV0 C;  2EGT A;  1USP B;  4DR1 C;  1XNQ C;  4JI6 C;  4JI8 C;  5IWA C;  1UKK A;  2VQF C;  4B3S C;  4B3R C;  2BJO A;  2E8E A;  3T1H C;  4MH4 A;  2E5L C;  4JI7 C;  2UXC C;  2UUB C;  4NOZ A;  1IBM C;  4DCS A;  4KHP C;  2UXD C;  1KKG A;  1IBL C;  4DV3 C;  3AF6 A;  1HNZ C;  2ASB A;  2JMP A; 
#chains in the Genus database with same CATH topology
 2P2J A;  1O93 A;  1IBK C;  2E8F A;  4XX2 A;  2V7B A;  4DUY C;  3E7X A;  4DCV A;  2DHM A;  4JI5 C;  1P4E C;  2P2B A;  1LQL A;  1ZB8 A;  1NY8 A;  3UX2 A;  1NYE A;  5DV9 A;  5LMU C;  3IEV A;  1JOS A;  1WCJ A;  2E8C A;  3J80 D;  2P2M A;  3A9U A;  4LFC C;  2QVY X;  4HPV A;  2D27 A;  1V26 A;  5LCI A;  2Y27 A;  3LNO A;  4DV6 C;  3R9X A;  4DV1 C;  2DPL A;  4PRO C;  2QVZ X;  4DG8 A;  4LFA C;  1XNR C;  3R44 A;  3GKU A;  1VLA A;  4B3M C;  4DCT A;  4U5Y D;  3PBK A;  2PRO A;  4FUT A;  5K85 A;  3FCC A;  3CQ2 A;  2QW0 X;  4JM1 A;  4OYC A;  1N36 C;  2CY1 A;  1GPM A;  2P02 A;  5T8T A;  4EAT A;  4DCU A;  2UUA C;  1IB8 A;  2QL8 A;  2OPL B;  5BSR A;  4LF6 C;  3A4I A;  1MXB A;  3PRO C;  2ZZM A;  4FUQ A;  4JI8 C;  1UKK A;  4B3S C;  2KZ0 A;  1ULT A;  1XRB A;  2UUB C;  3I08 A;  1KKG A;  4DV3 C;  4ISB A;  1RG9 A;  2ASB A;  2P20 A;  3ETC A;  4TPS B;  5A1I A;  1FJG C;  1UWD A;  4JI0 C;  2VSQ A;  5BSW A;  3A9V A;  5AE3 A;  4DR6 C;  5ADZ A;  1USP A;  2HHH C;  4L7I A;  4PUH A;  1XMO C;  1V25 A;  3IML A;  1HR0 C;  2YCB A;  1RY2 A;  5T8S A;  4K0K C;  1YJ7 A;  3JAM D;  2ZZN A;  1P7L A;  5BST A;  2MMA B;  1MD9 A;  3E7W A;  5FLX D;  5A19 A;  2D7V A;  4GXR A;  5IT9 D;  4I9F A;  3TDE A;  3LAX A;  1M6X C;  1WH9 A;  5K8F A;  3CJE A;  3DLP X;  4R0M A;  4X65 C;  5IFI A;  4DR3 C;  2NCL A;  2E7G A;  3N54 B;  4LFB C;  2M5H A;  4NXM C;  1T5H X;  4AQY C;  4LF5 C;  1T5D X;  4YY3 C;  1HH2 P;  3T1Y C;  3RV2 A;  1HNW C;  2D1T A;  1M6X A;  2YWB A;  3EQ6 A;  3OTO C;  4I9G A;  4DG9 A;  2VZE A;  3A25 A;  4RM3 A;  2DYJ A;  3SO4 A;  2JNV A;  4DV5 C;  4ODJ A;  4DR2 C;  1MDF A;  1L2F A;  4YHH C;  1MXC A;  4RM2 A;  2OBV A;  4DUZ C;  3R9W A;  4MTN A;  4LF4 C;  3VNQ A;  4DV0 C;  3H2T A;  4DR1 C;  4OXI A;  3UOW A;  4B3R C;  5BUS A;  2QVX X;  2UXC C;  5BSV A;  3DAY A;  3NYQ A;  4NOZ A;  2MCQ A;  4DCS A;  2UXD C;  1XS3 A;  1O9T A;  4PZP A;  2P2F A;  2JMP A;  3KXW A;  2MM9 A;  4BCA A;  4L4Q A;  1V60 A;  5E7Q A;  4GS5 A;  3IPL A;  4DR4 C;  4WS9 A;  2D1Q A;  2UXB C;  3AY0 A;  1QWI A;  1MXA A;  5H9U A;  4DV2 C;  3K6R A;  4D4I A;  3A26 A;  1MDB A;  3UZ0 A;  2WP0 C;  5KEI A;  4DR7 C;  4PHT A;  2ZTB A;  4PUG A;  4JYA C;  4DV4 C;  2PG1 E;  2ATW A;  3TQI A;  2Y4N A;  1XRA A;  2HJG A;  3UX3 A;  3CW9 A;  1XMQ C;  5AE1 A;  3PES A;  3NI2 A;  5BSU A;  4X62 C;  3AF5 A;  1PU1 A;  3I07 A;  4WV3 A;  4GKK C;  4L2Z A;  1AMU A;  3G7S A;  4R1L A;  1N33 C;  3O2E A;  3VNS A;  1EGA A;  1I94 C;  3FM7 A;  3LGX A;  3LUS A;  3VNR A;  3TR3 A;  2UU9 C;  4JI1 C;  4ZJZ A;  2PN2 A;  4D4G A;  4JI2 C;  3CQ1 A;  3CW8 X;  2OPL A;  4IZ6 A;  3IEU A;  1QM4 A;  4BSZ A;  2OO4 A;  3B7W A;  4G37 A;  1N2F A;  5LMN C;  1USP B;  1XNQ C;  3GPC A;  4RLF A;  5IWA C;  1LCI A;  3TUF A;  2VQF C;  2E8E A;  3T1H C;  2Y4O A;  5BUQ A;  4MH4 A;  4NDN A;  1VEH A;  2E5L C;  4JI7 C;  1P4E A;  1IBM C;  1IBL C;  2M5O A;  1HNZ C;  4DV7 C;  4D56 A;  2PT7 G;  5A1G A;  1MKY A;  2KDN A;  4R1M A;  4IR7 A;  2F4V C;  5CZV A;  1ML8 A;  4BC9 A;  4JI4 C;  3EER A;  2AYA A;  1FUG A;  3S82 A;  4BBY A;  4RVO A;  3DHV A;  2YWC A;  4K0B A;  1BA3 A;  2BH1 X;  4RMN A;  2XR1 A;  4KTT A;  2CXC A;  3NPD A;  5BSM A;  4KTV A;  4LF7 C;  1O90 A;  2P2Q A;  2KZF A;  3N2Q A;  1K0R A;  3CQ3 A;  4X66 C;  4D57 A;  1J5E C;  2ZM6 C;  3GR1 A;  3RG2 A;  1HNX C;  4B3T C;  1FLO A;  1O92 A;  3C5E A;  5AE2 A;  1PG3 A;  5JRH A;  5BR8 C;  1XHJ A;  1PG4 A;  4NXN C;  4RVN A;  2CU6 A;  3NYR A;  3L8C A;  5A2Q D;  2UUC C;  4G1I A;  4LE5 A;  4DR5 C;  4FTF A;  4RLQ A;  1PA4 A;  5KYT A;  2E0G A;  5BUR A;  4BC7 A;  2ONF A;  4G36 A;  5CZX A;  3UEB A;  1N32 C;  4JI3 C;  5KYV A;  3J7A D;  1XDX A;  1ZB9 A;  4OX9 C;  4LF9 C;  2YX1 A;  3LNV A;  1XRC A;  2D28 C;  5GTD A;  3FCE A;  2VQE C;  1YGT A;  4LF8 C;  1WF3 A;  4X64 C;  1N34 C;  2WD9 A;  2Z51 A;  4PUI A;  2D1S A;  3J81 D;  4JV5 C;  4GKJ C;  2D1R A;  2EGT A;  4JI6 C;  3L95 X;  3ETO A;  2BJO A;  4ZLP A;  3GR0 A;  1TH5 A;  4KHP C;  4GXQ A;  3AF6 A; 
#chains in the Genus database with same CATH homology
 2P2J A;  1O93 A;  1IBK C;  2E8F A;  4XX2 A;  2V7B A;  4DUY C;  3E7X A;  4DCV A;  4JI5 C;  2P2B A;  1LQL A;  1ZB8 A;  1NYE A;  5DV9 A;  5LMU C;  3IEV A;  1JOS A;  2E8C A;  3J80 D;  2P2M A;  3A9U A;  4LFC C;  2QVY X;  4HPV A;  2D27 A;  1V26 A;  2Y27 A;  4DV6 C;  3R9X A;  4DV1 C;  2DPL A;  4PRO C;  2QVZ X;  4DG8 A;  4LFA C;  1XNR C;  3R44 A;  3GKU A;  1VLA A;  4B3M C;  4DCT A;  4U5Y D;  3PBK A;  2PRO A;  4FUT A;  5K85 A;  3FCC A;  2QW0 X;  4JM1 A;  4OYC A;  1N36 C;  2CY1 A;  1GPM A;  2P02 A;  5T8T A;  4EAT A;  4DCU A;  2UUA C;  2QL8 A;  2OPL B;  5BSR A;  4LF6 C;  3A4I A;  1MXB A;  3PRO C;  4FUQ A;  4JI8 C;  1UKK A;  4B3S C;  1ULT A;  1XRB A;  2UUB C;  3I08 A;  1KKG A;  4DV3 C;  4ISB A;  1RG9 A;  2ASB A;  2P20 A;  3ETC A;  4TPS B;  5A1I A;  1FJG C;  4JI0 C;  2VSQ A;  5BSW A;  3A9V A;  5AE3 A;  4DR6 C;  5ADZ A;  1USP A;  2HHH C;  4L7I A;  1XMO C;  1V25 A;  3IML A;  1HR0 C;  2YCB A;  1RY2 A;  5T8S A;  4K0K C;  1YJ7 A;  3JAM D;  1P7L A;  5BST A;  1MD9 A;  3E7W A;  5FLX D;  5A19 A;  2D7V A;  4GXR A;  5IT9 D;  4I9F A;  3TDE A;  3LAX A;  1WH9 A;  5K8F A;  3CJE A;  3DLP X;  4R0M A;  4X65 C;  5IFI A;  4DR3 C;  2E7G A;  3N54 B;  4LFB C;  4NXM C;  4AQY C;  1T5H X;  4LF5 C;  1T5D X;  4YY3 C;  1HH2 P;  3T1Y C;  3RV2 A;  1HNW C;  2D1T A;  2YWB A;  3EQ6 A;  3OTO C;  4I9G A;  4DG9 A;  2VZE A;  4RM3 A;  2DYJ A;  3SO4 A;  4DV5 C;  4ODJ A;  4DR2 C;  1MDF A;  1L2F A;  4YHH C;  1MXC A;  4RM2 A;  2OBV A;  4DUZ C;  3R9W A;  4MTN A;  4LF4 C;  3VNQ A;  4DV0 C;  3H2T A;  4DR1 C;  4OXI A;  3UOW A;  4B3R C;  5BUS A;  2QVX X;  2UXC C;  5BSV A;  3DAY A;  3NYQ A;  4NOZ A;  4DCS A;  2UXD C;  1O9T A;  4PZP A;  2JMP A;  2P2F A;  3KXW A;  4BCA A;  4L4Q A;  5E7Q A;  4GS5 A;  3IPL A;  4DR4 C;  4WS9 A;  2D1Q A;  2UXB C;  1QWI A;  1MXA A;  5H9U A;  4DV2 C;  4D4I A;  1MDB A;  3UZ0 A;  2WP0 C;  5KEI A;  4DR7 C;  4PHT A;  4JYA C;  4DV4 C;  2ATW A;  3TQI A;  2Y4N A;  1XRA A;  2HJG A;  3CW9 A;  1XMQ C;  3PES A;  5AE1 A;  3NI2 A;  5BSU A;  4X62 C;  3AF5 A;  3I07 A;  4WV3 A;  4GKK C;  4L2Z A;  1AMU A;  3G7S A;  4R1L A;  1N33 C;  3VNS A;  1EGA A;  1I94 C;  3LGX A;  3LUS A;  3VNR A;  2UU9 C;  4JI1 C;  4ZJZ A;  2PN2 A;  4D4G A;  4JI2 C;  3CW8 X;  2OPL A;  4IZ6 A;  3IEU A;  1QM4 A;  4BSZ A;  2OO4 A;  3B7W A;  4G37 A;  1N2F A;  5LMN C;  1USP B;  1XNQ C;  3GPC A;  4RLF A;  5IWA C;  1LCI A;  3TUF A;  2VQF C;  2E8E A;  3T1H C;  2Y4O A;  5BUQ A;  4MH4 A;  4NDN A;  2E5L C;  4JI7 C;  1IBM C;  1IBL C;  1HNZ C;  4DV7 C;  4D56 A;  2PT7 G;  5A1G A;  1MKY A;  4R1M A;  4IR7 A;  2F4V C;  5CZV A;  1ML8 A;  4BC9 A;  4JI4 C;  3EER A;  2AYA A;  1FUG A;  3S82 A;  4BBY A;  4RVO A;  3DHV A;  2YWC A;  4K0B A;  1BA3 A;  2BH1 X;  4RMN A;  2XR1 A;  4KTT A;  2CXC A;  3NPD A;  5BSM A;  4KTV A;  4LF7 C;  1O90 A;  2P2Q A;  2KZF A;  3N2Q A;  1K0R A;  4X66 C;  4D57 A;  1J5E C;  2ZM6 C;  3GR1 A;  3RG2 A;  1HNX C;  4B3T C;  1O92 A;  3C5E A;  5AE2 A;  1PG3 A;  5JRH A;  5BR8 C;  1PG4 A;  4NXN C;  4RVN A;  3NYR A;  3L8C A;  5A2Q D;  2UUC C;  4G1I A;  4LE5 A;  4DR5 C;  4FTF A;  4RLQ A;  1PA4 A;  5KYT A;  2E0G A;  5BUR A;  4BC7 A;  2ONF A;  4G36 A;  5CZX A;  1N32 C;  4JI3 C;  5KYV A;  3J7A D;  1ZB9 A;  4OX9 C;  4LF9 C;  3LNV A;  1XRC A;  2D28 C;  5GTD A;  3FCE A;  2VQE C;  4LF8 C;  1WF3 A;  4X64 C;  1N34 C;  2WD9 A;  2D1S A;  3J81 D;  4JV5 C;  4GKJ C;  2D1R A;  2EGT A;  4JI6 C;  3L95 X;  3ETO A;  2BJO A;  4ZLP A;  3GR0 A;  4KHP C;  4GXQ A;  3AF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...