4JI8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 57
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji8C02
4B3TC 1N36C 2D7VA 5A2QD 1L2FA 4DV2C 1USPB 4K0KC 4NXMC 1MKYA 3AF5A 4JI4C 4DCSA 3IEVA 3IEUA 2HHHC 1WF3A 2OPLA 1IBMC 1XNRC 4JYAC 4LF7C 4DR1C 4X64C 4JI3C 4DUYC 4KHPC 1IBKC 1I94C 2XR1A 4DCTA 4YY3C 4X65C 1N33C 3OTOC 2ZM6C 2UUCC 4MTNA 4JI2C 4GKKC 2CY1A 1USPA 1VLAA 4DV5C 4DR5C 4JI7C 3J7AD 4DR4C 4GKJC 3I07A 4X66C 2VQEC 4LF8C 4OX9C 4LFCC 3CJEA 2E7GA 2UUAC 2PN2A 3R9XA 2DYJA 1XMOC 1J5EC 2ASBA 1XMQC 2UU9C 4JI8C 4DV1C 1HR0C 5FLXD 4DUZC 4DV4C 2UXDC 1N2FA 4LF4C 4JI5C 1EGAA 1LQLA 1HNZC 4B3SC 2BJOA 4DCUA 4LF5C 3LUSA 4JI1C 2EGTA 2CXCA 2ATWA 1N34C 1XNQC 2UXCC 4DV0C 4B3MC 4DR7C 3R9WA 1NYEA 2E8FA 5LMUC 1HH2P 4XX2A 5IT9D 4X62C 4LF6C 5LMNC 2QL8A 2UXBC 4AQYC 3EERA 4LF9C 1HNWC 1ZB8A 4MH4A 4LFBC 4DR3C 2E5LC 1KKGA 3GKUA 1PA4A 3J80D 2VQFC 4DV7C 2UUBC 4NOZA 4DR2C 5BR8C 2KZFA 4DCVA 4NXNC 1ZB9A 5IWAC 2JMPA 1N32C 4LFAC 4DR6C 1HNXC 2F4VC 2YCBA 3AF6A 2E8EA 4DV6C 2HJGA 2PT7G 4JV5C 1UKKA 1ML8A 1FJGC 4DV3C 4YHHC 4JI6C 2ONFA 4B3RC 1IBLC 1QWIA 2E8CA 1K0RA 3JAMD 2OPLB 3T1HC 3T1YC 4JI0C 3J81D 1JOSA 4BSZA 1WH9A
chains in the Genus database with same CATH superfamily
4DV2C 3UEBA 4K0KC 3NPDA 2OPLA 4OYCA 3TUFA 2D1RA 4JI3C 3DAYA 1N33C 1V60A 1MXCA 4RM2A 4JI2C 4GXQA 1YGTA 3H2TA 3UX2A 2DPLA 4FUQA 3J7AD 4DR4C 4GKJC 4D4GA 1M6XC 2KDNA 3CJEA 4L4QA 2UUAC 5KYVA 1XMOC 1PG3A 1P4EA 1HR0C 5BSTA 4BC7A 4DUZC 4R1LA 4JI5C 1HNZC 4B3SC 2D1SA 4LE5A 5AE1A 2P2FA 4JI1C 5ADZA 2CXCA 3TDEA 5GTDA 1XNQC 4DR7C 4G1IA 2E8FA 5LMUC 1HH2P 4XX2A 4X62C 2UXBC 2BH1X 1XDXA 4LFBC 5T8TA 1O90A 3A26A 1KKGA 3GKUA 4DV7C 2UUBC 2YX1A 4BC9A 2KZFA 4DCVA 1ZB9A 4FUTA 4IR7A 1HNXC 2WD9A 1PU1A 3GPCA 5E7QA 5K85A 1TH5A 1MXBA 4DV6C 5BSWA 2M5HA 1FJGC 4DV3C 4RVOA 4JI6C 2ONFA 3L8CA 4B3RC 1IBLC 2Y4NA 1K0RA 1O92A 3T1HC 3CW9A 4JI0C 1JOSA 4ZLPA 5IWAC 4B3TC 2OBVA 1N36C 5A1GA 1USPB 3KXWA 3IEVA 4ZJZA 2ZTBA 3IEUA 1XNRC 4JYAC 3PESA 4LF7C 2MM9A 4KHPC 3FCCA 3LNVA 2XR1A 4DG8A 3AY0A 1GPMA 3N54B 4PROC 2ZZNA 2UUCC 4MTNA 4RM3A 4PUIA 2CY1A 2OO4A 3R44A 4I9FA 1FUGA 3C5EA 1XRAA 1V26A 4L2ZA 4X66C 5A19A 2D27A 4JM1A 2E7GA 5BURA 4R0MA 1XS3A 5KEIA 4PHTA 3EQ6A 5BSRA 5KYTA 1XMQC 2UU9C 4JI8C 3VNRA 1VEHA 2ZZMA 3A9UA 1NY8A 2UXDC 1N2FA 1EGAA 1LQLA 3S82A 3FCEA 2AYAA 5T8SA 1P7LA 3CQ1A 1BA3A 1P4EC 1N34C 2ATWA 5H9UA 5AE3A 4KTVA 3CW8X 4B3MC 3NI2A 5IT9D 4HPVA 3VNSA 2QL8A 4NDNA 2PROA 1HNWC 1ZB8A 4MH4A 1PA4A 3J80D 5BR8C 4NXNC 1N32C 5BSUA 3DLPX 3GR0A 3A4IA 1RG9A 4L7IA 1T5HX 2CU6A 3NYRA 1XHJA 2PT7G 1UKKA 3RV2A 2P02A 1ML8A 1UWDA 4YHHC 4K0BA 4ODJA 1O9TA 3PBKA 2QVZX 2P2BA 3I08A 2OPLB 3LNOA 2M5OA 3O2EA 1MDBA 4BSZA 2Z51A 2D7VA 4BCAA 5A2QD 1L2FA 3K6RA 2MCQA 3AF5A 4PUHA 1MXAA 2D1TA 2V7BA 1IBMC 4DUYC 1IBKC 4OXIA 1I94C 3PROC 2ZM6C 5DV9A 2P2JA 4BBYA 1WCJA 3RG2A 4DV5C 3L95X 3TR3A 4JI7C 5LCIA 5K8FA 3LAXA 5AE2A 4LF8C 1YJ7A 3B7WA 1RY2A 4LFCC 3CQ2A 3N2QA 2PN2A 5CZVA 3R9XA 2YWCA 5A1IA 2DYJA 1J5EC 4GXRA 2ASBA 2MMAB 3E7XA 4DV1C 3DHVA 1ULTA 4LF4C 2BJOA 4DCUA 3LUSA 2EGTA 2QVYX 2UXCC 2D28C 5BSVA 2JNVA 1O93A 4AQYC 3EERA 4LF9C 1MDFA 2E5LC 3ETOA 2E0GA 3TQIA 2VQFC 2Y27A 2NCLA 4RLQA 3A9VA 2JMPA 3LGXA 2F4VC 2YCBA 2P20A 1QM4A 2E8EA 3UOWA 4JV5C 4RMNA 4G37A 3G7SA 4D57A 2E8CA 2P2QA 4GS5A 3CQ3A 1LCIA 2VSQA 5IFIA 3FM7A 3J81D 2DHMA 2QW0X 4FTFA 4PZPA 4NXMC 1MKYA 4JI4C 4DCSA 4G36A 2HHHC 1WF3A 4R1MA 4DR1C 4X64C 2WP0C 1T5DX 3NYQA 4DCTA 4YY3C 4X65C 1AMUA 3OTOC 1M6XA 3IMLA 4GKKC 4RVNA 2Y4OA 1USPA 1VLAA 1FLOA 4DR5C 3I07A 4DG9A 2VQEC 4OX9C 4D56A 3SO4A 2KZ0A 2P2MA 5BSMA 3UZ0A 1V25A 2YWBA 5BUQA 3VNQA 3GR1A 5FLXD 2QVXX 4DV4C 4LF5C 2VZEA 3IPLA 2PG1E 4DV0C 2D1QA 1PG4A 3R9WA 3UX3A 1NYEA 5CZXA 4LF6C 5LMNC 1MD9A 4KTTA 4DR3C 1XRBA 3E7WA 4NOZA 3ETCA 4DR2C 4LFAC 4DR6C 5BUSA 3AF6A 4D4IA 4WS9A 5JRHA 2HJGA 4IZ6A 4U5YD 3A25A 4PUGA 4RLFA 1XRCA 1QWIA 4EATA 4ISBA 4I9GA 3JAMD 3T1YC 4TPSB 4WV3A 1IB8A 1WH9A
chains in the Genus database with same CATH topology
4DV2C 4K0KC 3NPDA 2OPLA 4OYCA 3TUFA 2D1RA 4JI3C 3DAYA 1N33C 1MXCA 4RM2A 4JI2C 4GXQA 3H2TA 2DPLA 4FUQA 3J7AD 4DR4C 4GKJC 4D4GA 3CJEA 4L4QA 2UUAC 5KYVA 1XMOC 1PG3A 1HR0C 5BSTA 4BC7A 4DUZC 4R1LA 4JI5C 1HNZC 4B3SC 2D1SA 4LE5A 5AE1A 2P2FA 4JI1C 5ADZA 2CXCA 3TDEA 5GTDA 1XNQC 4DR7C 4G1IA 2E8FA 5LMUC 1HH2P 4XX2A 4X62C 2UXBC 2BH1X 4LFBC 5T8TA 1O90A 1KKGA 3GKUA 4DV7C 2UUBC 4BC9A 2KZFA 4DCVA 1ZB9A 4FUTA 4IR7A 1HNXC 2WD9A 3GPCA 5E7QA 5K85A 1MXBA 4DV6C 5BSWA 1FJGC 4DV3C 4RVOA 4JI6C 2ONFA 3L8CA 4B3RC 1IBLC 2Y4NA 1K0RA 1O92A 3T1HC 3CW9A 4JI0C 1JOSA 4ZLPA 5IWAC 4B3TC 2OBVA 1N36C 5A1GA 1USPB 3KXWA 3IEVA 4ZJZA 3IEUA 1XNRC 4JYAC 3PESA 4LF7C 4KHPC 3FCCA 3LNVA 2XR1A 4DG8A 1GPMA 3N54B 4PROC 2UUCC 4MTNA 4RM3A 2CY1A 2OO4A 3R44A 4I9FA 1FUGA 3C5EA 1XRAA 1V26A 4L2ZA 4X66C 5A19A 2D27A 4JM1A 2E7GA 5BURA 4R0MA 5KEIA 4PHTA 3EQ6A 5BSRA 5KYTA 1XMQC 2UU9C 4JI8C 3VNRA 3A9UA 2UXDC 1N2FA 1EGAA 1LQLA 3S82A 3FCEA 2AYAA 5T8SA 1P7LA 1BA3A 2ATWA 1N34C 5H9UA 5AE3A 4KTVA 3CW8X 4B3MC 3NI2A 5IT9D 4HPVA 3VNSA 2QL8A 4NDNA 2PROA 1HNWC 1ZB8A 4MH4A 1PA4A 3J80D 5BR8C 4NXNC 1N32C 5BSUA 3DLPX 3GR0A 3A4IA 1RG9A 4L7IA 1T5HX 3NYRA 2PT7G 1UKKA 3RV2A 2P02A 1ML8A 4YHHC 4K0BA 4ODJA 1O9TA 3PBKA 2QVZX 2P2BA 3I08A 2OPLB 1MDBA 4BSZA 2D7VA 4BCAA 5A2QD 1L2FA 3AF5A 1MXAA 2D1TA 2V7BA 1IBMC 4DUYC 1IBKC 4OXIA 1I94C 3PROC 2ZM6C 5DV9A 2P2JA 4BBYA 3RG2A 4DV5C 3L95X 4JI7C 5K8FA 3LAXA 5AE2A 4LF8C 1YJ7A 3B7WA 1RY2A 4LFCC 3N2QA 2PN2A 5CZVA 3R9XA 2YWCA 5A1IA 2DYJA 1J5EC 4GXRA 2ASBA 3E7XA 4DV1C 3DHVA 1ULTA 4LF4C 2BJOA 4DCUA 3LUSA 2EGTA 2QVYX 2UXCC 2D28C 5BSVA 1O93A 4AQYC 3EERA 4LF9C 1MDFA 2E5LC 3ETOA 2E0GA 3TQIA 2VQFC 2Y27A 4RLQA 3A9VA 2JMPA 3LGXA 2F4VC 2YCBA 2P20A 1QM4A 2E8EA 3UOWA 4JV5C 4RMNA 4G37A 3G7SA 4D57A 2E8CA 2P2QA 4GS5A 1LCIA 2VSQA 5IFIA 3J81D 2QW0X 4FTFA 4PZPA 4NXMC 1MKYA 4JI4C 4DCSA 4G36A 2HHHC 1WF3A 4R1MA 4DR1C 4X64C 2WP0C 1T5DX 3NYQA 4DCTA 4YY3C 4X65C 1AMUA 3OTOC 3IMLA 4GKKC 4RVNA 2Y4OA 1USPA 1VLAA 4DR5C 3I07A 4DG9A 2VQEC 4OX9C 4D56A 3SO4A 2P2MA 5BSMA 3UZ0A 1V25A 2YWBA 5BUQA 3VNQA 3GR1A 5FLXD 2QVXX 4DV4C 4LF5C 2VZEA 3IPLA 4DV0C 2D1QA 1PG4A 3R9WA 1NYEA 5CZXA 4LF6C 5LMNC 1MD9A 4KTTA 4DR3C 1XRBA 3E7WA 4NOZA 3ETCA 4DR2C 4LFAC 4DR6C 5BUSA 3AF6A 4D4IA 4WS9A 5JRHA 2HJGA 4IZ6A 4U5YD 4RLFA 1XRCA 1QWIA 4EATA 4ISBA 4I9GA 3JAMD 3T1YC 4TPSB 4WV3A 1WH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T C;  1N36 C;  2D7V A;  5A2Q D;  1L2F A;  4DV2 C;  1USP B;  4K0K C;  4NXM C;  1MKY A;  3AF5 A;  4JI4 C;  4DCS A;  3IEV A;  3IEU A;  2HHH C;  1WF3 A;  2OPL A;  1IBM C;  1XNR C;  4JYA C;  4LF7 C;  4DR1 C;  4X64 C;  4JI3 C;  4DUY C;  4KHP C;  1IBK C;  1I94 C;  2XR1 A;  4DCT A;  4YY3 C;  4X65 C;  1N33 C;  3OTO C;  2ZM6 C;  2UUC C;  4MTN A;  4JI2 C;  4GKK C;  2CY1 A;  1USP A;  1VLA A;  4DV5 C;  4DR5 C;  4JI7 C;  3J7A D;  4DR4 C;  4GKJ C;  3I07 A;  4X66 C;  2VQE C;  4LF8 C;  4OX9 C;  4LFC C;  3CJE A;  2E7G A;  2UUA C;  2PN2 A;  3R9X A;  2DYJ A;  1XMO C;  1J5E C;  2ASB A;  1XMQ C;  2UU9 C;  4JI8 C;  4DV1 C;  1HR0 C;  5FLX D;  4DUZ C;  4DV4 C;  2UXD C;  1N2F A;  4LF4 C;  4JI5 C;  1EGA A;  1LQL A;  1HNZ C;  4B3S C;  2BJO A;  4DCU A;  4LF5 C;  3LUS A;  4JI1 C;  2EGT A;  2CXC A;  2ATW A;  1N34 C;  1XNQ C;  2UXC C;  4DV0 C;  4B3M C;  4DR7 C;  3R9W A;  1NYE A;  2E8F A;  5LMU C;  1HH2 P;  4XX2 A;  5IT9 D;  4X62 C;  4LF6 C;  5LMN C;  2QL8 A;  2UXB C;  4AQY C;  3EER A;  4LF9 C;  1HNW C;  1ZB8 A;  4MH4 A;  4LFB C;  4DR3 C;  2E5L C;  1KKG A;  3GKU A;  1PA4 A;  3J80 D;  2VQF C;  4DV7 C;  2UUB C;  4NOZ A;  4DR2 C;  5BR8 C;  2KZF A;  4DCV A;  4NXN C;  1ZB9 A;  5IWA C;  2JMP A;  1N32 C;  4LFA C;  4DR6 C;  1HNX C;  2F4V C;  2YCB A;  3AF6 A;  2E8E A;  4DV6 C;  2HJG A;  2PT7 G;  4JV5 C;  1UKK A;  1ML8 A;  1FJG C;  4DV3 C;  4YHH C;  4JI6 C;  2ONF A;  4B3R C;  1IBL C;  1QWI A;  2E8C A;  1K0R A;  3JAM D;  2OPL B;  3T1H C;  3T1Y C;  4JI0 C;  3J81 D;  1JOS A;  4BSZ A;  1WH9 A; 
#chains in the Genus database with same CATH topology
 4DV2 C;  3UEB A;  4K0K C;  3NPD A;  2OPL A;  4OYC A;  3TUF A;  2D1R A;  4JI3 C;  3DAY A;  1N33 C;  1V60 A;  1MXC A;  4RM2 A;  4JI2 C;  4GXQ A;  1YGT A;  3H2T A;  3UX2 A;  2DPL A;  4FUQ A;  3J7A D;  4DR4 C;  4GKJ C;  4D4G A;  1M6X C;  2KDN A;  3CJE A;  4L4Q A;  2UUA C;  5KYV A;  1XMO C;  1PG3 A;  1P4E A;  1HR0 C;  5BST A;  4BC7 A;  4DUZ C;  4R1L A;  4JI5 C;  1HNZ C;  4B3S C;  2D1S A;  4LE5 A;  5AE1 A;  2P2F A;  4JI1 C;  5ADZ A;  2CXC A;  3TDE A;  5GTD A;  1XNQ C;  4DR7 C;  4G1I A;  2E8F A;  5LMU C;  1HH2 P;  4XX2 A;  4X62 C;  2UXB C;  2BH1 X;  1XDX A;  4LFB C;  5T8T A;  1O90 A;  3A26 A;  1KKG A;  3GKU A;  4DV7 C;  2UUB C;  2YX1 A;  4BC9 A;  2KZF A;  4DCV A;  1ZB9 A;  4FUT A;  4IR7 A;  1HNX C;  2WD9 A;  1PU1 A;  3GPC A;  5E7Q A;  5K85 A;  1TH5 A;  1MXB A;  4DV6 C;  5BSW A;  2M5H A;  1FJG C;  4DV3 C;  4RVO A;  4JI6 C;  2ONF A;  3L8C A;  4B3R C;  1IBL C;  2Y4N A;  1K0R A;  1O92 A;  3T1H C;  3CW9 A;  4JI0 C;  1JOS A;  4ZLP A;  5IWA C;  4B3T C;  2OBV A;  1N36 C;  5A1G A;  1USP B;  3KXW A;  3IEV A;  4ZJZ A;  2ZTB A;  3IEU A;  1XNR C;  4JYA C;  3PES A;  4LF7 C;  2MM9 A;  4KHP C;  3FCC A;  3LNV A;  2XR1 A;  4DG8 A;  3AY0 A;  1GPM A;  3N54 B;  4PRO C;  2ZZN A;  2UUC C;  4MTN A;  4RM3 A;  4PUI A;  2CY1 A;  2OO4 A;  3R44 A;  4I9F A;  1FUG A;  3C5E A;  1XRA A;  1V26 A;  4L2Z A;  4X66 C;  5A19 A;  2D27 A;  4JM1 A;  2E7G A;  5BUR A;  4R0M A;  1XS3 A;  5KEI A;  4PHT A;  3EQ6 A;  5BSR A;  5KYT A;  1XMQ C;  2UU9 C;  4JI8 C;  3VNR A;  1VEH A;  2ZZM A;  3A9U A;  1NY8 A;  2UXD C;  1N2F A;  1EGA A;  1LQL A;  3S82 A;  3FCE A;  2AYA A;  5T8S A;  1P7L A;  3CQ1 A;  1BA3 A;  1P4E C;  1N34 C;  2ATW A;  5H9U A;  5AE3 A;  4KTV A;  3CW8 X;  4B3M C;  3NI2 A;  5IT9 D;  4HPV A;  3VNS A;  2QL8 A;  4NDN A;  2PRO A;  1HNW C;  1ZB8 A;  4MH4 A;  1PA4 A;  3J80 D;  5BR8 C;  4NXN C;  1N32 C;  5BSU A;  3DLP X;  3GR0 A;  3A4I A;  1RG9 A;  4L7I A;  1T5H X;  2CU6 A;  3NYR A;  1XHJ A;  2PT7 G;  1UKK A;  3RV2 A;  2P02 A;  1ML8 A;  1UWD A;  4YHH C;  4K0B A;  4ODJ A;  1O9T A;  3PBK A;  2QVZ X;  2P2B A;  3I08 A;  2OPL B;  3LNO A;  2M5O A;  3O2E A;  1MDB A;  4BSZ A;  2Z51 A;  2D7V A;  4BCA A;  5A2Q D;  1L2F A;  3K6R A;  2MCQ A;  3AF5 A;  4PUH A;  1MXA A;  2D1T A;  2V7B A;  1IBM C;  4DUY C;  1IBK C;  4OXI A;  1I94 C;  3PRO C;  2ZM6 C;  5DV9 A;  2P2J A;  4BBY A;  1WCJ A;  3RG2 A;  4DV5 C;  3L95 X;  3TR3 A;  4JI7 C;  5LCI A;  5K8F A;  3LAX A;  5AE2 A;  4LF8 C;  1YJ7 A;  3B7W A;  1RY2 A;  4LFC C;  3CQ2 A;  3N2Q A;  2PN2 A;  5CZV A;  3R9X A;  2YWC A;  5A1I A;  2DYJ A;  1J5E C;  4GXR A;  2ASB A;  2MMA B;  3E7X A;  4DV1 C;  3DHV A;  1ULT A;  4LF4 C;  2BJO A;  4DCU A;  3LUS A;  2EGT A;  2QVY X;  2UXC C;  2D28 C;  5BSV A;  2JNV A;  1O93 A;  4AQY C;  3EER A;  4LF9 C;  1MDF A;  2E5L C;  3ETO A;  2E0G A;  3TQI A;  2VQF C;  2Y27 A;  2NCL A;  4RLQ A;  3A9V A;  2JMP A;  3LGX A;  2F4V C;  2YCB A;  2P20 A;  1QM4 A;  2E8E A;  3UOW A;  4JV5 C;  4RMN A;  4G37 A;  3G7S A;  4D57 A;  2E8C A;  2P2Q A;  4GS5 A;  3CQ3 A;  1LCI A;  2VSQ A;  5IFI A;  3FM7 A;  3J81 D;  2DHM A;  2QW0 X;  4FTF A;  4PZP A;  4NXM C;  1MKY A;  4JI4 C;  4DCS A;  4G36 A;  2HHH C;  1WF3 A;  4R1M A;  4DR1 C;  4X64 C;  2WP0 C;  1T5D X;  3NYQ A;  4DCT A;  4YY3 C;  4X65 C;  1AMU A;  3OTO C;  1M6X A;  3IML A;  4GKK C;  4RVN A;  2Y4O A;  1USP A;  1VLA A;  1FLO A;  4DR5 C;  3I07 A;  4DG9 A;  2VQE C;  4OX9 C;  4D56 A;  3SO4 A;  2KZ0 A;  2P2M A;  5BSM A;  3UZ0 A;  1V25 A;  2YWB A;  5BUQ A;  3VNQ A;  3GR1 A;  5FLX D;  2QVX X;  4DV4 C;  4LF5 C;  2VZE A;  3IPL A;  2PG1 E;  4DV0 C;  2D1Q A;  1PG4 A;  3R9W A;  3UX3 A;  1NYE A;  5CZX A;  4LF6 C;  5LMN C;  1MD9 A;  4KTT A;  4DR3 C;  1XRB A;  3E7W A;  4NOZ A;  3ETC A;  4DR2 C;  4LFA C;  4DR6 C;  5BUS A;  3AF6 A;  4D4I A;  4WS9 A;  5JRH A;  2HJG A;  4IZ6 A;  4U5Y D;  3A25 A;  4PUG A;  4RLF A;  1XRC A;  1QWI A;  4EAT A;  4ISB A;  4I9G A;  3JAM D;  3T1Y C;  4TPS B;  4WV3 A;  1IB8 A;  1WH9 A; 
#chains in the Genus database with same CATH homology
 4DV2 C;  4K0K C;  3NPD A;  2OPL A;  4OYC A;  3TUF A;  2D1R A;  4JI3 C;  3DAY A;  1N33 C;  1MXC A;  4RM2 A;  4JI2 C;  4GXQ A;  3H2T A;  2DPL A;  4FUQ A;  3J7A D;  4DR4 C;  4GKJ C;  4D4G A;  3CJE A;  4L4Q A;  2UUA C;  5KYV A;  1XMO C;  1PG3 A;  1HR0 C;  5BST A;  4BC7 A;  4DUZ C;  4R1L A;  4JI5 C;  1HNZ C;  4B3S C;  2D1S A;  4LE5 A;  5AE1 A;  2P2F A;  4JI1 C;  5ADZ A;  2CXC A;  3TDE A;  5GTD A;  1XNQ C;  4DR7 C;  4G1I A;  2E8F A;  5LMU C;  1HH2 P;  4XX2 A;  4X62 C;  2UXB C;  2BH1 X;  4LFB C;  5T8T A;  1O90 A;  1KKG A;  3GKU A;  4DV7 C;  2UUB C;  4BC9 A;  2KZF A;  4DCV A;  1ZB9 A;  4FUT A;  4IR7 A;  1HNX C;  2WD9 A;  3GPC A;  5E7Q A;  5K85 A;  1MXB A;  4DV6 C;  5BSW A;  1FJG C;  4DV3 C;  4RVO A;  4JI6 C;  2ONF A;  3L8C A;  4B3R C;  1IBL C;  2Y4N A;  1K0R A;  1O92 A;  3T1H C;  3CW9 A;  4JI0 C;  1JOS A;  4ZLP A;  5IWA C;  4B3T C;  2OBV A;  1N36 C;  5A1G A;  1USP B;  3KXW A;  3IEV A;  4ZJZ A;  3IEU A;  1XNR C;  4JYA C;  3PES A;  4LF7 C;  4KHP C;  3FCC A;  3LNV A;  2XR1 A;  4DG8 A;  1GPM A;  3N54 B;  4PRO C;  2UUC C;  4MTN A;  4RM3 A;  2CY1 A;  2OO4 A;  3R44 A;  4I9F A;  1FUG A;  3C5E A;  1XRA A;  1V26 A;  4L2Z A;  4X66 C;  5A19 A;  2D27 A;  4JM1 A;  2E7G A;  5BUR A;  4R0M A;  5KEI A;  4PHT A;  3EQ6 A;  5BSR A;  5KYT A;  1XMQ C;  2UU9 C;  4JI8 C;  3VNR A;  3A9U A;  2UXD C;  1N2F A;  1EGA A;  1LQL A;  3S82 A;  3FCE A;  2AYA A;  5T8S A;  1P7L A;  1BA3 A;  2ATW A;  1N34 C;  5H9U A;  5AE3 A;  4KTV A;  3CW8 X;  4B3M C;  3NI2 A;  5IT9 D;  4HPV A;  3VNS A;  2QL8 A;  4NDN A;  2PRO A;  1HNW C;  1ZB8 A;  4MH4 A;  1PA4 A;  3J80 D;  5BR8 C;  4NXN C;  1N32 C;  5BSU A;  3DLP X;  3GR0 A;  3A4I A;  1RG9 A;  4L7I A;  1T5H X;  3NYR A;  2PT7 G;  1UKK A;  3RV2 A;  2P02 A;  1ML8 A;  4YHH C;  4K0B A;  4ODJ A;  1O9T A;  3PBK A;  2QVZ X;  2P2B A;  3I08 A;  2OPL B;  1MDB A;  4BSZ A;  2D7V A;  4BCA A;  5A2Q D;  1L2F A;  3AF5 A;  1MXA A;  2D1T A;  2V7B A;  1IBM C;  4DUY C;  1IBK C;  4OXI A;  1I94 C;  3PRO C;  2ZM6 C;  5DV9 A;  2P2J A;  4BBY A;  3RG2 A;  4DV5 C;  3L95 X;  4JI7 C;  5K8F A;  3LAX A;  5AE2 A;  4LF8 C;  1YJ7 A;  3B7W A;  1RY2 A;  4LFC C;  3N2Q A;  2PN2 A;  5CZV A;  3R9X A;  2YWC A;  5A1I A;  2DYJ A;  1J5E C;  4GXR A;  2ASB A;  3E7X A;  4DV1 C;  3DHV A;  1ULT A;  4LF4 C;  2BJO A;  4DCU A;  3LUS A;  2EGT A;  2QVY X;  2UXC C;  2D28 C;  5BSV A;  1O93 A;  4AQY C;  3EER A;  4LF9 C;  1MDF A;  2E5L C;  3ETO A;  2E0G A;  3TQI A;  2VQF C;  2Y27 A;  4RLQ A;  3A9V A;  2JMP A;  3LGX A;  2F4V C;  2YCB A;  2P20 A;  1QM4 A;  2E8E A;  3UOW A;  4JV5 C;  4RMN A;  4G37 A;  3G7S A;  4D57 A;  2E8C A;  2P2Q A;  4GS5 A;  1LCI A;  2VSQ A;  5IFI A;  3J81 D;  2QW0 X;  4FTF A;  4PZP A;  4NXM C;  1MKY A;  4JI4 C;  4DCS A;  4G36 A;  2HHH C;  1WF3 A;  4R1M A;  4DR1 C;  4X64 C;  2WP0 C;  1T5D X;  3NYQ A;  4DCT A;  4YY3 C;  4X65 C;  1AMU A;  3OTO C;  3IML A;  4GKK C;  4RVN A;  2Y4O A;  1USP A;  1VLA A;  4DR5 C;  3I07 A;  4DG9 A;  2VQE C;  4OX9 C;  4D56 A;  3SO4 A;  2P2M A;  5BSM A;  3UZ0 A;  1V25 A;  2YWB A;  5BUQ A;  3VNQ A;  3GR1 A;  5FLX D;  2QVX X;  4DV4 C;  4LF5 C;  2VZE A;  3IPL A;  4DV0 C;  2D1Q A;  1PG4 A;  3R9W A;  1NYE A;  5CZX A;  4LF6 C;  5LMN C;  1MD9 A;  4KTT A;  4DR3 C;  1XRB A;  3E7W A;  4NOZ A;  3ETC A;  4DR2 C;  4LFA C;  4DR6 C;  5BUS A;  3AF6 A;  4D4I A;  4WS9 A;  5JRH A;  2HJG A;  4IZ6 A;  4U5Y D;  4RLF A;  1XRC A;  1QWI A;  4EAT A;  4ISB A;  4I9G A;  3JAM D;  3T1Y C;  4TPS B;  4WV3 A;  1WH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...