4LFAC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfaC02
3R9WA 2E8CA 2QL8A 2HHHC 4OX9C 2F4VC 3JAMD 2OPLA 2UXBC 4YY3C 4JI2C 1WH9A 4YHHC 1N33C 4LF5C 4JYAC 4DR3C 2YCBA 5FLXD 5A2QD 4DCSA 2UXCC 1HH2P 1USPA 1XMOC 3J80D 4NXNC 4X64C 1JOSA 4BSZA 1N36C 2CY1A 5IT9D 4JV5C 4DUZC 1IBLC 1QWIA 1UKKA 2UXDC 4MH4A 3T1HC 1IBMC 4JI6C 4LF7C 2DYJA 1HNWC 2ASBA 3T1YC 4LFCC 5IWAC 4DV0C 4B3TC 2OPLB 1XNRC 2CXCA 2ATWA 4K0KC 4X62C 3J7AD 3CJEA 1USPB 4X65C 3J81D 2E8FA 1ZB9A 4JI8C 4DR7C 4DCUA 1N34C 1NYEA 1HNZC 2BJOA 4JI0C 4KHPC 1WF3A 2ZM6C 2VQFC 4X66C 4B3RC 3OTOC 3LUSA 1K0RA 4LF4C 4DUYC 2EGTA 1ZB8A 1J5EC 1N32C 1IBKC 4NOZA 4AQYC 4DV2C 2E8EA 4B3MC 4JI1C 2JMPA 3R9XA 4DR1C 1I94C 4JI4C 4GKJC 4NXMC 1HR0C 4DV3C 4DR4C 1VLAA 4LFAC 2D7VA 2E7GA 3IEVA 2PT7G 1PA4A 2HJGA 2UUCC 1KKGA 2PN2A 2KZFA 1ML8A 4DR6C 4JI5C 4DR5C 1LQLA 1XNQC 4DV4C 2VQEC 2XR1A 2UU9C 2UUAC 3AF5A 4B3SC 4DV7C 4DCVA 3GKUA 5LMUC 1L2FA 5LMNC 4XX2A 2E5LC 4DV1C 4LF6C 2ONFA 4JI3C 3I07A 4MTNA 4GKKC 4JI7C 4DV5C 3EERA 5BR8C 1N2FA 3IEUA 3AF6A 4DV6C 4LFBC 4DCTA 2UUBC 1FJGC 1XMQC 1EGAA 4LF9C 1MKYA 1HNXC 4DR2C 4LF8C
chains in the Genus database with same CATH superfamily
1MDFA 2QL8A 2HHHC 5A1GA 2UXBC 4YY3C 5AE1A 4JI2C 2DPLA 4PROC 2P2BA 4PUHA 2YX1A 3TDEA 3KXWA 4BSZA 1N36C 2V7BA 2YWBA 4JV5C 1RG9A 2UXDC 1IB8A 4JI6C 3L95X 4LF7C 3C5EA 4I9GA 4L7IA 1XNRC 4RMNA 2CXCA 3A9UA 2YWCA 4L2ZA 2Z51A 4K0KC 4PZPA 1ZB9A 4DR7C 4DCUA 4NDNA 2D1SA 4HPVA 4LE5A 4JI0C 2VQFC 2Y27A 3OTOC 4RVOA 1K0RA 1TH5A 2OO4A 3IMLA 1MD9A 2D1TA 2PG1E 1P4EC 4AQYC 4B3MC 1V25A 3ETOA 4NXMC 4DR4C 3A25A 2E7GA 2D28C 2NCLA 2PT7G 1PA4A 2D1QA 2KZFA 4JI5C 4DR5C 1NY8A 3CQ1A 4FTFA 1V26A 5LMUC 5GTDA 4XX2A 2VSQA 5KYVA 5BURA 4JI7C 4BC7A 1XS3A 4LFBC 4DG8A 1FJGC 4BBYA 1HNXC 3NYQA 3A4IA 2E8CA 2WP0C 3CW9A 2F4VC 3JAMD 2OPLA 3CQ2A 4DR3C 3UX3A 2YCBA 4DCSA 1HH2P 3UX2A 1XHJA 5AE2A 1IBLC 1QWIA 3IPLA 3CQ3A 1IBMC 1HNWC 2ASBA 3UZ0A 4TPSB 3VNSA 5IWAC 1AMUA 4DG9A 3PROC 3H2TA 5K8FA 1MDBA 4RLFA 2ATWA 4X62C 1USPB 4X65C 3J81D 1RY2A 2E8FA 4IZ6A 2P02A 2P2FA 1NYEA 2QVZX 5H9UA 4KHPC 4X66C 3FCCA 3PESA 3EQ6A 4DUYC 1YGTA 3B7WA 4PUGA 1P7LA 4GXRA 5BSTA 2WD9A 3A26A 1FLOA 4DV2C 4OXIA 1ULTA 2JMPA 1I94C 4GKJC 1HR0C 1O92A 1UWDA 3FM7A 2D7VA 3GPCA 4D56A 5BUQA 5KYTA 1BA3A 5AE3A 1M6XA 2PN2A 4WV3A 4U5YD 3CW8X 1QM4A 5IFIA 3L8CA 5A1IA 3A9VA 2UUAC 4B3SC 1O90A 2KZ0A 2ZTBA 1L2FA 5LMNC 3GR0A 4WS9A 4RLQA 4MTNA 4DV5C 3EERA 5BR8C 1N2FA 3AF6A 5A19A 2UUBC 3G7SA 1XMQC 1EGAA 4LF9C 4DR2C 3R9WA 4OX9C 3DAYA 4LF5C 2E0GA 4D4GA 5KEIA 5FLXD 2UXCC 3TUFA 3J80D 5LCIA 2CY1A 5T8SA 5E7QA 3SO4A 4DUZC 3LAXA 3S82A 1UKKA 1O9TA 4OYCA 3E7WA 1LCIA 1FUGA 4IR7A 3GR1A 3T1YC 4LFCC 5BUSA 4B3TC 1PG4A 1T5HX 5BSUA 3LNOA 3J7AD 2P2QA 4JI8C 2CU6A 2D27A 4R1MA 4RM3A 2BJOA 2ZZNA 3RV2A 2MCQA 1WF3A 1MXAA 2QW0X 3LUSA 3TQIA 4PHTA 3K6RA 1P4EA 2EGTA 1ZB8A 2AYAA 3E7XA 5K85A 4G36A 3VNRA 1N32C 3NI2A 4NOZA 4JI1C 3R9XA 5T8TA 4JI4C 5CZVA 4ISBA 1MXCA 1VLAA 3FCEA 2P2MA 4FUTA 1VEHA 5ADZA 2HJGA 3NYRA 2UUCC 3VNQA 2Y4OA 1XRBA 4KTTA 1ML8A 4R0MA 3UEBA 1LQLA 4DV4C 3RG2A 4I9FA 2VQEC 2UU9C 2E5LC 5JRHA 2ONFA 4JI3C 4BC9A 2QVXX 3I07A 5BSWA 2Y4NA 4D57A 3N54B 4DCTA 4FUQA 2MMAB 4D4IA 1MKYA 3IEVA 1PU1A 4LF8C 3N2QA 2BH1X 4G37A 1WH9A 2D1RA 3R44A 4YHHC 4JYAC 4EATA 1N33C 5A2QD 2ZZMA 2P20A 3O2EA 1USPA 4L4QA 3TR3A 1O93A 1XMOC 3AY0A 4NXNC 4X64C 1JOSA 1PG3A 1WCJA 5IT9D 5CZXA 4PUIA 4MH4A 3T1HC 2DYJA 4BCAA 3ETCA 4KTVA 4DV0C 1XRCA 2OPLB 1T5DX 1XRAA 4RM2A 3CJEA 1N34C 4GS5A 1HNZC 2ZM6C 4B3RC 5BSVA 4JM1A 2P2JA 4LF4C 2PROA 2M5HA 2JNVA 1J5EC 3LGXA 4ODJA 1IBKC 2E8EA 4K0BA 1YJ7A 4DR1C 3DLPX 3I08A 4DV3C 2DHMA 5BSRA 4LFAC 5BSMA 4ZLPA 5DV9A 2OBVA 2QVYX 1KKGA 2MM9A 3UOWA 2M5OA 1M6XC 2VZEA 3DHVA 4RVNA 4DR6C 3NPDA 1XNQC 3LNVA 2XR1A 1XDXA 3AF5A 1GPMA 4DV7C 4DCVA 3GKUA 4DV1C 4LF6C 4R1LA 4GKKC 4G1IA 4ZJZA 1MXBA 1V60A 3IEUA 4GXQA 4DV6C 2KDNA 3PBKA
chains in the Genus database with same CATH topology
1MDFA 2QL8A 2HHHC 5A1GA 2UXBC 4YY3C 5AE1A 4JI2C 2DPLA 4PROC 2P2BA 3TDEA 3KXWA 4BSZA 1N36C 2V7BA 2YWBA 4JV5C 1RG9A 2UXDC 4JI6C 3L95X 4LF7C 3C5EA 4I9GA 4L7IA 1XNRC 4RMNA 2CXCA 3A9UA 2YWCA 4L2ZA 4K0KC 4PZPA 1ZB9A 4DR7C 4DCUA 4NDNA 2D1SA 4HPVA 4LE5A 4JI0C 2VQFC 2Y27A 3OTOC 4RVOA 1K0RA 2OO4A 3IMLA 1MD9A 2D1TA 4AQYC 4B3MC 1V25A 3ETOA 4NXMC 4DR4C 2E7GA 2D28C 2PT7G 1PA4A 2D1QA 2KZFA 4JI5C 4DR5C 4FTFA 1V26A 5LMUC 5GTDA 4XX2A 2VSQA 5KYVA 5BURA 4JI7C 4BC7A 4LFBC 4DG8A 1FJGC 4BBYA 1HNXC 3NYQA 3A4IA 2E8CA 2WP0C 3CW9A 2F4VC 3JAMD 2OPLA 4DR3C 2YCBA 4DCSA 1HH2P 5AE2A 1IBLC 1QWIA 3IPLA 1IBMC 1HNWC 2ASBA 3UZ0A 4TPSB 3VNSA 5IWAC 1AMUA 4DG9A 3PROC 3H2TA 5K8FA 1MDBA 4RLFA 2ATWA 4X62C 1USPB 4X65C 3J81D 1RY2A 2E8FA 4IZ6A 2P02A 2P2FA 1NYEA 2QVZX 5H9UA 4KHPC 4X66C 3FCCA 3PESA 3EQ6A 4DUYC 3B7WA 1P7LA 4GXRA 5BSTA 2WD9A 4DV2C 4OXIA 1ULTA 2JMPA 1I94C 4GKJC 1HR0C 1O92A 2D7VA 3GPCA 4D56A 5BUQA 5KYTA 1BA3A 5AE3A 2PN2A 4WV3A 4U5YD 3CW8X 1QM4A 5IFIA 3L8CA 5A1IA 3A9VA 2UUAC 4B3SC 1O90A 1L2FA 5LMNC 3GR0A 4WS9A 4RLQA 4MTNA 4DV5C 3EERA 5BR8C 1N2FA 3AF6A 5A19A 2UUBC 3G7SA 1XMQC 1EGAA 4LF9C 4DR2C 3R9WA 4OX9C 3DAYA 4LF5C 2E0GA 4D4GA 5KEIA 5FLXD 2UXCC 3TUFA 3J80D 2CY1A 5T8SA 5E7QA 3SO4A 4DUZC 3LAXA 3S82A 1UKKA 1O9TA 4OYCA 3E7WA 1LCIA 1FUGA 4IR7A 3GR1A 3T1YC 4LFCC 5BUSA 4B3TC 1PG4A 1T5HX 5BSUA 3J7AD 2P2QA 4JI8C 2D27A 4R1MA 4RM3A 2BJOA 3RV2A 1WF3A 1MXAA 2QW0X 3LUSA 3TQIA 4PHTA 2EGTA 1ZB8A 2AYAA 3E7XA 5K85A 4G36A 3VNRA 1N32C 3NI2A 4NOZA 4JI1C 3R9XA 5T8TA 4JI4C 5CZVA 4ISBA 1MXCA 1VLAA 3FCEA 2P2MA 4FUTA 5ADZA 2HJGA 3NYRA 2UUCC 3VNQA 2Y4OA 1XRBA 4KTTA 1ML8A 4R0MA 1LQLA 4DV4C 3RG2A 4I9FA 2VQEC 2UU9C 2E5LC 5JRHA 2ONFA 4JI3C 4BC9A 2QVXX 3I07A 5BSWA 2Y4NA 4D57A 3N54B 4DCTA 4FUQA 4D4IA 1MKYA 3IEVA 4LF8C 3N2QA 2BH1X 4G37A 1WH9A 2D1RA 3R44A 4YHHC 4JYAC 4EATA 1N33C 5A2QD 2P20A 1USPA 4L4QA 1XMOC 1O93A 4NXNC 4X64C 1JOSA 1PG3A 5IT9D 5CZXA 4MH4A 3T1HC 2DYJA 4BCAA 3ETCA 4KTVA 4DV0C 1XRCA 2OPLB 1T5DX 1XRAA 4RM2A 3CJEA 1N34C 4GS5A 1HNZC 2ZM6C 4B3RC 5BSVA 4JM1A 2P2JA 4LF4C 2PROA 1J5EC 3LGXA 4ODJA 1IBKC 2E8EA 4K0BA 1YJ7A 4DR1C 3DLPX 3I08A 4DV3C 5BSRA 4LFAC 5BSMA 4ZLPA 5DV9A 2OBVA 2QVYX 1KKGA 3UOWA 2VZEA 3DHVA 4RVNA 4DR6C 3NPDA 1XNQC 3LNVA 2XR1A 3AF5A 1GPMA 4DV7C 4DCVA 3GKUA 4DV1C 4LF6C 4R1LA 4GKKC 4G1IA 4ZJZA 1MXBA 3IEUA 4GXQA 4DV6C 3PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9W A;  2E8C A;  2QL8 A;  2HHH C;  4OX9 C;  2F4V C;  3JAM D;  2OPL A;  2UXB C;  4YY3 C;  4JI2 C;  1WH9 A;  4YHH C;  1N33 C;  4LF5 C;  4JYA C;  4DR3 C;  2YCB A;  5FLX D;  5A2Q D;  4DCS A;  2UXC C;  1HH2 P;  1USP A;  1XMO C;  3J80 D;  4NXN C;  4X64 C;  1JOS A;  4BSZ A;  1N36 C;  2CY1 A;  5IT9 D;  4JV5 C;  4DUZ C;  1IBL C;  1QWI A;  1UKK A;  2UXD C;  4MH4 A;  3T1H C;  1IBM C;  4JI6 C;  4LF7 C;  2DYJ A;  1HNW C;  2ASB A;  3T1Y C;  4LFC C;  5IWA C;  4DV0 C;  4B3T C;  2OPL B;  1XNR C;  2CXC A;  2ATW A;  4K0K C;  4X62 C;  3J7A D;  3CJE A;  1USP B;  4X65 C;  3J81 D;  2E8F A;  1ZB9 A;  4JI8 C;  4DR7 C;  4DCU A;  1N34 C;  1NYE A;  1HNZ C;  2BJO A;  4JI0 C;  4KHP C;  1WF3 A;  2ZM6 C;  2VQF C;  4X66 C;  4B3R C;  3OTO C;  3LUS A;  1K0R A;  4LF4 C;  4DUY C;  2EGT A;  1ZB8 A;  1J5E C;  1N32 C;  1IBK C;  4NOZ A;  4AQY C;  4DV2 C;  2E8E A;  4B3M C;  4JI1 C;  2JMP A;  3R9X A;  4DR1 C;  1I94 C;  4JI4 C;  4GKJ C;  4NXM C;  1HR0 C;  4DV3 C;  4DR4 C;  1VLA A;  4LFA C;  2D7V A;  2E7G A;  3IEV A;  2PT7 G;  1PA4 A;  2HJG A;  2UUC C;  1KKG A;  2PN2 A;  2KZF A;  1ML8 A;  4DR6 C;  4JI5 C;  4DR5 C;  1LQL A;  1XNQ C;  4DV4 C;  2VQE C;  2XR1 A;  2UU9 C;  2UUA C;  3AF5 A;  4B3S C;  4DV7 C;  4DCV A;  3GKU A;  5LMU C;  1L2F A;  5LMN C;  4XX2 A;  2E5L C;  4DV1 C;  4LF6 C;  2ONF A;  4JI3 C;  3I07 A;  4MTN A;  4GKK C;  4JI7 C;  4DV5 C;  3EER A;  5BR8 C;  1N2F A;  3IEU A;  3AF6 A;  4DV6 C;  4LFB C;  4DCT A;  2UUB C;  1FJG C;  1XMQ C;  1EGA A;  4LF9 C;  1MKY A;  1HNX C;  4DR2 C;  4LF8 C; 
#chains in the Genus database with same CATH topology
 1MDF A;  2QL8 A;  2HHH C;  5A1G A;  2UXB C;  4YY3 C;  5AE1 A;  4JI2 C;  2DPL A;  4PRO C;  2P2B A;  4PUH A;  2YX1 A;  3TDE A;  3KXW A;  4BSZ A;  1N36 C;  2V7B A;  2YWB A;  4JV5 C;  1RG9 A;  2UXD C;  1IB8 A;  4JI6 C;  3L95 X;  4LF7 C;  3C5E A;  4I9G A;  4L7I A;  1XNR C;  4RMN A;  2CXC A;  3A9U A;  2YWC A;  4L2Z A;  2Z51 A;  4K0K C;  4PZP A;  1ZB9 A;  4DR7 C;  4DCU A;  4NDN A;  2D1S A;  4HPV A;  4LE5 A;  4JI0 C;  2VQF C;  2Y27 A;  3OTO C;  4RVO A;  1K0R A;  1TH5 A;  2OO4 A;  3IML A;  1MD9 A;  2D1T A;  2PG1 E;  1P4E C;  4AQY C;  4B3M C;  1V25 A;  3ETO A;  4NXM C;  4DR4 C;  3A25 A;  2E7G A;  2D28 C;  2NCL A;  2PT7 G;  1PA4 A;  2D1Q A;  2KZF A;  4JI5 C;  4DR5 C;  1NY8 A;  3CQ1 A;  4FTF A;  1V26 A;  5LMU C;  5GTD A;  4XX2 A;  2VSQ A;  5KYV A;  5BUR A;  4JI7 C;  4BC7 A;  1XS3 A;  4LFB C;  4DG8 A;  1FJG C;  4BBY A;  1HNX C;  3NYQ A;  3A4I A;  2E8C A;  2WP0 C;  3CW9 A;  2F4V C;  3JAM D;  2OPL A;  3CQ2 A;  4DR3 C;  3UX3 A;  2YCB A;  4DCS A;  1HH2 P;  3UX2 A;  1XHJ A;  5AE2 A;  1IBL C;  1QWI A;  3IPL A;  3CQ3 A;  1IBM C;  1HNW C;  2ASB A;  3UZ0 A;  4TPS B;  3VNS A;  5IWA C;  1AMU A;  4DG9 A;  3PRO C;  3H2T A;  5K8F A;  1MDB A;  4RLF A;  2ATW A;  4X62 C;  1USP B;  4X65 C;  3J81 D;  1RY2 A;  2E8F A;  4IZ6 A;  2P02 A;  2P2F A;  1NYE A;  2QVZ X;  5H9U A;  4KHP C;  4X66 C;  3FCC A;  3PES A;  3EQ6 A;  4DUY C;  1YGT A;  3B7W A;  4PUG A;  1P7L A;  4GXR A;  5BST A;  2WD9 A;  3A26 A;  1FLO A;  4DV2 C;  4OXI A;  1ULT A;  2JMP A;  1I94 C;  4GKJ C;  1HR0 C;  1O92 A;  1UWD A;  3FM7 A;  2D7V A;  3GPC A;  4D56 A;  5BUQ A;  5KYT A;  1BA3 A;  5AE3 A;  1M6X A;  2PN2 A;  4WV3 A;  4U5Y D;  3CW8 X;  1QM4 A;  5IFI A;  3L8C A;  5A1I A;  3A9V A;  2UUA C;  4B3S C;  1O90 A;  2KZ0 A;  2ZTB A;  1L2F A;  5LMN C;  3GR0 A;  4WS9 A;  4RLQ A;  4MTN A;  4DV5 C;  3EER A;  5BR8 C;  1N2F A;  3AF6 A;  5A19 A;  2UUB C;  3G7S A;  1XMQ C;  1EGA A;  4LF9 C;  4DR2 C;  3R9W A;  4OX9 C;  3DAY A;  4LF5 C;  2E0G A;  4D4G A;  5KEI A;  5FLX D;  2UXC C;  3TUF A;  3J80 D;  5LCI A;  2CY1 A;  5T8S A;  5E7Q A;  3SO4 A;  4DUZ C;  3LAX A;  3S82 A;  1UKK A;  1O9T A;  4OYC A;  3E7W A;  1LCI A;  1FUG A;  4IR7 A;  3GR1 A;  3T1Y C;  4LFC C;  5BUS A;  4B3T C;  1PG4 A;  1T5H X;  5BSU A;  3LNO A;  3J7A D;  2P2Q A;  4JI8 C;  2CU6 A;  2D27 A;  4R1M A;  4RM3 A;  2BJO A;  2ZZN A;  3RV2 A;  2MCQ A;  1WF3 A;  1MXA A;  2QW0 X;  3LUS A;  3TQI A;  4PHT A;  3K6R A;  1P4E A;  2EGT A;  1ZB8 A;  2AYA A;  3E7X A;  5K85 A;  4G36 A;  3VNR A;  1N32 C;  3NI2 A;  4NOZ A;  4JI1 C;  3R9X A;  5T8T A;  4JI4 C;  5CZV A;  4ISB A;  1MXC A;  1VLA A;  3FCE A;  2P2M A;  4FUT A;  1VEH A;  5ADZ A;  2HJG A;  3NYR A;  2UUC C;  3VNQ A;  2Y4O A;  1XRB A;  4KTT A;  1ML8 A;  4R0M A;  3UEB A;  1LQL A;  4DV4 C;  3RG2 A;  4I9F A;  2VQE C;  2UU9 C;  2E5L C;  5JRH A;  2ONF A;  4JI3 C;  4BC9 A;  2QVX X;  3I07 A;  5BSW A;  2Y4N A;  4D57 A;  3N54 B;  4DCT A;  4FUQ A;  2MMA B;  4D4I A;  1MKY A;  3IEV A;  1PU1 A;  4LF8 C;  3N2Q A;  2BH1 X;  4G37 A;  1WH9 A;  2D1R A;  3R44 A;  4YHH C;  4JYA C;  4EAT A;  1N33 C;  5A2Q D;  2ZZM A;  2P20 A;  3O2E A;  1USP A;  4L4Q A;  3TR3 A;  1O93 A;  1XMO C;  3AY0 A;  4NXN C;  4X64 C;  1JOS A;  1PG3 A;  1WCJ A;  5IT9 D;  5CZX A;  4PUI A;  4MH4 A;  3T1H C;  2DYJ A;  4BCA A;  3ETC A;  4KTV A;  4DV0 C;  1XRC A;  2OPL B;  1T5D X;  1XRA A;  4RM2 A;  3CJE A;  1N34 C;  4GS5 A;  1HNZ C;  2ZM6 C;  4B3R C;  5BSV A;  4JM1 A;  2P2J A;  4LF4 C;  2PRO A;  2M5H A;  2JNV A;  1J5E C;  3LGX A;  4ODJ A;  1IBK C;  2E8E A;  4K0B A;  1YJ7 A;  4DR1 C;  3DLP X;  3I08 A;  4DV3 C;  2DHM A;  5BSR A;  4LFA C;  5BSM A;  4ZLP A;  5DV9 A;  2OBV A;  2QVY X;  1KKG A;  2MM9 A;  3UOW A;  2M5O A;  1M6X C;  2VZE A;  3DHV A;  4RVN A;  4DR6 C;  3NPD A;  1XNQ C;  3LNV A;  2XR1 A;  1XDX A;  3AF5 A;  1GPM A;  4DV7 C;  4DCV A;  3GKU A;  4DV1 C;  4LF6 C;  4R1L A;  4GKK C;  4G1I A;  4ZJZ A;  1MXB A;  1V60 A;  3IEU A;  4GXQ A;  4DV6 C;  2KDN A;  3PBK A; 
#chains in the Genus database with same CATH homology
 1MDF A;  2QL8 A;  2HHH C;  5A1G A;  2UXB C;  4YY3 C;  5AE1 A;  4JI2 C;  2DPL A;  4PRO C;  2P2B A;  3TDE A;  3KXW A;  4BSZ A;  1N36 C;  2V7B A;  2YWB A;  4JV5 C;  1RG9 A;  2UXD C;  4JI6 C;  3L95 X;  4LF7 C;  3C5E A;  4I9G A;  4L7I A;  1XNR C;  4RMN A;  2CXC A;  3A9U A;  2YWC A;  4L2Z A;  4K0K C;  4PZP A;  1ZB9 A;  4DR7 C;  4DCU A;  4NDN A;  2D1S A;  4HPV A;  4LE5 A;  4JI0 C;  2VQF C;  2Y27 A;  3OTO C;  4RVO A;  1K0R A;  2OO4 A;  3IML A;  1MD9 A;  2D1T A;  4AQY C;  4B3M C;  1V25 A;  3ETO A;  4NXM C;  4DR4 C;  2E7G A;  2D28 C;  2PT7 G;  1PA4 A;  2D1Q A;  2KZF A;  4JI5 C;  4DR5 C;  4FTF A;  1V26 A;  5LMU C;  5GTD A;  4XX2 A;  2VSQ A;  5KYV A;  5BUR A;  4JI7 C;  4BC7 A;  4LFB C;  4DG8 A;  1FJG C;  4BBY A;  1HNX C;  3NYQ A;  3A4I A;  2E8C A;  2WP0 C;  3CW9 A;  2F4V C;  3JAM D;  2OPL A;  4DR3 C;  2YCB A;  4DCS A;  1HH2 P;  5AE2 A;  1IBL C;  1QWI A;  3IPL A;  1IBM C;  1HNW C;  2ASB A;  3UZ0 A;  4TPS B;  3VNS A;  5IWA C;  1AMU A;  4DG9 A;  3PRO C;  3H2T A;  5K8F A;  1MDB A;  4RLF A;  2ATW A;  4X62 C;  1USP B;  4X65 C;  3J81 D;  1RY2 A;  2E8F A;  4IZ6 A;  2P02 A;  2P2F A;  1NYE A;  2QVZ X;  5H9U A;  4KHP C;  4X66 C;  3FCC A;  3PES A;  3EQ6 A;  4DUY C;  3B7W A;  1P7L A;  4GXR A;  5BST A;  2WD9 A;  4DV2 C;  4OXI A;  1ULT A;  2JMP A;  1I94 C;  4GKJ C;  1HR0 C;  1O92 A;  2D7V A;  3GPC A;  4D56 A;  5BUQ A;  5KYT A;  1BA3 A;  5AE3 A;  2PN2 A;  4WV3 A;  4U5Y D;  3CW8 X;  1QM4 A;  5IFI A;  3L8C A;  5A1I A;  3A9V A;  2UUA C;  4B3S C;  1O90 A;  1L2F A;  5LMN C;  3GR0 A;  4WS9 A;  4RLQ A;  4MTN A;  4DV5 C;  3EER A;  5BR8 C;  1N2F A;  3AF6 A;  5A19 A;  2UUB C;  3G7S A;  1XMQ C;  1EGA A;  4LF9 C;  4DR2 C;  3R9W A;  4OX9 C;  3DAY A;  4LF5 C;  2E0G A;  4D4G A;  5KEI A;  5FLX D;  2UXC C;  3TUF A;  3J80 D;  2CY1 A;  5T8S A;  5E7Q A;  3SO4 A;  4DUZ C;  3LAX A;  3S82 A;  1UKK A;  1O9T A;  4OYC A;  3E7W A;  1LCI A;  1FUG A;  4IR7 A;  3GR1 A;  3T1Y C;  4LFC C;  5BUS A;  4B3T C;  1PG4 A;  1T5H X;  5BSU A;  3J7A D;  2P2Q A;  4JI8 C;  2D27 A;  4R1M A;  4RM3 A;  2BJO A;  3RV2 A;  1WF3 A;  1MXA A;  2QW0 X;  3LUS A;  3TQI A;  4PHT A;  2EGT A;  1ZB8 A;  2AYA A;  3E7X A;  5K85 A;  4G36 A;  3VNR A;  1N32 C;  3NI2 A;  4NOZ A;  4JI1 C;  3R9X A;  5T8T A;  4JI4 C;  5CZV A;  4ISB A;  1MXC A;  1VLA A;  3FCE A;  2P2M A;  4FUT A;  5ADZ A;  2HJG A;  3NYR A;  2UUC C;  3VNQ A;  2Y4O A;  1XRB A;  4KTT A;  1ML8 A;  4R0M A;  1LQL A;  4DV4 C;  3RG2 A;  4I9F A;  2VQE C;  2UU9 C;  2E5L C;  5JRH A;  2ONF A;  4JI3 C;  4BC9 A;  2QVX X;  3I07 A;  5BSW A;  2Y4N A;  4D57 A;  3N54 B;  4DCT A;  4FUQ A;  4D4I A;  1MKY A;  3IEV A;  4LF8 C;  3N2Q A;  2BH1 X;  4G37 A;  1WH9 A;  2D1R A;  3R44 A;  4YHH C;  4JYA C;  4EAT A;  1N33 C;  5A2Q D;  2P20 A;  1USP A;  4L4Q A;  1XMO C;  1O93 A;  4NXN C;  4X64 C;  1JOS A;  1PG3 A;  5IT9 D;  5CZX A;  4MH4 A;  3T1H C;  2DYJ A;  4BCA A;  3ETC A;  4KTV A;  4DV0 C;  1XRC A;  2OPL B;  1T5D X;  1XRA A;  4RM2 A;  3CJE A;  1N34 C;  4GS5 A;  1HNZ C;  2ZM6 C;  4B3R C;  5BSV A;  4JM1 A;  2P2J A;  4LF4 C;  2PRO A;  1J5E C;  3LGX A;  4ODJ A;  1IBK C;  2E8E A;  4K0B A;  1YJ7 A;  4DR1 C;  3DLP X;  3I08 A;  4DV3 C;  5BSR A;  4LFA C;  5BSM A;  4ZLP A;  5DV9 A;  2OBV A;  2QVY X;  1KKG A;  3UOW A;  2VZE A;  3DHV A;  4RVN A;  4DR6 C;  3NPD A;  1XNQ C;  3LNV A;  2XR1 A;  3AF5 A;  1GPM A;  4DV7 C;  4DCV A;  3GKU A;  4DV1 C;  4LF6 C;  4R1L A;  4GKK C;  4G1I A;  4ZJZ A;  1MXB A;  3IEU A;  4GXQ A;  4DV6 C;  3PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...