4JI8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 57
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji8C02
4NXMC 3GKUA 2CY1A 3R9WA 2HHHC 4LF8C 4B3MC 4DV5C 1XMOC 4NOZA 1MKYA 4JYAC 2OPLA 1HNZC 2E8CA 4YHHC 1LQLA 1USPB 1N36C 3AF6A 2QL8A 1FJGC 5A2QD 3IEUA 4DR1C 5IWAC 4DUZC 4YY3C 4LF5C 2JMPA 2ONFA 4LFBC 4LF9C 4JI6C 1NYEA 4DCUA 4JI3C 4DUYC 4LFAC 1WH9A 4DCTA 3OTOC 1HNWC 1IBLC 2EGTA 2VQFC 1K0RA 1I94C 4GKKC 4MTNA 2ATWA 4DV3C 1UKKA 4DR5C 4BSZA 1ZB9A 1XNRC 1QWIA 2E8EA 4DCVA 3JAMD 2UXDC 2E7GA 4JI1C 2UUBC 4JI5C 4DCSA 4X66C 3J81D 3IEVA 4DV2C 1N2FA 2PT7G 2BJOA 4JI7C 1ZB8A 1L2FA 3CJEA 4DV6C 2KZFA 2UU9C 1JOSA 2ASBA 2UUAC 4DR4C 2UUCC 1HH2P 2YCBA 4GKJC 1KKGA 1PA4A 5LMNC 4JI8C 2PN2A 1EGAA 3AF5A 4JI0C 3I07A 1HR0C 3LUSA 4LFCC 4DR6C 2HJGA 4DV4C 2XR1A 2F4VC 4DV1C 3T1YC 4LF7C 2OPLB 5LMUC 4B3SC 4LF6C 1USPA 2ZM6C 4X65C 2VQEC 5BR8C 4DR2C 3J7AD 3EERA 3R9XA 4B3RC 3J80D 4DV7C 4NXNC 2D7VA 1XNQC 2E5LC 2UXCC 4MH4A 4X62C 5IT9D 4KHPC 3T1HC 2UXBC 4JI2C 1XMQC 1IBKC 4B3TC 4OX9C 2CXCA 1ML8A 1IBMC 4LF4C 2E8FA 1N32C 4DR7C 5FLXD 4K0KC 4JV5C 4DR3C 4JI4C 1VLAA 4XX2A 4X64C 1HNXC 1WF3A 2DYJA 1J5EC 1N33C 1N34C 4AQYC 4DV0C
chains in the Genus database with same CATH superfamily
3R9WA 4JYAC 1MKYA 3A25A 2MM9A 2Z51A 1N36C 5DV9A 2QL8A 3AF6A 4IZ6A 3IEUA 2P2FA 1MXAA 5A1IA 5AE2A 4LF9C 2QVXX 3OTOC 2YX1A 1HNWC 5KYTA 3S82A 1K0RA 3DLPX 2ATWA 3CW8X 3GR0A 1ZB9A 2D1QA 3JAMD 3A26A 1XS3A 4JI5C 3NYRA 3J81D 2P2BA 1MD9A 3N54B 4JI7C 2CU6A 5AE1A 3C5EA 4WS9A 2UUCC 3LGXA 4GKJC 5H9UA 4JM1A 1PA4A 1XRBA 2P2JA 4JI8C 5CZXA 1EGAA 1P4EA 3AF5A 2OBVA 4G37A 1HR0C 2PG1E 1GPMA 3NPDA 4R1LA 4D4GA 1M6XA 1USPA 2ZM6C 3RG2A 4FTFA 5E7QA 4PUIA 1AMUA 3R9XA 3PESA 5IT9D 3CQ3A 4WV3A 2UXBC 2D28C 4B3TC 2PROA 5KYVA 4BC7A 5FLXD 4DR7C 4RMNA 2D27A 2E0GA 4X64C 3PBKA 1HNXC 5BSUA 4GXQA 4ZLPA 4FUTA 2OO4A 2ZZNA 2OPLA 1HNZC 2E8CA 4YHHC 4NDNA 1USPB 1FJGC 3TQIA 4DR1C 1BA3A 5IWAC 4DUZC 2JMPA 2ONFA 3GPCA 4JI6C 4D57A 4LFAC 1WH9A 1IBLC 2KDNA 4R0MA 4DV3C 4BCAA 1UKKA 1MDBA 4HPVA 5KEIA 1XNRC 1QWIA 2E8EA 1TH5A 1LCIA 3E7WA 2UUBC 4X66C 4KTVA 3VNSA 3IEVA 4PUGA 4DV2C 1T5DX 1N2FA 3LNVA 3O2EA 3PROC 3CJEA 2VZEA 2MCQA 2KZFA 1QM4A 2D1TA 1JOSA 2ASBA 2NCLA 1FUGA 4L2ZA 3CQ1A 4RVOA 1KKGA 4D4IA 3A4IA 2WD9A 2YWCA 4LFCC 2HJGA 1O92A 1XHJA 4DV1C 2QW0X 1ULTA 3DHVA 5LMUC 1YJ7A 2QVZX 4B3SC 3UOWA 3NI2A 4X65C 2D1SA 3L8CA 4DR2C 3J7AD 4R1MA 3J80D 3UZ0A 1XRCA 1T5HX 4NXNC 1MDFA 1XNQC 2E5LC 1RY2A 3NYQA 2KZ0A 4MH4A 2UXCC 4KHPC 3T1HC 2Y4OA 4I9GA 2CXCA 5GTDA 1N32C 3E7XA 2Y27A 5BSWA 3GR1A 3TDEA 4OXIA 4JV5C 4JI4C 3TR3A 1J5EC 5T8SA 1V26A 1N33C 4AQYC 3CQ2A 3UEBA 4KTTA 5BSRA 2CY1A 4ODJA 2HHHC 4LF8C 4B3MC 1XMOC 2DPLA 1LQLA 4PHTA 2ZZMA 5A2QD 4PZPA 3B7WA 4LFBC 4DCUA 4JI3C 4DUYC 2ZTBA 4LE5A 2EGTA 2BH1X 1O9TA 4ISBA 1I94C 4GKKC 4MTNA 5BSVA 1PG3A 3FCEA 5K8FA 1P4EC 4BSZA 4EATA 2P20A 2D1RA 4GXRA 5JRHA 3EQ6A 1V60A 2E7GA 3A9UA 4RLFA 4L4QA 4DCSA 1IB8A 5LCIA 3N2QA 4I9FA 3KXWA 1ZB8A 4L7IA 2JNVA 5BSTA 4D56A 1RG9A 2UUAC 4DR4C 2YCBA 3FCCA 5LMNC 4U5YD 2PN2A 3I07A 3UX2A 3LUSA 4DV4C 3T1YC 4LF7C 5A1GA 5BUQA 4RM3A 2YWBA 3LNOA 3L95X 4BC9A 1VEHA 2VQEC 5BR8C 1XRAA 3EERA 1XDXA 4DV7C 3FM7A 5A19A 4X62C 1O90A 4ZJZA 4OX9C 2E8FA 1UWDA 4K0BA 4K0KC 4DR3C 1VLAA 3H2TA 4XX2A 4RVNA 1FLOA 4NXMC 3GKUA 3G7SA 4DV5C 4NOZA 1P7LA 4G36A 3ETCA 2AYAA 2WP0C 4BBYA 4YY3C 4TPSB 4OYCA 4LF5C 1NYEA 4DG9A 4IR7A 4DCTA 3LAXA 4FUQA 2VQFC 4GS5A 2V7BA 3I08A 4DR5C 2MMAB 3DAYA 3RV2A 2P2MA 2P02A 5CZVA 4DCVA 2UXDC 4RLQA 4JI1C 4DG8A 3TUFA 1O93A 2PT7G 2BJOA 1NY8A 3IPLA 1L2FA 2P2QA 4DV6C 2UU9C 1WCJA 1YGTA 1HH2P 3VNQA 4G1IA 4JI0C 2M5HA 3SO4A 3VNRA 4DR6C 2XR1A 2F4VC 2OPLB 4LF6C 3R44A 5AE3A 1M6XC 1MXBA 3AY0A 2Y4NA 4PUHA 5BUSA 2VSQA 1V25A 5K85A 4B3RC 1PG4A 1MXCA 2D7VA 1PU1A 3ETOA 4JI2C 1XMQC 1IBKC 5BSMA 1ML8A 1IBMC 4LF4C 3K6RA 3CW9A 5T8TA 2M5OA 5BURA 3IMLA 1WF3A 2DYJA 2DHMA 1N34C 4PROC 3UX3A 4DV0C 2QVYX 3A9VA 5IFIA 5ADZA 4RM2A
chains in the Genus database with same CATH topology
3R9WA 4JYAC 1MKYA 1N36C 5DV9A 2QL8A 3AF6A 4IZ6A 3IEUA 2P2FA 1MXAA 5A1IA 5AE2A 4LF9C 2QVXX 3OTOC 1HNWC 5KYTA 3S82A 1K0RA 3DLPX 2ATWA 3CW8X 3GR0A 1ZB9A 2D1QA 3JAMD 4JI5C 3NYRA 3J81D 2P2BA 1MD9A 3N54B 4JI7C 5AE1A 3C5EA 4WS9A 2UUCC 3LGXA 4GKJC 5H9UA 4JM1A 1PA4A 1XRBA 2P2JA 4JI8C 5CZXA 1EGAA 3AF5A 2OBVA 4G37A 1HR0C 1GPMA 3NPDA 4R1LA 4D4GA 1USPA 2ZM6C 3RG2A 4FTFA 5E7QA 1AMUA 3R9XA 3PESA 5IT9D 4WV3A 2UXBC 2D28C 4B3TC 2PROA 5KYVA 4BC7A 5FLXD 4DR7C 4RMNA 2D27A 2E0GA 4X64C 3PBKA 1HNXC 5BSUA 4GXQA 4ZLPA 4FUTA 2OO4A 2OPLA 1HNZC 2E8CA 4YHHC 4NDNA 1USPB 1FJGC 3TQIA 4DR1C 1BA3A 5IWAC 4DUZC 2JMPA 2ONFA 3GPCA 4JI6C 4D57A 4LFAC 1WH9A 1IBLC 4R0MA 4DV3C 4BCAA 1UKKA 1MDBA 4HPVA 5KEIA 1XNRC 1QWIA 2E8EA 1LCIA 3E7WA 2UUBC 4X66C 4KTVA 3VNSA 3IEVA 4DV2C 1T5DX 1N2FA 3LNVA 3PROC 3CJEA 2VZEA 2KZFA 1QM4A 2D1TA 1JOSA 2ASBA 1FUGA 4L2ZA 4RVOA 1KKGA 4D4IA 3A4IA 2WD9A 2YWCA 4LFCC 2HJGA 1O92A 4DV1C 2QW0X 1ULTA 3DHVA 5LMUC 1YJ7A 2QVZX 4B3SC 3UOWA 3NI2A 4X65C 2D1SA 3L8CA 4DR2C 3J7AD 4R1MA 3J80D 3UZ0A 1XRCA 1T5HX 4NXNC 1MDFA 1XNQC 2E5LC 1RY2A 3NYQA 4MH4A 2UXCC 4KHPC 3T1HC 2Y4OA 4I9GA 2CXCA 5GTDA 1N32C 3E7XA 2Y27A 5BSWA 3GR1A 3TDEA 4OXIA 4JV5C 4JI4C 1J5EC 5T8SA 1V26A 1N33C 4AQYC 4KTTA 5BSRA 2CY1A 4ODJA 2HHHC 4LF8C 4B3MC 1XMOC 2DPLA 1LQLA 4PHTA 5A2QD 4PZPA 3B7WA 4LFBC 4DCUA 4JI3C 4DUYC 4LE5A 2EGTA 2BH1X 1O9TA 4ISBA 1I94C 4GKKC 4MTNA 5BSVA 1PG3A 3FCEA 5K8FA 4BSZA 4EATA 2P20A 2D1RA 4GXRA 5JRHA 3EQ6A 2E7GA 3A9UA 4RLFA 4L4QA 4DCSA 3N2QA 4I9FA 3KXWA 1ZB8A 4L7IA 5BSTA 4D56A 1RG9A 2UUAC 4DR4C 2YCBA 3FCCA 5LMNC 4U5YD 2PN2A 3I07A 3LUSA 4DV4C 3T1YC 4LF7C 5A1GA 5BUQA 4RM3A 2YWBA 3L95X 4BC9A 2VQEC 5BR8C 1XRAA 3EERA 4DV7C 5A19A 4X62C 1O90A 4ZJZA 4OX9C 2E8FA 4K0BA 4K0KC 4DR3C 1VLAA 3H2TA 4XX2A 4RVNA 4NXMC 3GKUA 3G7SA 4DV5C 4NOZA 1P7LA 4G36A 3ETCA 2AYAA 2WP0C 4BBYA 4YY3C 4TPSB 4OYCA 4LF5C 1NYEA 4DG9A 4IR7A 4DCTA 3LAXA 4FUQA 2VQFC 4GS5A 2V7BA 3I08A 4DR5C 3DAYA 3RV2A 2P2MA 2P02A 5CZVA 4DCVA 2UXDC 4RLQA 4JI1C 4DG8A 3TUFA 1O93A 2PT7G 2BJOA 3IPLA 1L2FA 2P2QA 4DV6C 2UU9C 1HH2P 3VNQA 4G1IA 4JI0C 3SO4A 3VNRA 4DR6C 2XR1A 2F4VC 2OPLB 4LF6C 3R44A 5AE3A 1MXBA 2Y4NA 5BUSA 2VSQA 1V25A 5K85A 4B3RC 1PG4A 1MXCA 2D7VA 3ETOA 4JI2C 1XMQC 1IBKC 5BSMA 1ML8A 1IBMC 4LF4C 3CW9A 5T8TA 5BURA 3IMLA 1WF3A 2DYJA 1N34C 4PROC 4DV0C 2QVYX 3A9VA 5IFIA 5ADZA 4RM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM C;  3GKU A;  2CY1 A;  3R9W A;  2HHH C;  4LF8 C;  4B3M C;  4DV5 C;  1XMO C;  4NOZ A;  1MKY A;  4JYA C;  2OPL A;  1HNZ C;  2E8C A;  4YHH C;  1LQL A;  1USP B;  1N36 C;  3AF6 A;  2QL8 A;  1FJG C;  5A2Q D;  3IEU A;  4DR1 C;  5IWA C;  4DUZ C;  4YY3 C;  4LF5 C;  2JMP A;  2ONF A;  4LFB C;  4LF9 C;  4JI6 C;  1NYE A;  4DCU A;  4JI3 C;  4DUY C;  4LFA C;  1WH9 A;  4DCT A;  3OTO C;  1HNW C;  1IBL C;  2EGT A;  2VQF C;  1K0R A;  1I94 C;  4GKK C;  4MTN A;  2ATW A;  4DV3 C;  1UKK A;  4DR5 C;  4BSZ A;  1ZB9 A;  1XNR C;  1QWI A;  2E8E A;  4DCV A;  3JAM D;  2UXD C;  2E7G A;  4JI1 C;  2UUB C;  4JI5 C;  4DCS A;  4X66 C;  3J81 D;  3IEV A;  4DV2 C;  1N2F A;  2PT7 G;  2BJO A;  4JI7 C;  1ZB8 A;  1L2F A;  3CJE A;  4DV6 C;  2KZF A;  2UU9 C;  1JOS A;  2ASB A;  2UUA C;  4DR4 C;  2UUC C;  1HH2 P;  2YCB A;  4GKJ C;  1KKG A;  1PA4 A;  5LMN C;  4JI8 C;  2PN2 A;  1EGA A;  3AF5 A;  4JI0 C;  3I07 A;  1HR0 C;  3LUS A;  4LFC C;  4DR6 C;  2HJG A;  4DV4 C;  2XR1 A;  2F4V C;  4DV1 C;  3T1Y C;  4LF7 C;  2OPL B;  5LMU C;  4B3S C;  4LF6 C;  1USP A;  2ZM6 C;  4X65 C;  2VQE C;  5BR8 C;  4DR2 C;  3J7A D;  3EER A;  3R9X A;  4B3R C;  3J80 D;  4DV7 C;  4NXN C;  2D7V A;  1XNQ C;  2E5L C;  2UXC C;  4MH4 A;  4X62 C;  5IT9 D;  4KHP C;  3T1H C;  2UXB C;  4JI2 C;  1XMQ C;  1IBK C;  4B3T C;  4OX9 C;  2CXC A;  1ML8 A;  1IBM C;  4LF4 C;  2E8F A;  1N32 C;  4DR7 C;  5FLX D;  4K0K C;  4JV5 C;  4DR3 C;  4JI4 C;  1VLA A;  4XX2 A;  4X64 C;  1HNX C;  1WF3 A;  2DYJ A;  1J5E C;  1N33 C;  1N34 C;  4AQY C;  4DV0 C; 
#chains in the Genus database with same CATH topology
 3R9W A;  4JYA C;  1MKY A;  3A25 A;  2MM9 A;  2Z51 A;  1N36 C;  5DV9 A;  2QL8 A;  3AF6 A;  4IZ6 A;  3IEU A;  2P2F A;  1MXA A;  5A1I A;  5AE2 A;  4LF9 C;  2QVX X;  3OTO C;  2YX1 A;  1HNW C;  5KYT A;  3S82 A;  1K0R A;  3DLP X;  2ATW A;  3CW8 X;  3GR0 A;  1ZB9 A;  2D1Q A;  3JAM D;  3A26 A;  1XS3 A;  4JI5 C;  3NYR A;  3J81 D;  2P2B A;  1MD9 A;  3N54 B;  4JI7 C;  2CU6 A;  5AE1 A;  3C5E A;  4WS9 A;  2UUC C;  3LGX A;  4GKJ C;  5H9U A;  4JM1 A;  1PA4 A;  1XRB A;  2P2J A;  4JI8 C;  5CZX A;  1EGA A;  1P4E A;  3AF5 A;  2OBV A;  4G37 A;  1HR0 C;  2PG1 E;  1GPM A;  3NPD A;  4R1L A;  4D4G A;  1M6X A;  1USP A;  2ZM6 C;  3RG2 A;  4FTF A;  5E7Q A;  4PUI A;  1AMU A;  3R9X A;  3PES A;  5IT9 D;  3CQ3 A;  4WV3 A;  2UXB C;  2D28 C;  4B3T C;  2PRO A;  5KYV A;  4BC7 A;  5FLX D;  4DR7 C;  4RMN A;  2D27 A;  2E0G A;  4X64 C;  3PBK A;  1HNX C;  5BSU A;  4GXQ A;  4ZLP A;  4FUT A;  2OO4 A;  2ZZN A;  2OPL A;  1HNZ C;  2E8C A;  4YHH C;  4NDN A;  1USP B;  1FJG C;  3TQI A;  4DR1 C;  1BA3 A;  5IWA C;  4DUZ C;  2JMP A;  2ONF A;  3GPC A;  4JI6 C;  4D57 A;  4LFA C;  1WH9 A;  1IBL C;  2KDN A;  4R0M A;  4DV3 C;  4BCA A;  1UKK A;  1MDB A;  4HPV A;  5KEI A;  1XNR C;  1QWI A;  2E8E A;  1TH5 A;  1LCI A;  3E7W A;  2UUB C;  4X66 C;  4KTV A;  3VNS A;  3IEV A;  4PUG A;  4DV2 C;  1T5D X;  1N2F A;  3LNV A;  3O2E A;  3PRO C;  3CJE A;  2VZE A;  2MCQ A;  2KZF A;  1QM4 A;  2D1T A;  1JOS A;  2ASB A;  2NCL A;  1FUG A;  4L2Z A;  3CQ1 A;  4RVO A;  1KKG A;  4D4I A;  3A4I A;  2WD9 A;  2YWC A;  4LFC C;  2HJG A;  1O92 A;  1XHJ A;  4DV1 C;  2QW0 X;  1ULT A;  3DHV A;  5LMU C;  1YJ7 A;  2QVZ X;  4B3S C;  3UOW A;  3NI2 A;  4X65 C;  2D1S A;  3L8C A;  4DR2 C;  3J7A D;  4R1M A;  3J80 D;  3UZ0 A;  1XRC A;  1T5H X;  4NXN C;  1MDF A;  1XNQ C;  2E5L C;  1RY2 A;  3NYQ A;  2KZ0 A;  4MH4 A;  2UXC C;  4KHP C;  3T1H C;  2Y4O A;  4I9G A;  2CXC A;  5GTD A;  1N32 C;  3E7X A;  2Y27 A;  5BSW A;  3GR1 A;  3TDE A;  4OXI A;  4JV5 C;  4JI4 C;  3TR3 A;  1J5E C;  5T8S A;  1V26 A;  1N33 C;  4AQY C;  3CQ2 A;  3UEB A;  4KTT A;  5BSR A;  2CY1 A;  4ODJ A;  2HHH C;  4LF8 C;  4B3M C;  1XMO C;  2DPL A;  1LQL A;  4PHT A;  2ZZM A;  5A2Q D;  4PZP A;  3B7W A;  4LFB C;  4DCU A;  4JI3 C;  4DUY C;  2ZTB A;  4LE5 A;  2EGT A;  2BH1 X;  1O9T A;  4ISB A;  1I94 C;  4GKK C;  4MTN A;  5BSV A;  1PG3 A;  3FCE A;  5K8F A;  1P4E C;  4BSZ A;  4EAT A;  2P20 A;  2D1R A;  4GXR A;  5JRH A;  3EQ6 A;  1V60 A;  2E7G A;  3A9U A;  4RLF A;  4L4Q A;  4DCS A;  1IB8 A;  5LCI A;  3N2Q A;  4I9F A;  3KXW A;  1ZB8 A;  4L7I A;  2JNV A;  5BST A;  4D56 A;  1RG9 A;  2UUA C;  4DR4 C;  2YCB A;  3FCC A;  5LMN C;  4U5Y D;  2PN2 A;  3I07 A;  3UX2 A;  3LUS A;  4DV4 C;  3T1Y C;  4LF7 C;  5A1G A;  5BUQ A;  4RM3 A;  2YWB A;  3LNO A;  3L95 X;  4BC9 A;  1VEH A;  2VQE C;  5BR8 C;  1XRA A;  3EER A;  1XDX A;  4DV7 C;  3FM7 A;  5A19 A;  4X62 C;  1O90 A;  4ZJZ A;  4OX9 C;  2E8F A;  1UWD A;  4K0B A;  4K0K C;  4DR3 C;  1VLA A;  3H2T A;  4XX2 A;  4RVN A;  1FLO A;  4NXM C;  3GKU A;  3G7S A;  4DV5 C;  4NOZ A;  1P7L A;  4G36 A;  3ETC A;  2AYA A;  2WP0 C;  4BBY A;  4YY3 C;  4TPS B;  4OYC A;  4LF5 C;  1NYE A;  4DG9 A;  4IR7 A;  4DCT A;  3LAX A;  4FUQ A;  2VQF C;  4GS5 A;  2V7B A;  3I08 A;  4DR5 C;  2MMA B;  3DAY A;  3RV2 A;  2P2M A;  2P02 A;  5CZV A;  4DCV A;  2UXD C;  4RLQ A;  4JI1 C;  4DG8 A;  3TUF A;  1O93 A;  2PT7 G;  2BJO A;  1NY8 A;  3IPL A;  1L2F A;  2P2Q A;  4DV6 C;  2UU9 C;  1WCJ A;  1YGT A;  1HH2 P;  3VNQ A;  4G1I A;  4JI0 C;  2M5H A;  3SO4 A;  3VNR A;  4DR6 C;  2XR1 A;  2F4V C;  2OPL B;  4LF6 C;  3R44 A;  5AE3 A;  1M6X C;  1MXB A;  3AY0 A;  2Y4N A;  4PUH A;  5BUS A;  2VSQ A;  1V25 A;  5K85 A;  4B3R C;  1PG4 A;  1MXC A;  2D7V A;  1PU1 A;  3ETO A;  4JI2 C;  1XMQ C;  1IBK C;  5BSM A;  1ML8 A;  1IBM C;  4LF4 C;  3K6R A;  3CW9 A;  5T8T A;  2M5O A;  5BUR A;  3IML A;  1WF3 A;  2DYJ A;  2DHM A;  1N34 C;  4PRO C;  3UX3 A;  4DV0 C;  2QVY X;  3A9V A;  5IFI A;  5ADZ A;  4RM2 A; 
#chains in the Genus database with same CATH homology
 3R9W A;  4JYA C;  1MKY A;  1N36 C;  5DV9 A;  2QL8 A;  3AF6 A;  4IZ6 A;  3IEU A;  2P2F A;  1MXA A;  5A1I A;  5AE2 A;  4LF9 C;  2QVX X;  3OTO C;  1HNW C;  5KYT A;  3S82 A;  1K0R A;  3DLP X;  2ATW A;  3CW8 X;  3GR0 A;  1ZB9 A;  2D1Q A;  3JAM D;  4JI5 C;  3NYR A;  3J81 D;  2P2B A;  1MD9 A;  3N54 B;  4JI7 C;  5AE1 A;  3C5E A;  4WS9 A;  2UUC C;  3LGX A;  4GKJ C;  5H9U A;  4JM1 A;  1PA4 A;  1XRB A;  2P2J A;  4JI8 C;  5CZX A;  1EGA A;  3AF5 A;  2OBV A;  4G37 A;  1HR0 C;  1GPM A;  3NPD A;  4R1L A;  4D4G A;  1USP A;  2ZM6 C;  3RG2 A;  4FTF A;  5E7Q A;  1AMU A;  3R9X A;  3PES A;  5IT9 D;  4WV3 A;  2UXB C;  2D28 C;  4B3T C;  2PRO A;  5KYV A;  4BC7 A;  5FLX D;  4DR7 C;  4RMN A;  2D27 A;  2E0G A;  4X64 C;  3PBK A;  1HNX C;  5BSU A;  4GXQ A;  4ZLP A;  4FUT A;  2OO4 A;  2OPL A;  1HNZ C;  2E8C A;  4YHH C;  4NDN A;  1USP B;  1FJG C;  3TQI A;  4DR1 C;  1BA3 A;  5IWA C;  4DUZ C;  2JMP A;  2ONF A;  3GPC A;  4JI6 C;  4D57 A;  4LFA C;  1WH9 A;  1IBL C;  4R0M A;  4DV3 C;  4BCA A;  1UKK A;  1MDB A;  4HPV A;  5KEI A;  1XNR C;  1QWI A;  2E8E A;  1LCI A;  3E7W A;  2UUB C;  4X66 C;  4KTV A;  3VNS A;  3IEV A;  4DV2 C;  1T5D X;  1N2F A;  3LNV A;  3PRO C;  3CJE A;  2VZE A;  2KZF A;  1QM4 A;  2D1T A;  1JOS A;  2ASB A;  1FUG A;  4L2Z A;  4RVO A;  1KKG A;  4D4I A;  3A4I A;  2WD9 A;  2YWC A;  4LFC C;  2HJG A;  1O92 A;  4DV1 C;  2QW0 X;  1ULT A;  3DHV A;  5LMU C;  1YJ7 A;  2QVZ X;  4B3S C;  3UOW A;  3NI2 A;  4X65 C;  2D1S A;  3L8C A;  4DR2 C;  3J7A D;  4R1M A;  3J80 D;  3UZ0 A;  1XRC A;  1T5H X;  4NXN C;  1MDF A;  1XNQ C;  2E5L C;  1RY2 A;  3NYQ A;  4MH4 A;  2UXC C;  4KHP C;  3T1H C;  2Y4O A;  4I9G A;  2CXC A;  5GTD A;  1N32 C;  3E7X A;  2Y27 A;  5BSW A;  3GR1 A;  3TDE A;  4OXI A;  4JV5 C;  4JI4 C;  1J5E C;  5T8S A;  1V26 A;  1N33 C;  4AQY C;  4KTT A;  5BSR A;  2CY1 A;  4ODJ A;  2HHH C;  4LF8 C;  4B3M C;  1XMO C;  2DPL A;  1LQL A;  4PHT A;  5A2Q D;  4PZP A;  3B7W A;  4LFB C;  4DCU A;  4JI3 C;  4DUY C;  4LE5 A;  2EGT A;  2BH1 X;  1O9T A;  4ISB A;  1I94 C;  4GKK C;  4MTN A;  5BSV A;  1PG3 A;  3FCE A;  5K8F A;  4BSZ A;  4EAT A;  2P20 A;  2D1R A;  4GXR A;  5JRH A;  3EQ6 A;  2E7G A;  3A9U A;  4RLF A;  4L4Q A;  4DCS A;  3N2Q A;  4I9F A;  3KXW A;  1ZB8 A;  4L7I A;  5BST A;  4D56 A;  1RG9 A;  2UUA C;  4DR4 C;  2YCB A;  3FCC A;  5LMN C;  4U5Y D;  2PN2 A;  3I07 A;  3LUS A;  4DV4 C;  3T1Y C;  4LF7 C;  5A1G A;  5BUQ A;  4RM3 A;  2YWB A;  3L95 X;  4BC9 A;  2VQE C;  5BR8 C;  1XRA A;  3EER A;  4DV7 C;  5A19 A;  4X62 C;  1O90 A;  4ZJZ A;  4OX9 C;  2E8F A;  4K0B A;  4K0K C;  4DR3 C;  1VLA A;  3H2T A;  4XX2 A;  4RVN A;  4NXM C;  3GKU A;  3G7S A;  4DV5 C;  4NOZ A;  1P7L A;  4G36 A;  3ETC A;  2AYA A;  2WP0 C;  4BBY A;  4YY3 C;  4TPS B;  4OYC A;  4LF5 C;  1NYE A;  4DG9 A;  4IR7 A;  4DCT A;  3LAX A;  4FUQ A;  2VQF C;  4GS5 A;  2V7B A;  3I08 A;  4DR5 C;  3DAY A;  3RV2 A;  2P2M A;  2P02 A;  5CZV A;  4DCV A;  2UXD C;  4RLQ A;  4JI1 C;  4DG8 A;  3TUF A;  1O93 A;  2PT7 G;  2BJO A;  3IPL A;  1L2F A;  2P2Q A;  4DV6 C;  2UU9 C;  1HH2 P;  3VNQ A;  4G1I A;  4JI0 C;  3SO4 A;  3VNR A;  4DR6 C;  2XR1 A;  2F4V C;  2OPL B;  4LF6 C;  3R44 A;  5AE3 A;  1MXB A;  2Y4N A;  5BUS A;  2VSQ A;  1V25 A;  5K85 A;  4B3R C;  1PG4 A;  1MXC A;  2D7V A;  3ETO A;  4JI2 C;  1XMQ C;  1IBK C;  5BSM A;  1ML8 A;  1IBM C;  4LF4 C;  3CW9 A;  5T8T A;  5BUR A;  3IML A;  1WF3 A;  2DYJ A;  1N34 C;  4PRO C;  4DV0 C;  2QVY X;  3A9V A;  5IFI A;  5ADZ A;  4RM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...