4JI8C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 57
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji8C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji8C02
4X62C 1IBLC 4LFCC 4JI4C 1WF3A 2OPLB 1HNWC 4DV1C 1N36C 5IWAC 4DV4C 1XNRC 4YHHC 4DV7C 2XR1A 2UU9C 2CXCA 2QL8A 1I94C 1JOSA 1L2FA 4GKKC 3AF6A 2E8CA 4DR1C 1N32C 1NYEA 4JI1C 4AQYC 1ZB8A 4DR3C 4JI8C 2OPLA 4LF5C 4JV5C 2ATWA 5BR8C 4MTNA 3JAMD 4DR4C 2KZFA 2CY1A 4OX9C 2E5LC 4DV2C 1N2FA 4LF6C 3EERA 4LF4C 1HH2P 4YY3C 3GKUA 4DUZC 2UXBC 4XX2A 4LF8C 2UXCC 4X65C 4DUYC 1KKGA 1WH9A 1XNQC 2E7GA 1K0RA 1LQLA 1IBMC 4GKJC 2UXDC 5LMUC 3IEVA 3T1HC 2ASBA 4JYAC 2YCBA 4NXNC 3CJEA 1XMOC 4JI6C 4DR6C 2HHHC 4B3RC 1IBKC 4B3TC 1N34C 1VLAA 1J5EC 2PT7G 3IEUA 1HNXC 2VQEC 3R9XA 3R9WA 2ZM6C 3I07A 4DR5C 2JMPA 4B3MC 4LFAC 1UKKA 1ZB9A 4NXMC 4DV5C 3LUSA 1HNZC 4LFBC 1XMQC 3J81D 4DCSA 5IT9D 4DCVA 2PN2A 1FJGC 4X66C 3OTOC 4NOZA 5FLXD 2E8FA 2D7VA 2EGTA 1EGAA 4JI2C 2DYJA 4X64C 1HR0C 1PA4A 3T1YC 2UUAC 4B3SC 4JI7C 4K0KC 4LF9C 1QWIA 4DV0C 1MKYA 4DR2C 2VQFC 4BSZA 2ONFA 2F4VC 1USPB 3J80D 4MH4A 2UUCC 2HJGA 3AF5A 5LMNC 2BJOA 4JI0C 4DCTA 4DR7C 2UUBC 4DCUA 4JI5C 3J7AD 1N33C 4DV6C 5A2QD 1ML8A 2E8EA 4JI3C 4LF7C 4DV3C 1USPA 4KHPC
chains in the Genus database with same CATH superfamily
4LFCC 4JI4C 1WF3A 5A1IA 2D28C 2P2BA 2YWBA 1XNRC 5BSMA 2XR1A 5T8TA 5JRHA 2MM9A 1JOSA 2E0GA 4NDNA 3FCCA 2E8CA 1T5HX 3NYRA 4I9GA 2Y4OA 3K6RA 5AE1A 3JAMD 4GS5A 4DV2C 3DHVA 4OYCA 1LCIA 4YY3C 3L8CA 2UXBC 5BURA 4KTTA 4PUHA 2E7GA 1K0RA 5GTDA 2M5HA 1BA3A 1MD9A 1P4EC 2Z51A 3R9WA 3CQ1A 4TPSB 2WP0C 4B3MC 2D1QA 3A9UA 1HNZC 3E7WA 4DCVA 3A9VA 4KTVA 2CU6A 5FLXD 2D7VA 2EGTA 1EGAA 1VEHA 2P2MA 3LNVA 3CW9A 1IB8A 1MXCA 5H9UA 5AE2A 2MMAB 3UX3A 2KZ0A 1YJ7A 5BSTA 4JI0C 1TH5A 2UUBC 5K8FA 1PU1A 1ML8A 2QVYX 4KHPC 4X62C 4PROC 5A19A 4DV4C 4DV7C 2UU9C 4JM1A 1L2FA 1RG9A 4RVOA 4GKKC 3AF6A 1P4EA 2QW0X 2PG1E 4JI8C 5KYVA 5KEIA 1ULTA 2P2FA 3PESA 3TUFA 2WD9A 4OX9C 4DG9A 1UWDA 2E5LC 4LF4C 3NI2A 3DAYA 4IR7A 3H2TA 4DUZC 3TR3A 2JNVA 1WH9A 1NY8A 5BUSA 1LQLA 1FLOA 3IEVA 4JYAC 4NXNC 2DPLA 1XMOC 2Y27A 3SO4A 2HHHC 3ETOA 1IBKC 1N34C 2QVXX 3IEUA 4BCAA 1HNXC 2VQEC 5BSWA 4G36A 2DHMA 1O9TA 2JMPA 1UKKA 3VNSA 3PBKA 3GR1A 4D4GA 3J81D 4DCSA 4RVNA 5IT9D 1FJGC 2ZZMA 3G7SA 1MXBA 2DYJA 2P2QA 5CZXA 3KXWA 2P2JA 4X64C 3RG2A 4RLQA 3FCEA 4JI7C 4K0KC 2P02A 1XRAA 1MKYA 4DR2C 5AE3A 1M6XA 4G37A 3O2EA 1V25A 3IPLA 3GPCA 3J80D 5T8SA 2OBVA 2YX1A 2ZZNA 4RLFA 2BJOA 3CW8X 3UX2A 5BSVA 4ZLPA 5BSUA 4DV3C 1USPA 2V7BA 1WCJA 1HNWC 5DV9A 1FUGA 3B7WA 3C5EA 4GXRA 3LAXA 4DR1C 1N32C 1NYEA 1ZB8A 4DR3C 2OPLA 4LF5C 1PG3A 2ATWA 5BR8C 4MTNA 4DR4C 4L7IA 4RM3A 4IZ6A 1QM4A 5A1GA 1XRCA 5ADZA 5E7QA 3TDEA 4EATA 3AY0A 4LF6C 1YGTA 3A4IA 3CQ2A 1HH2P 3UEBA 3UZ0A 4D57A 4K0BA 4XX2A 4LF8C 2UXCC 3LNOA 2P20A 1KKGA 2MCQA 1M6XC 2VSQA 2M5OA 1IBMC 2UXDC 1GPMA 3T1HC 3UOWA 3EQ6A 2YCBA 5BSRA 2AYAA 3GR0A 4JI6C 4B3RC 3N54B 4B3TC 1VLAA 1J5EC 2PT7G 1XHJA 1PG4A 4L2ZA 3R9XA 4GXQA 5IFIA 3I07A 1O92A 4RM2A 1ZB9A 4LFAC 4D4IA 4LFBC 2D1TA 3NPDA 3I08A 3LGXA 1RY2A 5KYTA 3DLPX 4ISBA 3A25A 2Y4NA 1MXAA 4NOZA 1O90A 4ZJZA 3FM7A 3A26A 2E8FA 4JI2C 1HR0C 3T1YC 4B3SC 4LF9C 2BH1X 4DV0C 4BSZA 4FTFA 4BC7A 3VNRA 2ONFA 2F4VC 1USPB 2ZTBA 2OO4A 2UUCC 3CQ3A 3TQIA 4DR7C 4DCUA 4JI5C 1N33C 3NYQA 1XRBA 5A2QD 2E8EA 4JI3C 1V26A 4LF7C 1P7LA 1IBLC 5LCIA 2OPLB 4DV1C 1N36C 5IWAC 4YHHC 4WS9A 5BUQA 2KDNA 2D27A 1MDFA 2CXCA 2QL8A 4LE5A 4PUIA 4RMNA 1I94C 4HPVA 4JI1C 4AQYC 4FUTA 4JV5C 5K85A 4R1LA 4WV3A 1AMUA 2KZFA 2CY1A 1XS3A 4BBYA 4G1IA 2QVZX 1N2FA 1O93A 3EERA 1MDBA 3GKUA 4ODJA 4X65C 4DUYC 4OXIA 1XNQC 2NCLA 2YWCA 4GKJC 5LMUC 1T5DX 3E7XA 4PZPA 2ASBA 4R0MA 3CJEA 4I9FA 3VNQA 4DR6C 4R1MA 3RV2A 5CZVA 2VZEA 3ETCA 3R44A 2ZM6C 4DR5C 4PHTA 4NXMC 4DV5C 3LUSA 1XMQC 2PN2A 3S82A 4PUGA 4X66C 1V60A 3OTOC 4D56A 3L95X 4U5YD 1PA4A 2UUAC 3N2QA 4FUQA 1QWIA 2VQFC 2D1SA 2D1RA 4BC9A 4L4QA 4MH4A 2HJGA 3AF5A 5LMNC 4DCTA 3J7AD 4DV6C 1XDXA 2PROA 4DG8A 3IMLA 3PROC
chains in the Genus database with same CATH topology
4LFCC 4JI4C 1WF3A 5A1IA 2D28C 2P2BA 2YWBA 1XNRC 5BSMA 2XR1A 5T8TA 5JRHA 1JOSA 2E0GA 4NDNA 3FCCA 2E8CA 1T5HX 3NYRA 4I9GA 2Y4OA 5AE1A 3JAMD 4GS5A 4DV2C 3DHVA 4OYCA 1LCIA 4YY3C 3L8CA 2UXBC 5BURA 4KTTA 2E7GA 1K0RA 5GTDA 1BA3A 1MD9A 3R9WA 4TPSB 2WP0C 4B3MC 2D1QA 3A9UA 1HNZC 3E7WA 4DCVA 3A9VA 4KTVA 5FLXD 2D7VA 2EGTA 1EGAA 2P2MA 3LNVA 3CW9A 1MXCA 5H9UA 5AE2A 1YJ7A 5BSTA 4JI0C 2UUBC 5K8FA 1ML8A 2QVYX 4KHPC 4X62C 4PROC 5A19A 4DV4C 4DV7C 2UU9C 4JM1A 1L2FA 1RG9A 4RVOA 4GKKC 3AF6A 2QW0X 4JI8C 5KYVA 5KEIA 1ULTA 2P2FA 3PESA 3TUFA 2WD9A 4OX9C 4DG9A 2E5LC 4LF4C 3NI2A 3DAYA 4IR7A 3H2TA 4DUZC 1WH9A 5BUSA 1LQLA 3IEVA 4JYAC 4NXNC 2DPLA 1XMOC 2Y27A 3SO4A 2HHHC 3ETOA 1IBKC 1N34C 2QVXX 3IEUA 4BCAA 1HNXC 2VQEC 5BSWA 4G36A 1O9TA 2JMPA 1UKKA 3VNSA 3PBKA 3GR1A 4D4GA 3J81D 4DCSA 4RVNA 5IT9D 1FJGC 3G7SA 1MXBA 2DYJA 2P2QA 5CZXA 3KXWA 2P2JA 4X64C 3RG2A 4RLQA 3FCEA 4JI7C 4K0KC 2P02A 1XRAA 1MKYA 4DR2C 5AE3A 4G37A 1V25A 3IPLA 3GPCA 3J80D 5T8SA 2OBVA 4RLFA 2BJOA 3CW8X 5BSVA 4ZLPA 5BSUA 4DV3C 1USPA 2V7BA 1HNWC 5DV9A 1FUGA 3B7WA 3C5EA 4GXRA 3LAXA 4DR1C 1N32C 1NYEA 1ZB8A 4DR3C 2OPLA 4LF5C 1PG3A 2ATWA 5BR8C 4MTNA 4DR4C 4L7IA 4RM3A 4IZ6A 1QM4A 5A1GA 1XRCA 5ADZA 5E7QA 3TDEA 4EATA 4LF6C 3A4IA 1HH2P 3UZ0A 4D57A 4K0BA 4XX2A 4LF8C 2UXCC 2P20A 1KKGA 2VSQA 1IBMC 2UXDC 1GPMA 3T1HC 3UOWA 3EQ6A 2YCBA 5BSRA 2AYAA 3GR0A 4JI6C 4B3RC 3N54B 4B3TC 1VLAA 1J5EC 2PT7G 1PG4A 4L2ZA 3R9XA 4GXQA 5IFIA 3I07A 1O92A 4RM2A 1ZB9A 4LFAC 4D4IA 4LFBC 2D1TA 3NPDA 3I08A 3LGXA 1RY2A 5KYTA 3DLPX 4ISBA 2Y4NA 1MXAA 4NOZA 1O90A 4ZJZA 2E8FA 4JI2C 1HR0C 3T1YC 4B3SC 4LF9C 2BH1X 4DV0C 4BSZA 4FTFA 4BC7A 3VNRA 2ONFA 2F4VC 1USPB 2OO4A 2UUCC 3TQIA 4DR7C 4DCUA 4JI5C 1N33C 3NYQA 1XRBA 5A2QD 2E8EA 4JI3C 1V26A 4LF7C 1P7LA 1IBLC 2OPLB 4DV1C 1N36C 5IWAC 4YHHC 4WS9A 5BUQA 2D27A 1MDFA 2CXCA 2QL8A 4LE5A 1I94C 4RMNA 4HPVA 4JI1C 4AQYC 4FUTA 4JV5C 5K85A 4R1LA 4WV3A 1AMUA 2KZFA 2CY1A 4BBYA 4G1IA 2QVZX 1N2FA 1O93A 3EERA 1MDBA 3GKUA 4ODJA 4X65C 4DUYC 4OXIA 1XNQC 2YWCA 4GKJC 5LMUC 1T5DX 3E7XA 4PZPA 2ASBA 4R0MA 3CJEA 4I9FA 3VNQA 4DR6C 4R1MA 3RV2A 5CZVA 2VZEA 3ETCA 3R44A 2ZM6C 4DR5C 4PHTA 4NXMC 4DV5C 3LUSA 1XMQC 2PN2A 3S82A 4X66C 3OTOC 4D56A 3L95X 4U5YD 1PA4A 2UUAC 3N2QA 4FUQA 1QWIA 2VQFC 2D1SA 2D1RA 4BC9A 4L4QA 4MH4A 2HJGA 3AF5A 5LMNC 4DCTA 3J7AD 4DV6C 2PROA 4DG8A 3IMLA 3PROC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 C;  1IBL C;  4LFC C;  4JI4 C;  1WF3 A;  2OPL B;  1HNW C;  4DV1 C;  1N36 C;  5IWA C;  4DV4 C;  1XNR C;  4YHH C;  4DV7 C;  2XR1 A;  2UU9 C;  2CXC A;  2QL8 A;  1I94 C;  1JOS A;  1L2F A;  4GKK C;  3AF6 A;  2E8C A;  4DR1 C;  1N32 C;  1NYE A;  4JI1 C;  4AQY C;  1ZB8 A;  4DR3 C;  4JI8 C;  2OPL A;  4LF5 C;  4JV5 C;  2ATW A;  5BR8 C;  4MTN A;  3JAM D;  4DR4 C;  2KZF A;  2CY1 A;  4OX9 C;  2E5L C;  4DV2 C;  1N2F A;  4LF6 C;  3EER A;  4LF4 C;  1HH2 P;  4YY3 C;  3GKU A;  4DUZ C;  2UXB C;  4XX2 A;  4LF8 C;  2UXC C;  4X65 C;  4DUY C;  1KKG A;  1WH9 A;  1XNQ C;  2E7G A;  1K0R A;  1LQL A;  1IBM C;  4GKJ C;  2UXD C;  5LMU C;  3IEV A;  3T1H C;  2ASB A;  4JYA C;  2YCB A;  4NXN C;  3CJE A;  1XMO C;  4JI6 C;  4DR6 C;  2HHH C;  4B3R C;  1IBK C;  4B3T C;  1N34 C;  1VLA A;  1J5E C;  2PT7 G;  3IEU A;  1HNX C;  2VQE C;  3R9X A;  3R9W A;  2ZM6 C;  3I07 A;  4DR5 C;  2JMP A;  4B3M C;  4LFA C;  1UKK A;  1ZB9 A;  4NXM C;  4DV5 C;  3LUS A;  1HNZ C;  4LFB C;  1XMQ C;  3J81 D;  4DCS A;  5IT9 D;  4DCV A;  2PN2 A;  1FJG C;  4X66 C;  3OTO C;  4NOZ A;  5FLX D;  2E8F A;  2D7V A;  2EGT A;  1EGA A;  4JI2 C;  2DYJ A;  4X64 C;  1HR0 C;  1PA4 A;  3T1Y C;  2UUA C;  4B3S C;  4JI7 C;  4K0K C;  4LF9 C;  1QWI A;  4DV0 C;  1MKY A;  4DR2 C;  2VQF C;  4BSZ A;  2ONF A;  2F4V C;  1USP B;  3J80 D;  4MH4 A;  2UUC C;  2HJG A;  3AF5 A;  5LMN C;  2BJO A;  4JI0 C;  4DCT A;  4DR7 C;  2UUB C;  4DCU A;  4JI5 C;  3J7A D;  1N33 C;  4DV6 C;  5A2Q D;  1ML8 A;  2E8E A;  4JI3 C;  4LF7 C;  4DV3 C;  1USP A;  4KHP C; 
#chains in the Genus database with same CATH topology
 4LFC C;  4JI4 C;  1WF3 A;  5A1I A;  2D28 C;  2P2B A;  2YWB A;  1XNR C;  5BSM A;  2XR1 A;  5T8T A;  5JRH A;  2MM9 A;  1JOS A;  2E0G A;  4NDN A;  3FCC A;  2E8C A;  1T5H X;  3NYR A;  4I9G A;  2Y4O A;  3K6R A;  5AE1 A;  3JAM D;  4GS5 A;  4DV2 C;  3DHV A;  4OYC A;  1LCI A;  4YY3 C;  3L8C A;  2UXB C;  5BUR A;  4KTT A;  4PUH A;  2E7G A;  1K0R A;  5GTD A;  2M5H A;  1BA3 A;  1MD9 A;  1P4E C;  2Z51 A;  3R9W A;  3CQ1 A;  4TPS B;  2WP0 C;  4B3M C;  2D1Q A;  3A9U A;  1HNZ C;  3E7W A;  4DCV A;  3A9V A;  4KTV A;  2CU6 A;  5FLX D;  2D7V A;  2EGT A;  1EGA A;  1VEH A;  2P2M A;  3LNV A;  3CW9 A;  1IB8 A;  1MXC A;  5H9U A;  5AE2 A;  2MMA B;  3UX3 A;  2KZ0 A;  1YJ7 A;  5BST A;  4JI0 C;  1TH5 A;  2UUB C;  5K8F A;  1PU1 A;  1ML8 A;  2QVY X;  4KHP C;  4X62 C;  4PRO C;  5A19 A;  4DV4 C;  4DV7 C;  2UU9 C;  4JM1 A;  1L2F A;  1RG9 A;  4RVO A;  4GKK C;  3AF6 A;  1P4E A;  2QW0 X;  2PG1 E;  4JI8 C;  5KYV A;  5KEI A;  1ULT A;  2P2F A;  3PES A;  3TUF A;  2WD9 A;  4OX9 C;  4DG9 A;  1UWD A;  2E5L C;  4LF4 C;  3NI2 A;  3DAY A;  4IR7 A;  3H2T A;  4DUZ C;  3TR3 A;  2JNV A;  1WH9 A;  1NY8 A;  5BUS A;  1LQL A;  1FLO A;  3IEV A;  4JYA C;  4NXN C;  2DPL A;  1XMO C;  2Y27 A;  3SO4 A;  2HHH C;  3ETO A;  1IBK C;  1N34 C;  2QVX X;  3IEU A;  4BCA A;  1HNX C;  2VQE C;  5BSW A;  4G36 A;  2DHM A;  1O9T A;  2JMP A;  1UKK A;  3VNS A;  3PBK A;  3GR1 A;  4D4G A;  3J81 D;  4DCS A;  4RVN A;  5IT9 D;  1FJG C;  2ZZM A;  3G7S A;  1MXB A;  2DYJ A;  2P2Q A;  5CZX A;  3KXW A;  2P2J A;  4X64 C;  3RG2 A;  4RLQ A;  3FCE A;  4JI7 C;  4K0K C;  2P02 A;  1XRA A;  1MKY A;  4DR2 C;  5AE3 A;  1M6X A;  4G37 A;  3O2E A;  1V25 A;  3IPL A;  3GPC A;  3J80 D;  5T8S A;  2OBV A;  2YX1 A;  2ZZN A;  4RLF A;  2BJO A;  3CW8 X;  3UX2 A;  5BSV A;  4ZLP A;  5BSU A;  4DV3 C;  1USP A;  2V7B A;  1WCJ A;  1HNW C;  5DV9 A;  1FUG A;  3B7W A;  3C5E A;  4GXR A;  3LAX A;  4DR1 C;  1N32 C;  1NYE A;  1ZB8 A;  4DR3 C;  2OPL A;  4LF5 C;  1PG3 A;  2ATW A;  5BR8 C;  4MTN A;  4DR4 C;  4L7I A;  4RM3 A;  4IZ6 A;  1QM4 A;  5A1G A;  1XRC A;  5ADZ A;  5E7Q A;  3TDE A;  4EAT A;  3AY0 A;  4LF6 C;  1YGT A;  3A4I A;  3CQ2 A;  1HH2 P;  3UEB A;  3UZ0 A;  4D57 A;  4K0B A;  4XX2 A;  4LF8 C;  2UXC C;  3LNO A;  2P20 A;  1KKG A;  2MCQ A;  1M6X C;  2VSQ A;  2M5O A;  1IBM C;  2UXD C;  1GPM A;  3T1H C;  3UOW A;  3EQ6 A;  2YCB A;  5BSR A;  2AYA A;  3GR0 A;  4JI6 C;  4B3R C;  3N54 B;  4B3T C;  1VLA A;  1J5E C;  2PT7 G;  1XHJ A;  1PG4 A;  4L2Z A;  3R9X A;  4GXQ A;  5IFI A;  3I07 A;  1O92 A;  4RM2 A;  1ZB9 A;  4LFA C;  4D4I A;  4LFB C;  2D1T A;  3NPD A;  3I08 A;  3LGX A;  1RY2 A;  5KYT A;  3DLP X;  4ISB A;  3A25 A;  2Y4N A;  1MXA A;  4NOZ A;  1O90 A;  4ZJZ A;  3FM7 A;  3A26 A;  2E8F A;  4JI2 C;  1HR0 C;  3T1Y C;  4B3S C;  4LF9 C;  2BH1 X;  4DV0 C;  4BSZ A;  4FTF A;  4BC7 A;  3VNR A;  2ONF A;  2F4V C;  1USP B;  2ZTB A;  2OO4 A;  2UUC C;  3CQ3 A;  3TQI A;  4DR7 C;  4DCU A;  4JI5 C;  1N33 C;  3NYQ A;  1XRB A;  5A2Q D;  2E8E A;  4JI3 C;  1V26 A;  4LF7 C;  1P7L A;  1IBL C;  5LCI A;  2OPL B;  4DV1 C;  1N36 C;  5IWA C;  4YHH C;  4WS9 A;  5BUQ A;  2KDN A;  2D27 A;  1MDF A;  2CXC A;  2QL8 A;  4LE5 A;  4PUI A;  4RMN A;  1I94 C;  4HPV A;  4JI1 C;  4AQY C;  4FUT A;  4JV5 C;  5K85 A;  4R1L A;  4WV3 A;  1AMU A;  2KZF A;  2CY1 A;  1XS3 A;  4BBY A;  4G1I A;  2QVZ X;  1N2F A;  1O93 A;  3EER A;  1MDB A;  3GKU A;  4ODJ A;  4X65 C;  4DUY C;  4OXI A;  1XNQ C;  2NCL A;  2YWC A;  4GKJ C;  5LMU C;  1T5D X;  3E7X A;  4PZP A;  2ASB A;  4R0M A;  3CJE A;  4I9F A;  3VNQ A;  4DR6 C;  4R1M A;  3RV2 A;  5CZV A;  2VZE A;  3ETC A;  3R44 A;  2ZM6 C;  4DR5 C;  4PHT A;  4NXM C;  4DV5 C;  3LUS A;  1XMQ C;  2PN2 A;  3S82 A;  4PUG A;  4X66 C;  1V60 A;  3OTO C;  4D56 A;  3L95 X;  4U5Y D;  1PA4 A;  2UUA C;  3N2Q A;  4FUQ A;  1QWI A;  2VQF C;  2D1S A;  2D1R A;  4BC9 A;  4L4Q A;  4MH4 A;  2HJG A;  3AF5 A;  5LMN C;  4DCT A;  3J7A D;  4DV6 C;  1XDX A;  2PRO A;  4DG8 A;  3IML A;  3PRO C; 
#chains in the Genus database with same CATH homology
 4LFC C;  4JI4 C;  1WF3 A;  5A1I A;  2D28 C;  2P2B A;  2YWB A;  1XNR C;  5BSM A;  2XR1 A;  5T8T A;  5JRH A;  1JOS A;  2E0G A;  4NDN A;  3FCC A;  2E8C A;  1T5H X;  3NYR A;  4I9G A;  2Y4O A;  5AE1 A;  3JAM D;  4GS5 A;  4DV2 C;  3DHV A;  4OYC A;  1LCI A;  4YY3 C;  3L8C A;  2UXB C;  5BUR A;  4KTT A;  2E7G A;  1K0R A;  5GTD A;  1BA3 A;  1MD9 A;  3R9W A;  4TPS B;  2WP0 C;  4B3M C;  2D1Q A;  3A9U A;  1HNZ C;  3E7W A;  4DCV A;  3A9V A;  4KTV A;  5FLX D;  2D7V A;  2EGT A;  1EGA A;  2P2M A;  3LNV A;  3CW9 A;  1MXC A;  5H9U A;  5AE2 A;  1YJ7 A;  5BST A;  4JI0 C;  2UUB C;  5K8F A;  1ML8 A;  2QVY X;  4KHP C;  4X62 C;  4PRO C;  5A19 A;  4DV4 C;  4DV7 C;  2UU9 C;  4JM1 A;  1L2F A;  1RG9 A;  4RVO A;  4GKK C;  3AF6 A;  2QW0 X;  4JI8 C;  5KYV A;  5KEI A;  1ULT A;  2P2F A;  3PES A;  3TUF A;  2WD9 A;  4OX9 C;  4DG9 A;  2E5L C;  4LF4 C;  3NI2 A;  3DAY A;  4IR7 A;  3H2T A;  4DUZ C;  1WH9 A;  5BUS A;  1LQL A;  3IEV A;  4JYA C;  4NXN C;  2DPL A;  1XMO C;  2Y27 A;  3SO4 A;  2HHH C;  3ETO A;  1IBK C;  1N34 C;  2QVX X;  3IEU A;  4BCA A;  1HNX C;  2VQE C;  5BSW A;  4G36 A;  1O9T A;  2JMP A;  1UKK A;  3VNS A;  3PBK A;  3GR1 A;  4D4G A;  3J81 D;  4DCS A;  4RVN A;  5IT9 D;  1FJG C;  3G7S A;  1MXB A;  2DYJ A;  2P2Q A;  5CZX A;  3KXW A;  2P2J A;  4X64 C;  3RG2 A;  4RLQ A;  3FCE A;  4JI7 C;  4K0K C;  2P02 A;  1XRA A;  1MKY A;  4DR2 C;  5AE3 A;  4G37 A;  1V25 A;  3IPL A;  3GPC A;  3J80 D;  5T8S A;  2OBV A;  4RLF A;  2BJO A;  3CW8 X;  5BSV A;  4ZLP A;  5BSU A;  4DV3 C;  1USP A;  2V7B A;  1HNW C;  5DV9 A;  1FUG A;  3B7W A;  3C5E A;  4GXR A;  3LAX A;  4DR1 C;  1N32 C;  1NYE A;  1ZB8 A;  4DR3 C;  2OPL A;  4LF5 C;  1PG3 A;  2ATW A;  5BR8 C;  4MTN A;  4DR4 C;  4L7I A;  4RM3 A;  4IZ6 A;  1QM4 A;  5A1G A;  1XRC A;  5ADZ A;  5E7Q A;  3TDE A;  4EAT A;  4LF6 C;  3A4I A;  1HH2 P;  3UZ0 A;  4D57 A;  4K0B A;  4XX2 A;  4LF8 C;  2UXC C;  2P20 A;  1KKG A;  2VSQ A;  1IBM C;  2UXD C;  1GPM A;  3T1H C;  3UOW A;  3EQ6 A;  2YCB A;  5BSR A;  2AYA A;  3GR0 A;  4JI6 C;  4B3R C;  3N54 B;  4B3T C;  1VLA A;  1J5E C;  2PT7 G;  1PG4 A;  4L2Z A;  3R9X A;  4GXQ A;  5IFI A;  3I07 A;  1O92 A;  4RM2 A;  1ZB9 A;  4LFA C;  4D4I A;  4LFB C;  2D1T A;  3NPD A;  3I08 A;  3LGX A;  1RY2 A;  5KYT A;  3DLP X;  4ISB A;  2Y4N A;  1MXA A;  4NOZ A;  1O90 A;  4ZJZ A;  2E8F A;  4JI2 C;  1HR0 C;  3T1Y C;  4B3S C;  4LF9 C;  2BH1 X;  4DV0 C;  4BSZ A;  4FTF A;  4BC7 A;  3VNR A;  2ONF A;  2F4V C;  1USP B;  2OO4 A;  2UUC C;  3TQI A;  4DR7 C;  4DCU A;  4JI5 C;  1N33 C;  3NYQ A;  1XRB A;  5A2Q D;  2E8E A;  4JI3 C;  1V26 A;  4LF7 C;  1P7L A;  1IBL C;  2OPL B;  4DV1 C;  1N36 C;  5IWA C;  4YHH C;  4WS9 A;  5BUQ A;  2D27 A;  1MDF A;  2CXC A;  2QL8 A;  4LE5 A;  1I94 C;  4RMN A;  4HPV A;  4JI1 C;  4AQY C;  4FUT A;  4JV5 C;  5K85 A;  4R1L A;  4WV3 A;  1AMU A;  2KZF A;  2CY1 A;  4BBY A;  4G1I A;  2QVZ X;  1N2F A;  1O93 A;  3EER A;  1MDB A;  3GKU A;  4ODJ A;  4X65 C;  4DUY C;  4OXI A;  1XNQ C;  2YWC A;  4GKJ C;  5LMU C;  1T5D X;  3E7X A;  4PZP A;  2ASB A;  4R0M A;  3CJE A;  4I9F A;  3VNQ A;  4DR6 C;  4R1M A;  3RV2 A;  5CZV A;  2VZE A;  3ETC A;  3R44 A;  2ZM6 C;  4DR5 C;  4PHT A;  4NXM C;  4DV5 C;  3LUS A;  1XMQ C;  2PN2 A;  3S82 A;  4X66 C;  3OTO C;  4D56 A;  3L95 X;  4U5Y D;  1PA4 A;  2UUA C;  3N2Q A;  4FUQ A;  1QWI A;  2VQF C;  2D1S A;  2D1R A;  4BC9 A;  4L4Q A;  4MH4 A;  2HJG A;  3AF5 A;  5LMN C;  4DCT A;  3J7A D;  4DV6 C;  2PRO A;  4DG8 A;  3IML A;  3PRO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...