4JI8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 57
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji8C02
1IBLC 1HNWC 4B3RC 5BR8C 2VQEC 4JI7C 4LF8C 4JI8C 4JI6C 1USPA 4LFBC 3J80D 2UUBC 4KHPC 1HR0C 1PA4A 1ZB9A 1N2FA 4DR7C 1N34C 1VLAA 1UKKA 4DCSA 4DV7C 1N33C 4LF9C 3R9XA 1WF3A 4DCTA 1HNZC 4B3SC 4LF7C 4X64C 4JYAC 3AF5A 3AF6A 3T1YC 2D7VA 1LQLA 4B3TC 4DV3C 3OTOC 2ONFA 4JV5C 3CJEA 3JAMD 5LMNC 4LF5C 4DV1C 2KZFA 1USPB 4DCUA 5IT9D 2E5LC 2JMPA 4LFCC 1KKGA 3I07A 1JOSA 1K0RA 1XNRC 4DR4C 2UUCC 1MKYA 2XR1A 2UXDC 4LF6C 4JI2C 1FJGC 4DUYC 2PN2A 4JI4C 2E8CA 2YCBA 4X66C 4DUZC 1XNQC 4GKKC 1J5EC 5LMUC 2UXBC 4JI0C 1WH9A 1I94C 2CY1A 3IEUA 4X65C 1NYEA 2OPLB 4DV6C 4DR6C 4JI3C 2ATWA 4YHHC 4GKJC 4OX9C 3EERA 1ZB8A 5IWAC 3J81D 2VQFC 4JI5C 2PT7G 2ASBA 4NXNC 2CXCA 3GKUA 4MH4A 4XX2A 4AQYC 1ML8A 1IBKC 1EGAA 2OPLA 5FLXD 3T1HC 5A2QD 4LF4C 2F4VC 2HJGA 4DV2C 4DV0C 4DR1C 4MTNA 2UXCC 2UU9C 4NOZA 2UUAC 1HH2P 2DYJA 3J7AD 3LUSA 2E8FA 2HHHC 1N32C 2QL8A 4DCVA 4DV4C 1IBMC 3IEVA 2E7GA 2E8EA 4DV5C 1HNXC 4JI1C 4X62C 4B3MC 1QWIA 4LFAC 2BJOA 4DR3C 1L2FA 1XMQC 4BSZA 2EGTA 4NXMC 3R9WA 2ZM6C 4YY3C 4DR5C 4DR2C 1XMOC 1N36C 4K0KC
chains in the Genus database with same CATH superfamily
1IBLC 1HNWC 4B3RC 5BR8C 2WD9A 4LF8C 4RVOA 2UUBC 1FLOA 1PA4A 3VNRA 1MD9A 1GPMA 4DR7C 3O2EA 1VLAA 3R9XA 5LCIA 5A1GA 1P7LA 5A19A 3AF5A 4RM3A 2P2JA 1LQLA 4DV3C 2Y27A 3NI2A 3FM7A 4JV5C 3RG2A 4DV1C 2Z51A 3LGXA 3N2QA 3SO4A 1KKGA 1YGTA 2ZZNA 4NDNA 5GTDA 1LCIA 1XRAA 1MKYA 4PUHA 5KYTA 2Y4OA 2PN2A 4RLQA 4JI4C 2E8CA 4U5YD 4L4QA 4IZ6A 5AE2A 4JI0C 2D28C 2M5OA 2ATWA 1RG9A 3J81D 2KZ0A 4R0MA 2CXCA 5E7QA 4D57A 5FLXD 1P4EC 4EATA 2D1TA 4DV2C 5BUQA 4DR1C 4ZLPA 2E0GA 3PROC 4LE5A 2UXCC 1MDBA 1HH2P 5KEIA 5A1IA 2DYJA 4G1IA 3LUSA 1T5HX 5CZXA 2HHHC 1IB8A 1IBMC 1PU1A 2E8EA 4FUTA 3I08A 4DG8A 1XDXA 1MXBA 2QW0X 3N54B 3ETOA 4BC9A 2P20A 4BSZA 5BSMA 4L7IA 3R9WA 4DR2C 3TR3A 2VQEC 1UWDA 3GPCA 4JI8C 3CW8X 4JI6C 4BC7A 2PROA 2JNVA 3PESA 1N2FA 2V7BA 3ETCA 3FCCA 5K85A 4PROC 2YWBA 1N34C 4DCSA 4LF9C 4BCAA 4B3SC 4DCTA 4I9GA 3L8CA 1BA3A 4LF7C 3VNSA 3H2TA 3EQ6A 5T8TA 1NY8A 3L95X 4D4GA 4LF5C 1O9TA 3CQ3A 5IT9D 2JMPA 5BSTA 1XRBA 2UUCC 2XR1A 4JI2C 5BSUA 4L2ZA 3UOWA 1XNQC 3LNVA 1WH9A 3IEUA 2QVZX 4DV6C 4DR6C 2VSQA 2P2MA 3UX3A 4GKJC 3TQIA 5IWAC 4JI5C 4WV3A 2D1QA 3GKUA 1ML8A 1IBKC 4RM2A 2OPLA 4LF4C 2HJGA 3NYRA 2ZZMA 3LNOA 2UUAC 1RY2A 4TPSB 3J7AD 2E8FA 2QVYX 3IEVA 2MCQA 5IFIA 1O90A 3AY0A 4X62C 4JI1C 4B3MC 1QWIA 2BJOA 3A26A 4DR3C 2P2BA 1TH5A 1XMQC 1ULTA 4ISBA 4YY3C 2MMAB 4DR5C 1PG3A 1XMOC 1N36C 4JI7C 1USPA 4PUIA 2PG1E 4KHPC 1HR0C 3G7SA 4FUQA 1UKKA 1N33C 1M6XA 1WF3A 1HNZC 4BBYA 4KTVA 1XS3A 3AF6A 3T1YC 2D7VA 4B3TC 5BSWA 3A4IA 3OTOC 2ONFA 5BSVA 4DCUA 2KZFA 1USPB 4R1LA 2E5LC 4D56A 2VZEA 2AYAA 2YX1A 1K0RA 3E7WA 2ZTBA 1FUGA 4DUYC 3LAXA 2YCBA 4X66C 4DUZC 1J5EC 5BSRA 2CY1A 4X65C 1NYEA 1MDFA 2P2FA 4G37A 2OPLB 2OO4A 3DHVA 4OX9C 3GR0A 1ZB8A 4ZJZA 1MXAA 4PHTA 4G36A 1EGAA 2Y4NA 3T1HC 2F4VC 2YWCA 4DV0C 1WCJA 1XHJA 4NOZA 2UU9C 3R44A 4I9FA 3B7WA 3C5EA 5AE3A 1VEHA 4DV4C 4DV5C 1O92A 1HNXC 4KTTA 4WS9A 4RVNA 3CQ2A 3CW9A 2EGTA 4NXMC 4OXIA 2ZM6C 3A25A 1M6XC 3TDEA 1O93A 4PZPA 4LFBC 3J80D 3S82A 2WP0C 4GS5A 2OBVA 1ZB9A 1T5DX 3DLPX 2P02A 1AMUA 4DV7C 4RMNA 5BURA 1YJ7A 4X64C 4JYAC 5CZVA 3IMLA 1V26A 2P2QA 2MM9A 3NPDA 4HPVA 2M5HA 3CJEA 3JAMD 5LMNC 2KDNA 3NYQA 4D4IA 3PBKA 4IR7A 4LFCC 5DV9A 3CQ1A 3I07A 1JOSA 1XNRC 5H9UA 4DR4C 3E7XA 4DG9A 5KYVA 2UXDC 3TUFA 4LF6C 1FJGC 2D1SA 2NCLA 5T8SA 2BH1X 4K0BA 3A9UA 5BUSA 4GKKC 4JM1A 3K6RA 2UXBC 5LMUC 1I94C 3DAYA 5AE1A 4GXRA 3GR1A 4JI3C 4YHHC 5JRHA 1PG4A 2DPLA 4RLFA 4PUGA 3EERA 3VNQA 2VQFC 2PT7G 1MXCA 2CU6A 2ASBA 4NXNC 1V60A 3A9VA 3KXWA 4MH4A 4XX2A 4AQYC 1QM4A 4FTFA 4ODJA 4R1MA 5A2QD 3IPLA 3UZ0A 5ADZA 4GXQA 4MTNA 4OYCA 1V25A 1N32C 2QL8A 1P4EA 4DCVA 2E7GA 3UX2A 2QVXX 3RV2A 3FCEA 4LFAC 1XRCA 2D27A 2DHMA 3UEBA 1L2FA 2D1RA 5K8FA 4K0KC
chains in the Genus database with same CATH topology
1IBLC 1HNWC 4B3RC 5BR8C 2WD9A 4LF8C 4RVOA 2UUBC 1PA4A 3VNRA 1MD9A 1GPMA 4DR7C 1VLAA 3R9XA 5A1GA 1P7LA 5A19A 3AF5A 4RM3A 2P2JA 1LQLA 4DV3C 2Y27A 3NI2A 4JV5C 3RG2A 4DV1C 3LGXA 3N2QA 3SO4A 1KKGA 4NDNA 5GTDA 1LCIA 1XRAA 1MKYA 5KYTA 2Y4OA 2PN2A 4RLQA 4JI4C 2E8CA 4U5YD 4L4QA 4IZ6A 5AE2A 4JI0C 2D28C 2ATWA 1RG9A 3J81D 4R0MA 2CXCA 5E7QA 4D57A 5FLXD 4EATA 2D1TA 4DV2C 5BUQA 4DR1C 4ZLPA 2E0GA 3PROC 4LE5A 2UXCC 1MDBA 1HH2P 5KEIA 5A1IA 2DYJA 4G1IA 3LUSA 1T5HX 5CZXA 2HHHC 1IBMC 2E8EA 4FUTA 3I08A 4DG8A 1MXBA 2QW0X 3N54B 3ETOA 4BC9A 2P20A 4BSZA 5BSMA 4L7IA 3R9WA 4DR2C 2VQEC 3GPCA 4JI8C 3CW8X 4JI6C 4BC7A 2PROA 3PESA 1N2FA 2V7BA 3ETCA 3FCCA 5K85A 4PROC 2YWBA 1N34C 4DCSA 4LF9C 4BCAA 4B3SC 4DCTA 4I9GA 3L8CA 1BA3A 4LF7C 3VNSA 3H2TA 3EQ6A 5T8TA 4D4GA 3L95X 4LF5C 1O9TA 5IT9D 2JMPA 5BSTA 1XRBA 2UUCC 2XR1A 4JI2C 5BSUA 4L2ZA 3UOWA 1XNQC 3LNVA 1WH9A 3IEUA 2QVZX 4DV6C 4DR6C 2VSQA 2P2MA 4GKJC 3TQIA 5IWAC 4JI5C 4WV3A 2D1QA 3GKUA 1ML8A 1IBKC 4RM2A 2OPLA 4LF4C 2HJGA 3NYRA 2UUAC 1RY2A 4TPSB 3J7AD 2E8FA 2QVYX 3IEVA 5IFIA 1O90A 4JI1C 4X62C 4B3MC 1QWIA 2BJOA 4DR3C 2P2BA 1XMQC 1ULTA 4ISBA 4YY3C 4DR5C 1PG3A 1XMOC 1N36C 4JI7C 1USPA 4KHPC 1HR0C 3G7SA 4FUQA 1UKKA 1N33C 1WF3A 1HNZC 4BBYA 4KTVA 3AF6A 3T1YC 2D7VA 4B3TC 5BSWA 3A4IA 3OTOC 2ONFA 5BSVA 2KZFA 1USPB 4DCUA 4R1LA 2E5LC 4D56A 2VZEA 2AYAA 1K0RA 3E7WA 1FUGA 4DUYC 3LAXA 2YCBA 4X66C 4DUZC 1J5EC 5BSRA 2CY1A 4X65C 1NYEA 1MDFA 2P2FA 4G37A 2OPLB 2OO4A 3DHVA 4OX9C 3GR0A 1ZB8A 4ZJZA 1MXAA 4PHTA 4G36A 1EGAA 2Y4NA 3T1HC 2F4VC 2YWCA 4DV0C 2UU9C 4NOZA 3R44A 4I9FA 3B7WA 3C5EA 5AE3A 4DV4C 4DV5C 1O92A 1HNXC 4KTTA 4WS9A 4RVNA 3CW9A 2EGTA 4NXMC 4OXIA 2ZM6C 3TDEA 1O93A 4PZPA 4LFBC 3J80D 3S82A 2WP0C 4GS5A 2OBVA 1ZB9A 1T5DX 3DLPX 2P02A 1AMUA 4DV7C 4RMNA 5BURA 1YJ7A 4X64C 4JYAC 5CZVA 3IMLA 1V26A 2P2QA 3NPDA 4HPVA 3CJEA 3JAMD 5LMNC 3NYQA 4D4IA 3PBKA 4IR7A 4LFCC 5DV9A 3I07A 1JOSA 1XNRC 5H9UA 4DR4C 3E7XA 4DG9A 5KYVA 2UXDC 3TUFA 4LF6C 1FJGC 2D1SA 5T8SA 2BH1X 4K0BA 3A9UA 5BUSA 4GKKC 4JM1A 2UXBC 5LMUC 1I94C 3DAYA 5AE1A 4GXRA 3GR1A 4JI3C 4YHHC 5JRHA 1PG4A 2DPLA 4RLFA 3EERA 3VNQA 2VQFC 2PT7G 1MXCA 2ASBA 4NXNC 3A9VA 3KXWA 4MH4A 4XX2A 4AQYC 1QM4A 4FTFA 4ODJA 4R1MA 5A2QD 3IPLA 3UZ0A 5ADZA 4GXQA 4MTNA 4OYCA 1V25A 1N32C 2QL8A 4DCVA 2E7GA 2QVXX 3RV2A 3FCEA 4LFAC 1XRCA 2D27A 1L2FA 2D1RA 5K8FA 4K0KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL C;  1HNW C;  4B3R C;  5BR8 C;  2VQE C;  4JI7 C;  4LF8 C;  4JI8 C;  4JI6 C;  1USP A;  4LFB C;  3J80 D;  2UUB C;  4KHP C;  1HR0 C;  1PA4 A;  1ZB9 A;  1N2F A;  4DR7 C;  1N34 C;  1VLA A;  1UKK A;  4DCS A;  4DV7 C;  1N33 C;  4LF9 C;  3R9X A;  1WF3 A;  4DCT A;  1HNZ C;  4B3S C;  4LF7 C;  4X64 C;  4JYA C;  3AF5 A;  3AF6 A;  3T1Y C;  2D7V A;  1LQL A;  4B3T C;  4DV3 C;  3OTO C;  2ONF A;  4JV5 C;  3CJE A;  3JAM D;  5LMN C;  4LF5 C;  4DV1 C;  2KZF A;  1USP B;  4DCU A;  5IT9 D;  2E5L C;  2JMP A;  4LFC C;  1KKG A;  3I07 A;  1JOS A;  1K0R A;  1XNR C;  4DR4 C;  2UUC C;  1MKY A;  2XR1 A;  2UXD C;  4LF6 C;  4JI2 C;  1FJG C;  4DUY C;  2PN2 A;  4JI4 C;  2E8C A;  2YCB A;  4X66 C;  4DUZ C;  1XNQ C;  4GKK C;  1J5E C;  5LMU C;  2UXB C;  4JI0 C;  1WH9 A;  1I94 C;  2CY1 A;  3IEU A;  4X65 C;  1NYE A;  2OPL B;  4DV6 C;  4DR6 C;  4JI3 C;  2ATW A;  4YHH C;  4GKJ C;  4OX9 C;  3EER A;  1ZB8 A;  5IWA C;  3J81 D;  2VQF C;  4JI5 C;  2PT7 G;  2ASB A;  4NXN C;  2CXC A;  3GKU A;  4MH4 A;  4XX2 A;  4AQY C;  1ML8 A;  1IBK C;  1EGA A;  2OPL A;  5FLX D;  3T1H C;  5A2Q D;  4LF4 C;  2F4V C;  2HJG A;  4DV2 C;  4DV0 C;  4DR1 C;  4MTN A;  2UXC C;  2UU9 C;  4NOZ A;  2UUA C;  1HH2 P;  2DYJ A;  3J7A D;  3LUS A;  2E8F A;  2HHH C;  1N32 C;  2QL8 A;  4DCV A;  4DV4 C;  1IBM C;  3IEV A;  2E7G A;  2E8E A;  4DV5 C;  1HNX C;  4JI1 C;  4X62 C;  4B3M C;  1QWI A;  4LFA C;  2BJO A;  4DR3 C;  1L2F A;  1XMQ C;  4BSZ A;  2EGT A;  4NXM C;  3R9W A;  2ZM6 C;  4YY3 C;  4DR5 C;  4DR2 C;  1XMO C;  1N36 C;  4K0K C; 
#chains in the Genus database with same CATH topology
 1IBL C;  1HNW C;  4B3R C;  5BR8 C;  2WD9 A;  4LF8 C;  4RVO A;  2UUB C;  1FLO A;  1PA4 A;  3VNR A;  1MD9 A;  1GPM A;  4DR7 C;  3O2E A;  1VLA A;  3R9X A;  5LCI A;  5A1G A;  1P7L A;  5A19 A;  3AF5 A;  4RM3 A;  2P2J A;  1LQL A;  4DV3 C;  2Y27 A;  3NI2 A;  3FM7 A;  4JV5 C;  3RG2 A;  4DV1 C;  2Z51 A;  3LGX A;  3N2Q A;  3SO4 A;  1KKG A;  1YGT A;  2ZZN A;  4NDN A;  5GTD A;  1LCI A;  1XRA A;  1MKY A;  4PUH A;  5KYT A;  2Y4O A;  2PN2 A;  4RLQ A;  4JI4 C;  2E8C A;  4U5Y D;  4L4Q A;  4IZ6 A;  5AE2 A;  4JI0 C;  2D28 C;  2M5O A;  2ATW A;  1RG9 A;  3J81 D;  2KZ0 A;  4R0M A;  2CXC A;  5E7Q A;  4D57 A;  5FLX D;  1P4E C;  4EAT A;  2D1T A;  4DV2 C;  5BUQ A;  4DR1 C;  4ZLP A;  2E0G A;  3PRO C;  4LE5 A;  2UXC C;  1MDB A;  1HH2 P;  5KEI A;  5A1I A;  2DYJ A;  4G1I A;  3LUS A;  1T5H X;  5CZX A;  2HHH C;  1IB8 A;  1IBM C;  1PU1 A;  2E8E A;  4FUT A;  3I08 A;  4DG8 A;  1XDX A;  1MXB A;  2QW0 X;  3N54 B;  3ETO A;  4BC9 A;  2P20 A;  4BSZ A;  5BSM A;  4L7I A;  3R9W A;  4DR2 C;  3TR3 A;  2VQE C;  1UWD A;  3GPC A;  4JI8 C;  3CW8 X;  4JI6 C;  4BC7 A;  2PRO A;  2JNV A;  3PES A;  1N2F A;  2V7B A;  3ETC A;  3FCC A;  5K85 A;  4PRO C;  2YWB A;  1N34 C;  4DCS A;  4LF9 C;  4BCA A;  4B3S C;  4DCT A;  4I9G A;  3L8C A;  1BA3 A;  4LF7 C;  3VNS A;  3H2T A;  3EQ6 A;  5T8T A;  1NY8 A;  3L95 X;  4D4G A;  4LF5 C;  1O9T A;  3CQ3 A;  5IT9 D;  2JMP A;  5BST A;  1XRB A;  2UUC C;  2XR1 A;  4JI2 C;  5BSU A;  4L2Z A;  3UOW A;  1XNQ C;  3LNV A;  1WH9 A;  3IEU A;  2QVZ X;  4DV6 C;  4DR6 C;  2VSQ A;  2P2M A;  3UX3 A;  4GKJ C;  3TQI A;  5IWA C;  4JI5 C;  4WV3 A;  2D1Q A;  3GKU A;  1ML8 A;  1IBK C;  4RM2 A;  2OPL A;  4LF4 C;  2HJG A;  3NYR A;  2ZZM A;  3LNO A;  2UUA C;  1RY2 A;  4TPS B;  3J7A D;  2E8F A;  2QVY X;  3IEV A;  2MCQ A;  5IFI A;  1O90 A;  3AY0 A;  4X62 C;  4JI1 C;  4B3M C;  1QWI A;  2BJO A;  3A26 A;  4DR3 C;  2P2B A;  1TH5 A;  1XMQ C;  1ULT A;  4ISB A;  4YY3 C;  2MMA B;  4DR5 C;  1PG3 A;  1XMO C;  1N36 C;  4JI7 C;  1USP A;  4PUI A;  2PG1 E;  4KHP C;  1HR0 C;  3G7S A;  4FUQ A;  1UKK A;  1N33 C;  1M6X A;  1WF3 A;  1HNZ C;  4BBY A;  4KTV A;  1XS3 A;  3AF6 A;  3T1Y C;  2D7V A;  4B3T C;  5BSW A;  3A4I A;  3OTO C;  2ONF A;  5BSV A;  4DCU A;  2KZF A;  1USP B;  4R1L A;  2E5L C;  4D56 A;  2VZE A;  2AYA A;  2YX1 A;  1K0R A;  3E7W A;  2ZTB A;  1FUG A;  4DUY C;  3LAX A;  2YCB A;  4X66 C;  4DUZ C;  1J5E C;  5BSR A;  2CY1 A;  4X65 C;  1NYE A;  1MDF A;  2P2F A;  4G37 A;  2OPL B;  2OO4 A;  3DHV A;  4OX9 C;  3GR0 A;  1ZB8 A;  4ZJZ A;  1MXA A;  4PHT A;  4G36 A;  1EGA A;  2Y4N A;  3T1H C;  2F4V C;  2YWC A;  4DV0 C;  1WCJ A;  1XHJ A;  4NOZ A;  2UU9 C;  3R44 A;  4I9F A;  3B7W A;  3C5E A;  5AE3 A;  1VEH A;  4DV4 C;  4DV5 C;  1O92 A;  1HNX C;  4KTT A;  4WS9 A;  4RVN A;  3CQ2 A;  3CW9 A;  2EGT A;  4NXM C;  4OXI A;  2ZM6 C;  3A25 A;  1M6X C;  3TDE A;  1O93 A;  4PZP A;  4LFB C;  3J80 D;  3S82 A;  2WP0 C;  4GS5 A;  2OBV A;  1ZB9 A;  1T5D X;  3DLP X;  2P02 A;  1AMU A;  4DV7 C;  4RMN A;  5BUR A;  1YJ7 A;  4X64 C;  4JYA C;  5CZV A;  3IML A;  1V26 A;  2P2Q A;  2MM9 A;  3NPD A;  4HPV A;  2M5H A;  3CJE A;  3JAM D;  5LMN C;  2KDN A;  3NYQ A;  4D4I A;  3PBK A;  4IR7 A;  4LFC C;  5DV9 A;  3CQ1 A;  3I07 A;  1JOS A;  1XNR C;  5H9U A;  4DR4 C;  3E7X A;  4DG9 A;  5KYV A;  2UXD C;  3TUF A;  4LF6 C;  1FJG C;  2D1S A;  2NCL A;  5T8S A;  2BH1 X;  4K0B A;  3A9U A;  5BUS A;  4GKK C;  4JM1 A;  3K6R A;  2UXB C;  5LMU C;  1I94 C;  3DAY A;  5AE1 A;  4GXR A;  3GR1 A;  4JI3 C;  4YHH C;  5JRH A;  1PG4 A;  2DPL A;  4RLF A;  4PUG A;  3EER A;  3VNQ A;  2VQF C;  2PT7 G;  1MXC A;  2CU6 A;  2ASB A;  4NXN C;  1V60 A;  3A9V A;  3KXW A;  4MH4 A;  4XX2 A;  4AQY C;  1QM4 A;  4FTF A;  4ODJ A;  4R1M A;  5A2Q D;  3IPL A;  3UZ0 A;  5ADZ A;  4GXQ A;  4MTN A;  4OYC A;  1V25 A;  1N32 C;  2QL8 A;  1P4E A;  4DCV A;  2E7G A;  3UX2 A;  2QVX X;  3RV2 A;  3FCE A;  4LFA C;  1XRC A;  2D27 A;  2DHM A;  3UEB A;  1L2F A;  2D1R A;  5K8F A;  4K0K C; 
#chains in the Genus database with same CATH homology
 1IBL C;  1HNW C;  4B3R C;  5BR8 C;  2WD9 A;  4LF8 C;  4RVO A;  2UUB C;  1PA4 A;  3VNR A;  1MD9 A;  1GPM A;  4DR7 C;  1VLA A;  3R9X A;  5A1G A;  1P7L A;  5A19 A;  3AF5 A;  4RM3 A;  2P2J A;  1LQL A;  4DV3 C;  2Y27 A;  3NI2 A;  4JV5 C;  3RG2 A;  4DV1 C;  3LGX A;  3N2Q A;  3SO4 A;  1KKG A;  4NDN A;  5GTD A;  1LCI A;  1XRA A;  1MKY A;  5KYT A;  2Y4O A;  2PN2 A;  4RLQ A;  4JI4 C;  2E8C A;  4U5Y D;  4L4Q A;  4IZ6 A;  5AE2 A;  4JI0 C;  2D28 C;  2ATW A;  1RG9 A;  3J81 D;  4R0M A;  2CXC A;  5E7Q A;  4D57 A;  5FLX D;  4EAT A;  2D1T A;  4DV2 C;  5BUQ A;  4DR1 C;  4ZLP A;  2E0G A;  3PRO C;  4LE5 A;  2UXC C;  1MDB A;  1HH2 P;  5KEI A;  5A1I A;  2DYJ A;  4G1I A;  3LUS A;  1T5H X;  5CZX A;  2HHH C;  1IBM C;  2E8E A;  4FUT A;  3I08 A;  4DG8 A;  1MXB A;  2QW0 X;  3N54 B;  3ETO A;  4BC9 A;  2P20 A;  4BSZ A;  5BSM A;  4L7I A;  3R9W A;  4DR2 C;  2VQE C;  3GPC A;  4JI8 C;  3CW8 X;  4JI6 C;  4BC7 A;  2PRO A;  3PES A;  1N2F A;  2V7B A;  3ETC A;  3FCC A;  5K85 A;  4PRO C;  2YWB A;  1N34 C;  4DCS A;  4LF9 C;  4BCA A;  4B3S C;  4DCT A;  4I9G A;  3L8C A;  1BA3 A;  4LF7 C;  3VNS A;  3H2T A;  3EQ6 A;  5T8T A;  4D4G A;  3L95 X;  4LF5 C;  1O9T A;  5IT9 D;  2JMP A;  5BST A;  1XRB A;  2UUC C;  2XR1 A;  4JI2 C;  5BSU A;  4L2Z A;  3UOW A;  1XNQ C;  3LNV A;  1WH9 A;  3IEU A;  2QVZ X;  4DV6 C;  4DR6 C;  2VSQ A;  2P2M A;  4GKJ C;  3TQI A;  5IWA C;  4JI5 C;  4WV3 A;  2D1Q A;  3GKU A;  1ML8 A;  1IBK C;  4RM2 A;  2OPL A;  4LF4 C;  2HJG A;  3NYR A;  2UUA C;  1RY2 A;  4TPS B;  3J7A D;  2E8F A;  2QVY X;  3IEV A;  5IFI A;  1O90 A;  4JI1 C;  4X62 C;  4B3M C;  1QWI A;  2BJO A;  4DR3 C;  2P2B A;  1XMQ C;  1ULT A;  4ISB A;  4YY3 C;  4DR5 C;  1PG3 A;  1XMO C;  1N36 C;  4JI7 C;  1USP A;  4KHP C;  1HR0 C;  3G7S A;  4FUQ A;  1UKK A;  1N33 C;  1WF3 A;  1HNZ C;  4BBY A;  4KTV A;  3AF6 A;  3T1Y C;  2D7V A;  4B3T C;  5BSW A;  3A4I A;  3OTO C;  2ONF A;  5BSV A;  2KZF A;  1USP B;  4DCU A;  4R1L A;  2E5L C;  4D56 A;  2VZE A;  2AYA A;  1K0R A;  3E7W A;  1FUG A;  4DUY C;  3LAX A;  2YCB A;  4X66 C;  4DUZ C;  1J5E C;  5BSR A;  2CY1 A;  4X65 C;  1NYE A;  1MDF A;  2P2F A;  4G37 A;  2OPL B;  2OO4 A;  3DHV A;  4OX9 C;  3GR0 A;  1ZB8 A;  4ZJZ A;  1MXA A;  4PHT A;  4G36 A;  1EGA A;  2Y4N A;  3T1H C;  2F4V C;  2YWC A;  4DV0 C;  2UU9 C;  4NOZ A;  3R44 A;  4I9F A;  3B7W A;  3C5E A;  5AE3 A;  4DV4 C;  4DV5 C;  1O92 A;  1HNX C;  4KTT A;  4WS9 A;  4RVN A;  3CW9 A;  2EGT A;  4NXM C;  4OXI A;  2ZM6 C;  3TDE A;  1O93 A;  4PZP A;  4LFB C;  3J80 D;  3S82 A;  2WP0 C;  4GS5 A;  2OBV A;  1ZB9 A;  1T5D X;  3DLP X;  2P02 A;  1AMU A;  4DV7 C;  4RMN A;  5BUR A;  1YJ7 A;  4X64 C;  4JYA C;  5CZV A;  3IML A;  1V26 A;  2P2Q A;  3NPD A;  4HPV A;  3CJE A;  3JAM D;  5LMN C;  3NYQ A;  4D4I A;  3PBK A;  4IR7 A;  4LFC C;  5DV9 A;  3I07 A;  1JOS A;  1XNR C;  5H9U A;  4DR4 C;  3E7X A;  4DG9 A;  5KYV A;  2UXD C;  3TUF A;  4LF6 C;  1FJG C;  2D1S A;  5T8S A;  2BH1 X;  4K0B A;  3A9U A;  5BUS A;  4GKK C;  4JM1 A;  2UXB C;  5LMU C;  1I94 C;  3DAY A;  5AE1 A;  4GXR A;  3GR1 A;  4JI3 C;  4YHH C;  5JRH A;  1PG4 A;  2DPL A;  4RLF A;  3EER A;  3VNQ A;  2VQF C;  2PT7 G;  1MXC A;  2ASB A;  4NXN C;  3A9V A;  3KXW A;  4MH4 A;  4XX2 A;  4AQY C;  1QM4 A;  4FTF A;  4ODJ A;  4R1M A;  5A2Q D;  3IPL A;  3UZ0 A;  5ADZ A;  4GXQ A;  4MTN A;  4OYC A;  1V25 A;  1N32 C;  2QL8 A;  4DCV A;  2E7G A;  2QVX X;  3RV2 A;  3FCE A;  4LFA C;  1XRC A;  2D27 A;  1L2F A;  2D1R A;  5K8F A;  4K0K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...