2E5LC

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e5lC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2e5lC02
4DCSA 2BJOA 1N2FA 4DCUA 4DV2C 4GKKC 3J81D 1UKKA 4LFAC 3R9WA 2XR1A 4DV6C 2QL8A 5LMNC 4X65C 1NYEA 2D7VA 5FLXD 2UUBC 3CJEA 4DUZC 1N33C 2PN2A 4AQYC 5A2QD 3T1YC 3J7AD 4JI4C 2HJGA 4JI1C 1XMQC 4LF5C 1EGAA 1N34C 3IEUA 3JAMD 1IBMC 2ZM6C 4LF4C 3IEVA 1WH9A 1I94C 4DR7C 4JYAC 4B3SC 4JI2C 5BR8C 4YHHC 1XNRC 2YCBA 4NXMC 2UXDC 2ASBA 5IWAC 2CXCA 2UUCC 1QWIA 1KKGA 1ZB9A 2ONFA 1K0RA 2E8EA 4JI3C 1USPB 1ML8A 4XX2A 4DV1C 4BSZA 1HNXC 4MTNA 4DV7C 4X62C 4JI6C 1HR0C 4JI8C 1HNWC 3J80D 1IBKC 4DUYC 4DR6C 2JMPA 4JV5C 4JI7C 2EGTA 4LF8C 2VQFC 3AF6A 4B3TC 4DV4C 4LF6C 1HH2P 4MH4A 5IT9D 4DR2C 1J5EC 4GKJC 1ZB8A 1L2FA 4DR5C 3GKUA 2PT7G 2DYJA 4B3MC 2E5LC 3T1HC 4DR1C 2HHHC 4LF9C 4K0KC 5LMUC 4DV3C 3AF5A 2UXBC 1VLAA 3LUSA 1XMOC 2F4VC 4NOZA 2CY1A 2ATWA 2KZFA 4KHPC 4DCTA 3I07A 4LFBC 4JI0C 2OPLA 1WF3A 4DV5C 4JI5C 2E8CA 1HNZC 4LF7C 4OX9C 1IBLC 4DR4C 4DR3C 3R9XA 2UUAC 3EERA 1PA4A 4NXNC 1FJGC 1MKYA 1XNQC 1N36C 4DV0C 4X66C 4YY3C 1JOSA 4B3RC 4X64C 2OPLB 4LFCC 2E8FA 2E7GA 3OTOC 2UXCC 4DCVA 2VQEC 1USPA 1LQLA 2UU9C 1N32C
chains in the Genus database with same CATH superfamily
4DCUA 4DV2C 2QW0X 4LFAC 4L4QA 2QL8A 5LMNC 5FLXD 2UUBC 4GXQA 4DUZC 4RMNA 4LF5C 1EGAA 3JAMD 2OBVA 4JI2C 4NXMC 2UXDC 4OXIA 2M5HA 3UX2A 4D4IA 2CXCA 4DG9A 1ZB9A 2ONFA 5LCIA 5JRHA 5K8FA 2Y27A 4DV7C 4GS5A 4JI8C 3LNVA 3TR3A 2JNVA 2CU6A 4LF8C 5A1GA 2VQFC 2D1QA 4DV4C 4D4GA 4LE5A 3O2EA 5BSMA 3RG2A 3PESA 3CQ1A 1P7LA 4I9FA 5T8SA 1MXBA 2Z51A 4B3MC 4ODJA 3IMLA 3T1HC 2HHHC 4K0KC 1O93A 4PROC 2VSQA 3AF5A 4FUQA 1VLAA 2Y4OA 3LUSA 3TUFA 2ATWA 2KZFA 3IPLA 4KHPC 4LFBC 1V26A 1O92A 4WS9A 3VNRA 4DV5C 4OX9C 1PG4A 4ZLPA 3R9XA 2WD9A 1XHJA 2P2BA 1MKYA 4DV0C 4X66C 4X64C 4D56A 2E0GA 1LQLA 2YWBA 4NDNA 2UU9C 2BJOA 1MD9A 1O90A 2VZEA 3FM7A 3R9WA 1T5DX 4PUIA 3RV2A 1NYEA 2D7VA 4L2ZA 1RG9A 3K6RA 4JI4C 5CZVA 5AE1A 1V60A 2ZM6C 3UX3A 1M6XC 4IR7A 3IEVA 4DR7C 4B3SC 4RLFA 5IFIA 5BR8C 1P4EC 5BSTA 5IWAC 1QWIA 1KKGA 2ZTBA 1K0RA 2KZ0A 1ML8A 1GPMA 4BSZA 1V25A 3PROC 1NY8A 4BC9A 1HNWC 1FLOA 1IBKC 3DAYA 3VNQA 3LGXA 4JI7C 3UOWA 2D1SA 2V7BA 1MXCA 2ZZNA 3AF6A 4B3TC 2QVXX 3CQ3A 1HH2P 4LF6C 5BUQA 2D1TA 1UWDA 1ZB8A 5ADZA 4RVNA 5T8TA 4K0BA 2DYJA 3A9UA 5BSRA 4HPVA 4DR1C 5BUSA 2KDNA 4DV3C 2YX1A 5BSUA 4OYCA 2F4VC 2DPLA 2CY1A 2AYAA 1MDFA 3A25A 4R1LA 5E7QA 5AE3A 3A9VA 3FCEA 1WF3A 3B7WA 4JI5C 1HNZC 4DR4C 4DR3C 1XS3A 2P2MA 1N36C 1JOSA 1M6XA 5CZXA 4BBYA 4G36A 2OPLB 4LFCC 5KYTA 2E8FA 2UXCC 2VQEC 4BCAA 2D27A 4DCSA 1N2FA 3NYRA 4GKKC 3J81D 1UKKA 4TPSB 2XR1A 4DG8A 3CJEA 1N33C 2PN2A 3NPDA 4GXRA 4JI1C 5KEIA 5BURA 3LAXA 4FTFA 4LF4C 1FUGA 2PROA 3R44A 4WV3A 1XNRC 1AMUA 2YCBA 1XDXA 3L8CA 3LNOA 5DV9A 3S82A 3H2TA 1XRBA 2E8EA 4XX2A 4PUGA 3ETOA 1MXAA 5A19A 4X62C 4ZJZA 4JI6C 3GR0A 3C5EA 3J80D 4DUYC 2Y4NA 4DR6C 4JV5C 1TH5A 2D1RA 1PG3A 4BC7A 3UEBA 4KTTA 2WP0C 3FCCA 4IZ6A 3SO4A 3VNSA 4DR2C 2YWCA 5KYVA 3EQ6A 3E7WA 3GKUA 1YJ7A 3A4IA 2E5LC 4LF9C 5LMUC 3N54B 3KXWA 2UXBC 4L7IA 3A26A 2P2QA 4KTVA 1XMOC 5H9UA 1XRAA 2MM9A 4RM2A 4DCTA 1VEHA 3I07A 3N2QA 2P2JA 5BSVA 1T5HX 2OPLA 2E8CA 1PA4A 4NXNC 1FJGC 2P2FA 4B3RC 3OTOC 4DCVA 1USPA 4PUHA 1WCJA 3G7SA 3DLPX 3CW8X 4RVOA 4FUTA 4G1IA 4DV6C 5GTDA 4X65C 5K85A 4PHTA 2MMAB 4R1MA 4AQYC 5A2QD 3T1YC 1YGTA 3J7AD 2HJGA 1XMQC 1N34C 3IEUA 3DHVA 1IBMC 1IB8A 3L95X 1LCIA 4EATA 1WH9A 1I94C 2P02A 1P4EA 4JYAC 4YHHC 2BH1X 3UZ0A 2QVYX 2ASBA 2OO4A 2UUCC 1BA3A 4JI3C 1USPB 4DV1C 3PBKA 4MTNA 1HNXC 4RLQA 1HR0C 1RY2A 2NCLA 2JMPA 1QM4A 2MCQA 3NYQA 2EGTA 1MDBA 5A1IA 2PG1E 3TQIA 3GR1A 1ULTA 4ISBA 4MH4A 5IT9D 4R0MA 1J5EC 4I9GA 4GKJC 1L2FA 3CQ2A 2P20A 4G37A 4DR5C 2PT7G 3GPCA 5AE2A 3CW9A 4PZPA 4NOZA 1O9TA 2ZZMA 4JI0C 2D28C 2M5OA 4LF7C 1IBLC 2QVZX 4JM1A 3TDEA 3EERA 4D57A 2UUAC 3E7XA 5BSWA 3ETCA 4U5YD 1XNQC 3NI2A 4YY3C 1PU1A 3I08A 2E7GA 4RM3A 2DHMA 1N32C 3AY0A 1XRCA
chains in the Genus database with same CATH topology
4DCUA 4DV2C 2QW0X 4LFAC 4L4QA 2QL8A 5LMNC 5FLXD 2UUBC 4GXQA 4DUZC 4RMNA 4LF5C 1EGAA 3JAMD 2OBVA 4JI2C 4NXMC 2UXDC 4OXIA 4D4IA 2CXCA 4DG9A 1ZB9A 2ONFA 5JRHA 5K8FA 2Y27A 4DV7C 4GS5A 4JI8C 3LNVA 4LF8C 5A1GA 2VQFC 2D1QA 4DV4C 4D4GA 4LE5A 5BSMA 3RG2A 3PESA 1P7LA 4I9FA 5T8SA 1MXBA 4B3MC 4ODJA 3IMLA 3T1HC 2HHHC 4K0KC 1O93A 4PROC 2VSQA 3AF5A 4FUQA 1VLAA 2Y4OA 3LUSA 3TUFA 2ATWA 2KZFA 3IPLA 4KHPC 4LFBC 1V26A 1O92A 4WS9A 3VNRA 4DV5C 4OX9C 1PG4A 4ZLPA 3R9XA 2WD9A 2P2BA 1MKYA 4DV0C 4X66C 4X64C 4D56A 2E0GA 1LQLA 2YWBA 4NDNA 2UU9C 2BJOA 1MD9A 1O90A 2VZEA 3R9WA 1T5DX 3RV2A 1NYEA 2D7VA 4L2ZA 1RG9A 4JI4C 5CZVA 5AE1A 2ZM6C 4IR7A 3IEVA 4DR7C 4B3SC 4RLFA 5IFIA 5BR8C 5BSTA 5IWAC 1QWIA 1KKGA 1K0RA 1ML8A 1GPMA 4BSZA 1V25A 3PROC 4BC9A 1HNWC 1IBKC 3DAYA 3VNQA 3LGXA 4JI7C 3UOWA 2D1SA 2V7BA 1MXCA 3AF6A 4B3TC 2QVXX 4LF6C 1HH2P 5BUQA 2D1TA 1ZB8A 5ADZA 4RVNA 5T8TA 4K0BA 2DYJA 3A9UA 5BSRA 4HPVA 4DR1C 5BUSA 4DV3C 5BSUA 4OYCA 2F4VC 2DPLA 2CY1A 2AYAA 1MDFA 4R1LA 5E7QA 5AE3A 3A9VA 3FCEA 1WF3A 3B7WA 4JI5C 1HNZC 4DR4C 4DR3C 2P2MA 1N36C 1JOSA 5CZXA 4BBYA 4G36A 2OPLB 4LFCC 5KYTA 2E8FA 2UXCC 2VQEC 4BCAA 2D27A 4DCSA 1N2FA 3NYRA 4GKKC 3J81D 1UKKA 4TPSB 2XR1A 4DG8A 3CJEA 1N33C 2PN2A 3NPDA 4GXRA 4JI1C 5KEIA 5BURA 3LAXA 4FTFA 4LF4C 1FUGA 2PROA 3R44A 4WV3A 1XNRC 1AMUA 2YCBA 3L8CA 5DV9A 3S82A 3H2TA 1XRBA 2E8EA 4XX2A 3ETOA 1MXAA 5A19A 4X62C 4ZJZA 4JI6C 3GR0A 3C5EA 3J80D 4DUYC 2Y4NA 4DR6C 4JV5C 2D1RA 1PG3A 4BC7A 4KTTA 2WP0C 3FCCA 4IZ6A 3SO4A 3VNSA 4DR2C 2YWCA 5KYVA 3EQ6A 3E7WA 3GKUA 1YJ7A 3A4IA 2E5LC 4LF9C 5LMUC 3N54B 3KXWA 2UXBC 4L7IA 2P2QA 4KTVA 1XMOC 5H9UA 1XRAA 4RM2A 4DCTA 3I07A 3N2QA 2P2JA 5BSVA 1T5HX 2OPLA 2E8CA 1PA4A 4NXNC 1FJGC 2P2FA 4B3RC 3OTOC 4DCVA 1USPA 3G7SA 3DLPX 3CW8X 4RVOA 4FUTA 4G1IA 4DV6C 5GTDA 4X65C 5K85A 4PHTA 4R1MA 4AQYC 5A2QD 3T1YC 3J7AD 2HJGA 1XMQC 1N34C 3IEUA 3DHVA 1IBMC 3L95X 1LCIA 4EATA 1WH9A 1I94C 2P02A 4JYAC 4YHHC 2BH1X 3UZ0A 2QVYX 2ASBA 2OO4A 2UUCC 1BA3A 4JI3C 1USPB 4DV1C 3PBKA 4MTNA 1HNXC 4RLQA 1HR0C 1RY2A 2JMPA 1QM4A 3NYQA 2EGTA 1MDBA 5A1IA 3TQIA 3GR1A 1ULTA 4ISBA 4MH4A 5IT9D 4R0MA 1J5EC 4I9GA 4GKJC 1L2FA 4G37A 2P20A 4DR5C 2PT7G 3GPCA 5AE2A 3CW9A 4PZPA 4NOZA 1O9TA 4JI0C 2D28C 4LF7C 1IBLC 2QVZX 4JM1A 3TDEA 3EERA 4D57A 2UUAC 3E7XA 5BSWA 3ETCA 4U5YD 1XNQC 3NI2A 4YY3C 3I08A 2E7GA 4RM3A 1N32C 1XRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCS A;  2BJO A;  1N2F A;  4DCU A;  4DV2 C;  4GKK C;  3J81 D;  1UKK A;  4LFA C;  3R9W A;  2XR1 A;  4DV6 C;  2QL8 A;  5LMN C;  4X65 C;  1NYE A;  2D7V A;  5FLX D;  2UUB C;  3CJE A;  4DUZ C;  1N33 C;  2PN2 A;  4AQY C;  5A2Q D;  3T1Y C;  3J7A D;  4JI4 C;  2HJG A;  4JI1 C;  1XMQ C;  4LF5 C;  1EGA A;  1N34 C;  3IEU A;  3JAM D;  1IBM C;  2ZM6 C;  4LF4 C;  3IEV A;  1WH9 A;  1I94 C;  4DR7 C;  4JYA C;  4B3S C;  4JI2 C;  5BR8 C;  4YHH C;  1XNR C;  2YCB A;  4NXM C;  2UXD C;  2ASB A;  5IWA C;  2CXC A;  2UUC C;  1QWI A;  1KKG A;  1ZB9 A;  2ONF A;  1K0R A;  2E8E A;  4JI3 C;  1USP B;  1ML8 A;  4XX2 A;  4DV1 C;  4BSZ A;  1HNX C;  4MTN A;  4DV7 C;  4X62 C;  4JI6 C;  1HR0 C;  4JI8 C;  1HNW C;  3J80 D;  1IBK C;  4DUY C;  4DR6 C;  2JMP A;  4JV5 C;  4JI7 C;  2EGT A;  4LF8 C;  2VQF C;  3AF6 A;  4B3T C;  4DV4 C;  4LF6 C;  1HH2 P;  4MH4 A;  5IT9 D;  4DR2 C;  1J5E C;  4GKJ C;  1ZB8 A;  1L2F A;  4DR5 C;  3GKU A;  2PT7 G;  2DYJ A;  4B3M C;  2E5L C;  3T1H C;  4DR1 C;  2HHH C;  4LF9 C;  4K0K C;  5LMU C;  4DV3 C;  3AF5 A;  2UXB C;  1VLA A;  3LUS A;  1XMO C;  2F4V C;  4NOZ A;  2CY1 A;  2ATW A;  2KZF A;  4KHP C;  4DCT A;  3I07 A;  4LFB C;  4JI0 C;  2OPL A;  1WF3 A;  4DV5 C;  4JI5 C;  2E8C A;  1HNZ C;  4LF7 C;  4OX9 C;  1IBL C;  4DR4 C;  4DR3 C;  3R9X A;  2UUA C;  3EER A;  1PA4 A;  4NXN C;  1FJG C;  1MKY A;  1XNQ C;  1N36 C;  4DV0 C;  4X66 C;  4YY3 C;  1JOS A;  4B3R C;  4X64 C;  2OPL B;  4LFC C;  2E8F A;  2E7G A;  3OTO C;  2UXC C;  4DCV A;  2VQE C;  1USP A;  1LQL A;  2UU9 C;  1N32 C; 
#chains in the Genus database with same CATH topology
 4DCU A;  4DV2 C;  2QW0 X;  4LFA C;  4L4Q A;  2QL8 A;  5LMN C;  5FLX D;  2UUB C;  4GXQ A;  4DUZ C;  4RMN A;  4LF5 C;  1EGA A;  3JAM D;  2OBV A;  4JI2 C;  4NXM C;  2UXD C;  4OXI A;  2M5H A;  3UX2 A;  4D4I A;  2CXC A;  4DG9 A;  1ZB9 A;  2ONF A;  5LCI A;  5JRH A;  5K8F A;  2Y27 A;  4DV7 C;  4GS5 A;  4JI8 C;  3LNV A;  3TR3 A;  2JNV A;  2CU6 A;  4LF8 C;  5A1G A;  2VQF C;  2D1Q A;  4DV4 C;  4D4G A;  4LE5 A;  3O2E A;  5BSM A;  3RG2 A;  3PES A;  3CQ1 A;  1P7L A;  4I9F A;  5T8S A;  1MXB A;  2Z51 A;  4B3M C;  4ODJ A;  3IML A;  3T1H C;  2HHH C;  4K0K C;  1O93 A;  4PRO C;  2VSQ A;  3AF5 A;  4FUQ A;  1VLA A;  2Y4O A;  3LUS A;  3TUF A;  2ATW A;  2KZF A;  3IPL A;  4KHP C;  4LFB C;  1V26 A;  1O92 A;  4WS9 A;  3VNR A;  4DV5 C;  4OX9 C;  1PG4 A;  4ZLP A;  3R9X A;  2WD9 A;  1XHJ A;  2P2B A;  1MKY A;  4DV0 C;  4X66 C;  4X64 C;  4D56 A;  2E0G A;  1LQL A;  2YWB A;  4NDN A;  2UU9 C;  2BJO A;  1MD9 A;  1O90 A;  2VZE A;  3FM7 A;  3R9W A;  1T5D X;  4PUI A;  3RV2 A;  1NYE A;  2D7V A;  4L2Z A;  1RG9 A;  3K6R A;  4JI4 C;  5CZV A;  5AE1 A;  1V60 A;  2ZM6 C;  3UX3 A;  1M6X C;  4IR7 A;  3IEV A;  4DR7 C;  4B3S C;  4RLF A;  5IFI A;  5BR8 C;  1P4E C;  5BST A;  5IWA C;  1QWI A;  1KKG A;  2ZTB A;  1K0R A;  2KZ0 A;  1ML8 A;  1GPM A;  4BSZ A;  1V25 A;  3PRO C;  1NY8 A;  4BC9 A;  1HNW C;  1FLO A;  1IBK C;  3DAY A;  3VNQ A;  3LGX A;  4JI7 C;  3UOW A;  2D1S A;  2V7B A;  1MXC A;  2ZZN A;  3AF6 A;  4B3T C;  2QVX X;  3CQ3 A;  1HH2 P;  4LF6 C;  5BUQ A;  2D1T A;  1UWD A;  1ZB8 A;  5ADZ A;  4RVN A;  5T8T A;  4K0B A;  2DYJ A;  3A9U A;  5BSR A;  4HPV A;  4DR1 C;  5BUS A;  2KDN A;  4DV3 C;  2YX1 A;  5BSU A;  4OYC A;  2F4V C;  2DPL A;  2CY1 A;  2AYA A;  1MDF A;  3A25 A;  4R1L A;  5E7Q A;  5AE3 A;  3A9V A;  3FCE A;  1WF3 A;  3B7W A;  4JI5 C;  1HNZ C;  4DR4 C;  4DR3 C;  1XS3 A;  2P2M A;  1N36 C;  1JOS A;  1M6X A;  5CZX A;  4BBY A;  4G36 A;  2OPL B;  4LFC C;  5KYT A;  2E8F A;  2UXC C;  2VQE C;  4BCA A;  2D27 A;  4DCS A;  1N2F A;  3NYR A;  4GKK C;  3J81 D;  1UKK A;  4TPS B;  2XR1 A;  4DG8 A;  3CJE A;  1N33 C;  2PN2 A;  3NPD A;  4GXR A;  4JI1 C;  5KEI A;  5BUR A;  3LAX A;  4FTF A;  4LF4 C;  1FUG A;  2PRO A;  3R44 A;  4WV3 A;  1XNR C;  1AMU A;  2YCB A;  1XDX A;  3L8C A;  3LNO A;  5DV9 A;  3S82 A;  3H2T A;  1XRB A;  2E8E A;  4XX2 A;  4PUG A;  3ETO A;  1MXA A;  5A19 A;  4X62 C;  4ZJZ A;  4JI6 C;  3GR0 A;  3C5E A;  3J80 D;  4DUY C;  2Y4N A;  4DR6 C;  4JV5 C;  1TH5 A;  2D1R A;  1PG3 A;  4BC7 A;  3UEB A;  4KTT A;  2WP0 C;  3FCC A;  4IZ6 A;  3SO4 A;  3VNS A;  4DR2 C;  2YWC A;  5KYV A;  3EQ6 A;  3E7W A;  3GKU A;  1YJ7 A;  3A4I A;  2E5L C;  4LF9 C;  5LMU C;  3N54 B;  3KXW A;  2UXB C;  4L7I A;  3A26 A;  2P2Q A;  4KTV A;  1XMO C;  5H9U A;  1XRA A;  2MM9 A;  4RM2 A;  4DCT A;  1VEH A;  3I07 A;  3N2Q A;  2P2J A;  5BSV A;  1T5H X;  2OPL A;  2E8C A;  1PA4 A;  4NXN C;  1FJG C;  2P2F A;  4B3R C;  3OTO C;  4DCV A;  1USP A;  4PUH A;  1WCJ A;  3G7S A;  3DLP X;  3CW8 X;  4RVO A;  4FUT A;  4G1I A;  4DV6 C;  5GTD A;  4X65 C;  5K85 A;  4PHT A;  2MMA B;  4R1M A;  4AQY C;  5A2Q D;  3T1Y C;  1YGT A;  3J7A D;  2HJG A;  1XMQ C;  1N34 C;  3IEU A;  3DHV A;  1IBM C;  1IB8 A;  3L95 X;  1LCI A;  4EAT A;  1WH9 A;  1I94 C;  2P02 A;  1P4E A;  4JYA C;  4YHH C;  2BH1 X;  3UZ0 A;  2QVY X;  2ASB A;  2OO4 A;  2UUC C;  1BA3 A;  4JI3 C;  1USP B;  4DV1 C;  3PBK A;  4MTN A;  1HNX C;  4RLQ A;  1HR0 C;  1RY2 A;  2NCL A;  2JMP A;  1QM4 A;  2MCQ A;  3NYQ A;  2EGT A;  1MDB A;  5A1I A;  2PG1 E;  3TQI A;  3GR1 A;  1ULT A;  4ISB A;  4MH4 A;  5IT9 D;  4R0M A;  1J5E C;  4I9G A;  4GKJ C;  1L2F A;  3CQ2 A;  2P20 A;  4G37 A;  4DR5 C;  2PT7 G;  3GPC A;  5AE2 A;  3CW9 A;  4PZP A;  4NOZ A;  1O9T A;  2ZZM A;  4JI0 C;  2D28 C;  2M5O A;  4LF7 C;  1IBL C;  2QVZ X;  4JM1 A;  3TDE A;  3EER A;  4D57 A;  2UUA C;  3E7X A;  5BSW A;  3ETC A;  4U5Y D;  1XNQ C;  3NI2 A;  4YY3 C;  1PU1 A;  3I08 A;  2E7G A;  4RM3 A;  2DHM A;  1N32 C;  3AY0 A;  1XRC A; 
#chains in the Genus database with same CATH homology
 4DCU A;  4DV2 C;  2QW0 X;  4LFA C;  4L4Q A;  2QL8 A;  5LMN C;  5FLX D;  2UUB C;  4GXQ A;  4DUZ C;  4RMN A;  4LF5 C;  1EGA A;  3JAM D;  2OBV A;  4JI2 C;  4NXM C;  2UXD C;  4OXI A;  4D4I A;  2CXC A;  4DG9 A;  1ZB9 A;  2ONF A;  5JRH A;  5K8F A;  2Y27 A;  4DV7 C;  4GS5 A;  4JI8 C;  3LNV A;  4LF8 C;  5A1G A;  2VQF C;  2D1Q A;  4DV4 C;  4D4G A;  4LE5 A;  5BSM A;  3RG2 A;  3PES A;  1P7L A;  4I9F A;  5T8S A;  1MXB A;  4B3M C;  4ODJ A;  3IML A;  3T1H C;  2HHH C;  4K0K C;  1O93 A;  4PRO C;  2VSQ A;  3AF5 A;  4FUQ A;  1VLA A;  2Y4O A;  3LUS A;  3TUF A;  2ATW A;  2KZF A;  3IPL A;  4KHP C;  4LFB C;  1V26 A;  1O92 A;  4WS9 A;  3VNR A;  4DV5 C;  4OX9 C;  1PG4 A;  4ZLP A;  3R9X A;  2WD9 A;  2P2B A;  1MKY A;  4DV0 C;  4X66 C;  4X64 C;  4D56 A;  2E0G A;  1LQL A;  2YWB A;  4NDN A;  2UU9 C;  2BJO A;  1MD9 A;  1O90 A;  2VZE A;  3R9W A;  1T5D X;  3RV2 A;  1NYE A;  2D7V A;  4L2Z A;  1RG9 A;  4JI4 C;  5CZV A;  5AE1 A;  2ZM6 C;  4IR7 A;  3IEV A;  4DR7 C;  4B3S C;  4RLF A;  5IFI A;  5BR8 C;  5BST A;  5IWA C;  1QWI A;  1KKG A;  1K0R A;  1ML8 A;  1GPM A;  4BSZ A;  1V25 A;  3PRO C;  4BC9 A;  1HNW C;  1IBK C;  3DAY A;  3VNQ A;  3LGX A;  4JI7 C;  3UOW A;  2D1S A;  2V7B A;  1MXC A;  3AF6 A;  4B3T C;  2QVX X;  4LF6 C;  1HH2 P;  5BUQ A;  2D1T A;  1ZB8 A;  5ADZ A;  4RVN A;  5T8T A;  4K0B A;  2DYJ A;  3A9U A;  5BSR A;  4HPV A;  4DR1 C;  5BUS A;  4DV3 C;  5BSU A;  4OYC A;  2F4V C;  2DPL A;  2CY1 A;  2AYA A;  1MDF A;  4R1L A;  5E7Q A;  5AE3 A;  3A9V A;  3FCE A;  1WF3 A;  3B7W A;  4JI5 C;  1HNZ C;  4DR4 C;  4DR3 C;  2P2M A;  1N36 C;  1JOS A;  5CZX A;  4BBY A;  4G36 A;  2OPL B;  4LFC C;  5KYT A;  2E8F A;  2UXC C;  2VQE C;  4BCA A;  2D27 A;  4DCS A;  1N2F A;  3NYR A;  4GKK C;  3J81 D;  1UKK A;  4TPS B;  2XR1 A;  4DG8 A;  3CJE A;  1N33 C;  2PN2 A;  3NPD A;  4GXR A;  4JI1 C;  5KEI A;  5BUR A;  3LAX A;  4FTF A;  4LF4 C;  1FUG A;  2PRO A;  3R44 A;  4WV3 A;  1XNR C;  1AMU A;  2YCB A;  3L8C A;  5DV9 A;  3S82 A;  3H2T A;  1XRB A;  2E8E A;  4XX2 A;  3ETO A;  1MXA A;  5A19 A;  4X62 C;  4ZJZ A;  4JI6 C;  3GR0 A;  3C5E A;  3J80 D;  4DUY C;  2Y4N A;  4DR6 C;  4JV5 C;  2D1R A;  1PG3 A;  4BC7 A;  4KTT A;  2WP0 C;  3FCC A;  4IZ6 A;  3SO4 A;  3VNS A;  4DR2 C;  2YWC A;  5KYV A;  3EQ6 A;  3E7W A;  3GKU A;  1YJ7 A;  3A4I A;  2E5L C;  4LF9 C;  5LMU C;  3N54 B;  3KXW A;  2UXB C;  4L7I A;  2P2Q A;  4KTV A;  1XMO C;  5H9U A;  1XRA A;  4RM2 A;  4DCT A;  3I07 A;  3N2Q A;  2P2J A;  5BSV A;  1T5H X;  2OPL A;  2E8C A;  1PA4 A;  4NXN C;  1FJG C;  2P2F A;  4B3R C;  3OTO C;  4DCV A;  1USP A;  3G7S A;  3DLP X;  3CW8 X;  4RVO A;  4FUT A;  4G1I A;  4DV6 C;  5GTD A;  4X65 C;  5K85 A;  4PHT A;  4R1M A;  4AQY C;  5A2Q D;  3T1Y C;  3J7A D;  2HJG A;  1XMQ C;  1N34 C;  3IEU A;  3DHV A;  1IBM C;  3L95 X;  1LCI A;  4EAT A;  1WH9 A;  1I94 C;  2P02 A;  4JYA C;  4YHH C;  2BH1 X;  3UZ0 A;  2QVY X;  2ASB A;  2OO4 A;  2UUC C;  1BA3 A;  4JI3 C;  1USP B;  4DV1 C;  3PBK A;  4MTN A;  1HNX C;  4RLQ A;  1HR0 C;  1RY2 A;  2JMP A;  1QM4 A;  3NYQ A;  2EGT A;  1MDB A;  5A1I A;  3TQI A;  3GR1 A;  1ULT A;  4ISB A;  4MH4 A;  5IT9 D;  4R0M A;  1J5E C;  4I9G A;  4GKJ C;  1L2F A;  4G37 A;  2P20 A;  4DR5 C;  2PT7 G;  3GPC A;  5AE2 A;  3CW9 A;  4PZP A;  4NOZ A;  1O9T A;  4JI0 C;  2D28 C;  4LF7 C;  1IBL C;  2QVZ X;  4JM1 A;  3TDE A;  3EER A;  4D57 A;  2UUA C;  3E7X A;  5BSW A;  3ETC A;  4U5Y D;  1XNQ C;  3NI2 A;  4YY3 C;  3I08 A;  2E7G A;  4RM3 A;  1N32 C;  1XRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...