4LFAC

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 52
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lfaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lfaC02
2CY1A 4DV6C 4KHPC 4LF8C 2F4VC 3IEUA 2UXDC 1ZB9A 2JMPA 1KKGA 3J7AD 1IBLC 4YY3C 2E8CA 1HR0C 1FJGC 4JI0C 4DCSA 4YHHC 4DV0C 2HHHC 4JYAC 1MKYA 3T1YC 4DR7C 1UKKA 1JOSA 1WF3A 4X64C 4DV5C 1USPA 1N36C 4DUYC 1IBKC 2HJGA 2UU9C 1VLAA 2PT7G 4DR1C 1XNQC 4DR3C 4NXNC 5A2QD 1USPB 1XMQC 4GKJC 1N2FA 4BSZA 5FLXD 3R9XA 1WH9A 2UUAC 4DR4C 5BR8C 3AF5A 2VQFC 1XNRC 2XR1A 2VQEC 4DUZC 4K0KC 1N33C 1HNWC 2BJOA 5LMNC 2ASBA 3R9WA 1NYEA 4DV2C 4LFBC 4NOZA 4JI2C 1HH2P 3JAMD 1LQLA 3T1HC 2EGTA 2E7GA 1EGAA 1ZB8A 1PA4A 4OX9C 2UXBC 1XMOC 4JV5C 4AQYC 2OPLA 4X65C 4GKKC 4DCVA 1J5EC 4XX2A 3EERA 2QL8A 2ATWA 4DR6C 2OPLB 4JI5C 5IWAC 1N34C 4B3TC 1N32C 2KZFA 1HNZC 2DYJA 4DCUA 4B3MC 2E8FA 2E8EA 2PN2A 1I94C 3LUSA 2D7VA 4NXMC 5LMUC 3GKUA 4JI6C 4DV7C 4MTNA 4MH4A 1QWIA 4DR2C 4LF5C 4B3SC 2ZM6C 4B3RC 3AF6A 1HNXC 1L2FA 4DR5C 4JI8C 4DCTA 4JI4C 2UUBC 4LFCC 4LF4C 3IEVA 1ML8A 2YCBA 2CXCA 3CJEA 4JI7C 2UUCC 4DV3C 4X62C 1IBMC 4LF6C 5IT9D 4LF9C 3OTOC 4DV4C 4LFAC 1K0RA 4LF7C 3J80D 4JI1C 2E5LC 4DV1C 3J81D 2UXCC 3I07A 4X66C 4JI3C 2ONFA
chains in the Genus database with same CATH superfamily
1O93A 4DV6C 1ZB9A 2JMPA 3J7AD 3UX3A 2D28C 1HR0C 4DV0C 1MKYA 4DR7C 3PBKA 4X64C 1USPA 1AMUA 2UU9C 1MXBA 1VLAA 4G36A 4NXNC 2P2BA 4BSZA 2QVZX 3PROC 1M6XA 3A9VA 4L2ZA 3UEBA 1XNRC 2VQEC 4K0KC 3UOWA 2P20A 3VNRA 4DV2C 2AYAA 4JI2C 3N54B 1HH2P 1MXCA 4LE5A 5H9UA 2OO4A 4FUTA 2EGTA 2E7GA 1PA4A 2Z51A 4OX9C 3L95X 4KTTA 2CU6A 2P2FA 3TR3A 5IFIA 3TDEA 2DPLA 1YJ7A 2OPLB 5IWAC 2D1QA 2NCLA 1BA3A 1N32C 2KZFA 4PROC 4WV3A 1MDBA 3DLPX 3FM7A 5T8SA 2PN2A 3LUSA 5LMUC 4JI6C 4RLQA 2Y4NA 4PHTA 4KTVA 4LF5C 4B3RC 1L2FA 4R1LA 4JM1A 4L7IA 4LF4C 1RG9A 2QVYX 2UUCC 3PESA 2WD9A 5IT9D 4LF9C 4DV4C 3NPDA 4GXRA 4HPVA 2QW0X 1V60A 4FUQA 4LF8C 2F4VC 3NYQA 4WS9A 4BC7A 2M5HA 2QVXX 1XHJA 2JNVA 4DG8A 4DV5C 1N36C 5E7QA 5KEIA 2PT7G 4FTFA 3GR1A 4TPSB 5A1GA 1USPB 4GKJC 5BURA 5CZVA 2E0GA 2P02A 5KYVA 1WH9A 5BUSA 4D56A 3CW8X 1P4EC 2XR1A 2YWBA 4DUZC 3DHVA 2D27A 3A25A 1N33C 4OXIA 1ULTA 2P2QA 3B7WA 1NYEA 1NY8A 2P2MA 1M6XC 4RM3A 3FCEA 5T8TA 4D57A 1ZB8A 2DHMA 5A19A 3C5EA 1YGTA 3I08A 4GKKC 4I9FA 2KZ0A 2Y27A 2QL8A 2V7BA 4DR6C 1GPMA 5AE2A 1FUGA 1QM4A 4I9GA 5AE3A 4DCUA 4RM2A 1FLOA 4B3MC 3E7WA 4U5YD 4NXMC 1P7LA 4DR2C 4B3SC 2ZTBA 1HNXC 4DR5C 4PUHA 4DG9A 4JI4C 2D1SA 3IEVA 1ML8A 2CXCA 1XRAA 5DV9A 4NDNA 4DV3C 1IBMC 5K8FA 4LF6C 3OTOC 1PG3A 1K0RA 4LF7C 5KYTA 3ETCA 3J81D 2UXCC 3SO4A 4X66C 1MDFA 3TQIA 5BSMA 3CQ2A 3ETOA 2PROA 2WP0C 5BSTA 4ZLPA 4D4IA 3IEUA 4G37A 2E8CA 1FJGC 4JI0C 1XRCA 4DCSA 4YHHC 4JYAC 3A9UA 3TUFA 4D4GA 3T1YC 1JOSA 1WF3A 3CQ3A 2BH1X 1TH5A 3UZ0A 1IBKC 3RG2A 1XNQC 4DR3C 1XS3A 5A2QD 2ZZMA 3A4IA 3LNVA 1XMQC 3EQ6A 5JRHA 5FLXD 2UUAC 5BR8C 3AF5A 2MMAB 1T5HX 2YX1A 5ADZA 1WCJA 4LFBC 2MCQA 4NOZA 3G7SA 2KDNA 4BCAA 3IPLA 1RY2A 1PU1A 4IZ6A 3JAMD 3T1HC 4EATA 1EGAA 4BBYA 3LAXA 3CQ1A 2ZZNA 4X65C 5GTDA 3FCCA 3EERA 4JI5C 4B3TC 1O9TA 3CW9A 3AY0A 4RVOA 5LCIA 2DYJA 4GXQA 3GR0A 3LGXA 1O90A 2E8FA 4DV7C 4MTNA 3H2TA 4JI8C 1XDXA 4ODJA 4DCTA 3DAYA 3K6RA 4LFCC 3L8CA 3R44A 3CJEA 5BSVA 3KXWA 4JI7C 4X62C 1P4EA 3J80D 3GPCA 4JI1C 2E5LC 3VNSA 4DV1C 4JI3C 2P2JA 3E7XA 2CY1A 4KHPC 3RV2A 1KKGA 2UXDC 1IBLC 2OBVA 4YY3C 2HHHC 2VSQA 4K0BA 1UKKA 1IB8A 2D1RA 1LCIA 4DUYC 2HJGA 4BC9A 4DR1C 1O92A 5BSUA 2YWCA 5AE1A 1N2FA 3UX2A 3R9XA 4DR4C 2VQFC 1UWDA 3O2EA 3N2QA 5A1IA 1HNWC 2BJOA 5LMNC 3S82A 2ASBA 3R9WA 1LQLA 5CZXA 2UXBC 1XRBA 1XMOC 5BSRA 4RVNA 2D1TA 4JV5C 4AQYC 2OPLA 1T5DX 1VEHA 1V26A 2M5OA 4L4QA 4DCVA 1J5EC 5BSWA 4XX2A 2PG1E 1MD9A 2ATWA 1N34C 1HNZC 4RLFA 2E8EA 2Y4OA 4ZJZA 4ISBA 3LNOA 4R0MA 1MXAA 1I94C 2D7VA 3GKUA 4RMNA 1PG4A 1QWIA 4MH4A 5BUQA 1V25A 3VNQA 2ZM6C 3AF6A 2UUBC 2VZEA 5K85A 2YCBA 4IR7A 4PUGA 2MM9A 3A26A 3NYRA 4LFAC 3NI2A 3IMLA 3I07A 4G1IA 4R1MA 4PZPA 4GS5A 4OYCA 2ONFA 4PUIA
chains in the Genus database with same CATH topology
1O93A 4DV6C 1ZB9A 2JMPA 3J7AD 2D28C 1HR0C 4DV0C 1MKYA 4DR7C 3PBKA 4X64C 1USPA 1AMUA 2UU9C 1MXBA 1VLAA 4G36A 4NXNC 2P2BA 4BSZA 2QVZX 3PROC 3A9VA 4L2ZA 1XNRC 2VQEC 4K0KC 3UOWA 2P20A 3VNRA 4DV2C 2AYAA 4JI2C 3N54B 1HH2P 1MXCA 4LE5A 5H9UA 2OO4A 4FUTA 2EGTA 2E7GA 1PA4A 4OX9C 3L95X 4KTTA 2P2FA 5IFIA 3TDEA 2DPLA 1YJ7A 2OPLB 5IWAC 2D1QA 1BA3A 1N32C 2KZFA 4PROC 4WV3A 1MDBA 3DLPX 5T8SA 2PN2A 3LUSA 5LMUC 4JI6C 4RLQA 2Y4NA 4PHTA 4KTVA 4LF5C 4B3RC 1L2FA 4R1LA 4JM1A 4L7IA 4LF4C 1RG9A 2QVYX 2UUCC 3PESA 2WD9A 5IT9D 4LF9C 4DV4C 3NPDA 4GXRA 4HPVA 2QW0X 4FUQA 4LF8C 2F4VC 3NYQA 4WS9A 4BC7A 2QVXX 4DG8A 4DV5C 1N36C 5E7QA 5KEIA 2PT7G 4FTFA 3GR1A 4TPSB 5A1GA 1USPB 4GKJC 5BURA 5CZVA 2E0GA 2P02A 5KYVA 1WH9A 5BUSA 4D56A 3CW8X 2XR1A 2YWBA 4DUZC 3DHVA 2D27A 1N33C 4OXIA 1ULTA 2P2QA 3B7WA 1NYEA 2P2MA 4RM3A 3FCEA 5T8TA 4D57A 1ZB8A 5A19A 3C5EA 3I08A 4GKKC 4I9FA 2Y27A 2QL8A 2V7BA 4DR6C 1GPMA 5AE2A 1FUGA 1QM4A 4I9GA 5AE3A 4DCUA 4RM2A 4B3MC 3E7WA 4U5YD 4NXMC 1P7LA 4DR2C 4B3SC 1HNXC 4DR5C 4DG9A 4JI4C 2D1SA 3IEVA 1ML8A 2CXCA 1XRAA 5DV9A 4NDNA 4DV3C 1IBMC 5K8FA 4LF6C 3OTOC 1PG3A 1K0RA 4LF7C 5KYTA 3ETCA 3J81D 2UXCC 3SO4A 4X66C 1MDFA 3TQIA 5BSMA 3ETOA 2PROA 2WP0C 5BSTA 4ZLPA 4D4IA 3IEUA 4G37A 2E8CA 1FJGC 4JI0C 1XRCA 4DCSA 4YHHC 4JYAC 3A9UA 3TUFA 4D4GA 3T1YC 1JOSA 1WF3A 2BH1X 3UZ0A 1IBKC 3RG2A 1XNQC 4DR3C 5A2QD 3A4IA 3LNVA 1XMQC 3EQ6A 5JRHA 5FLXD 2UUAC 5BR8C 3AF5A 1T5HX 5ADZA 4LFBC 4NOZA 3G7SA 4BCAA 3IPLA 3JAMD 3T1HC 1RY2A 4IZ6A 4EATA 1EGAA 4BBYA 3LAXA 4X65C 5GTDA 3FCCA 3EERA 4JI5C 4B3TC 1O9TA 3CW9A 4RVOA 2DYJA 4GXQA 3GR0A 3LGXA 1O90A 2E8FA 4DV7C 4MTNA 3H2TA 4JI8C 4ODJA 4DCTA 3DAYA 4LFCC 3L8CA 3R44A 3CJEA 5BSVA 3KXWA 4JI7C 4X62C 3J80D 3GPCA 4JI1C 2E5LC 3VNSA 4DV1C 4JI3C 2P2JA 3E7XA 2CY1A 4KHPC 3RV2A 1KKGA 2UXDC 1IBLC 2OBVA 4YY3C 2HHHC 2VSQA 4K0BA 1UKKA 2D1RA 1LCIA 4DUYC 2HJGA 4BC9A 4DR1C 1O92A 5BSUA 2YWCA 5AE1A 1N2FA 3R9XA 4DR4C 2VQFC 3N2QA 5A1IA 1HNWC 2BJOA 5LMNC 3S82A 2ASBA 3R9WA 1LQLA 5CZXA 2UXBC 1XRBA 1XMOC 5BSRA 4RVNA 2D1TA 4JV5C 4AQYC 2OPLA 1T5DX 1V26A 4L4QA 4DCVA 1J5EC 5BSWA 4XX2A 1MD9A 2ATWA 1N34C 1HNZC 4RLFA 2E8EA 2Y4OA 4ZJZA 4ISBA 4R0MA 1MXAA 1I94C 2D7VA 3GKUA 4RMNA 1PG4A 1QWIA 4MH4A 5BUQA 1V25A 3VNQA 2ZM6C 3AF6A 2UUBC 2VZEA 5K85A 2YCBA 4IR7A 3NYRA 4LFAC 3NI2A 3IMLA 3I07A 4G1IA 4R1MA 4PZPA 4GS5A 4OYCA 2ONFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  4DV6 C;  4KHP C;  4LF8 C;  2F4V C;  3IEU A;  2UXD C;  1ZB9 A;  2JMP A;  1KKG A;  3J7A D;  1IBL C;  4YY3 C;  2E8C A;  1HR0 C;  1FJG C;  4JI0 C;  4DCS A;  4YHH C;  4DV0 C;  2HHH C;  4JYA C;  1MKY A;  3T1Y C;  4DR7 C;  1UKK A;  1JOS A;  1WF3 A;  4X64 C;  4DV5 C;  1USP A;  1N36 C;  4DUY C;  1IBK C;  2HJG A;  2UU9 C;  1VLA A;  2PT7 G;  4DR1 C;  1XNQ C;  4DR3 C;  4NXN C;  5A2Q D;  1USP B;  1XMQ C;  4GKJ C;  1N2F A;  4BSZ A;  5FLX D;  3R9X A;  1WH9 A;  2UUA C;  4DR4 C;  5BR8 C;  3AF5 A;  2VQF C;  1XNR C;  2XR1 A;  2VQE C;  4DUZ C;  4K0K C;  1N33 C;  1HNW C;  2BJO A;  5LMN C;  2ASB A;  3R9W A;  1NYE A;  4DV2 C;  4LFB C;  4NOZ A;  4JI2 C;  1HH2 P;  3JAM D;  1LQL A;  3T1H C;  2EGT A;  2E7G A;  1EGA A;  1ZB8 A;  1PA4 A;  4OX9 C;  2UXB C;  1XMO C;  4JV5 C;  4AQY C;  2OPL A;  4X65 C;  4GKK C;  4DCV A;  1J5E C;  4XX2 A;  3EER A;  2QL8 A;  2ATW A;  4DR6 C;  2OPL B;  4JI5 C;  5IWA C;  1N34 C;  4B3T C;  1N32 C;  2KZF A;  1HNZ C;  2DYJ A;  4DCU A;  4B3M C;  2E8F A;  2E8E A;  2PN2 A;  1I94 C;  3LUS A;  2D7V A;  4NXM C;  5LMU C;  3GKU A;  4JI6 C;  4DV7 C;  4MTN A;  4MH4 A;  1QWI A;  4DR2 C;  4LF5 C;  4B3S C;  2ZM6 C;  4B3R C;  3AF6 A;  1HNX C;  1L2F A;  4DR5 C;  4JI8 C;  4DCT A;  4JI4 C;  2UUB C;  4LFC C;  4LF4 C;  3IEV A;  1ML8 A;  2YCB A;  2CXC A;  3CJE A;  4JI7 C;  2UUC C;  4DV3 C;  4X62 C;  1IBM C;  4LF6 C;  5IT9 D;  4LF9 C;  3OTO C;  4DV4 C;  4LFA C;  1K0R A;  4LF7 C;  3J80 D;  4JI1 C;  2E5L C;  4DV1 C;  3J81 D;  2UXC C;  3I07 A;  4X66 C;  4JI3 C;  2ONF A; 
#chains in the Genus database with same CATH topology
 1O93 A;  4DV6 C;  1ZB9 A;  2JMP A;  3J7A D;  3UX3 A;  2D28 C;  1HR0 C;  4DV0 C;  1MKY A;  4DR7 C;  3PBK A;  4X64 C;  1USP A;  1AMU A;  2UU9 C;  1MXB A;  1VLA A;  4G36 A;  4NXN C;  2P2B A;  4BSZ A;  2QVZ X;  3PRO C;  1M6X A;  3A9V A;  4L2Z A;  3UEB A;  1XNR C;  2VQE C;  4K0K C;  3UOW A;  2P20 A;  3VNR A;  4DV2 C;  2AYA A;  4JI2 C;  3N54 B;  1HH2 P;  1MXC A;  4LE5 A;  5H9U A;  2OO4 A;  4FUT A;  2EGT A;  2E7G A;  1PA4 A;  2Z51 A;  4OX9 C;  3L95 X;  4KTT A;  2CU6 A;  2P2F A;  3TR3 A;  5IFI A;  3TDE A;  2DPL A;  1YJ7 A;  2OPL B;  5IWA C;  2D1Q A;  2NCL A;  1BA3 A;  1N32 C;  2KZF A;  4PRO C;  4WV3 A;  1MDB A;  3DLP X;  3FM7 A;  5T8S A;  2PN2 A;  3LUS A;  5LMU C;  4JI6 C;  4RLQ A;  2Y4N A;  4PHT A;  4KTV A;  4LF5 C;  4B3R C;  1L2F A;  4R1L A;  4JM1 A;  4L7I A;  4LF4 C;  1RG9 A;  2QVY X;  2UUC C;  3PES A;  2WD9 A;  5IT9 D;  4LF9 C;  4DV4 C;  3NPD A;  4GXR A;  4HPV A;  2QW0 X;  1V60 A;  4FUQ A;  4LF8 C;  2F4V C;  3NYQ A;  4WS9 A;  4BC7 A;  2M5H A;  2QVX X;  1XHJ A;  2JNV A;  4DG8 A;  4DV5 C;  1N36 C;  5E7Q A;  5KEI A;  2PT7 G;  4FTF A;  3GR1 A;  4TPS B;  5A1G A;  1USP B;  4GKJ C;  5BUR A;  5CZV A;  2E0G A;  2P02 A;  5KYV A;  1WH9 A;  5BUS A;  4D56 A;  3CW8 X;  1P4E C;  2XR1 A;  2YWB A;  4DUZ C;  3DHV A;  2D27 A;  3A25 A;  1N33 C;  4OXI A;  1ULT A;  2P2Q A;  3B7W A;  1NYE A;  1NY8 A;  2P2M A;  1M6X C;  4RM3 A;  3FCE A;  5T8T A;  4D57 A;  1ZB8 A;  2DHM A;  5A19 A;  3C5E A;  1YGT A;  3I08 A;  4GKK C;  4I9F A;  2KZ0 A;  2Y27 A;  2QL8 A;  2V7B A;  4DR6 C;  1GPM A;  5AE2 A;  1FUG A;  1QM4 A;  4I9G A;  5AE3 A;  4DCU A;  4RM2 A;  1FLO A;  4B3M C;  3E7W A;  4U5Y D;  4NXM C;  1P7L A;  4DR2 C;  4B3S C;  2ZTB A;  1HNX C;  4DR5 C;  4PUH A;  4DG9 A;  4JI4 C;  2D1S A;  3IEV A;  1ML8 A;  2CXC A;  1XRA A;  5DV9 A;  4NDN A;  4DV3 C;  1IBM C;  5K8F A;  4LF6 C;  3OTO C;  1PG3 A;  1K0R A;  4LF7 C;  5KYT A;  3ETC A;  3J81 D;  2UXC C;  3SO4 A;  4X66 C;  1MDF A;  3TQI A;  5BSM A;  3CQ2 A;  3ETO A;  2PRO A;  2WP0 C;  5BST A;  4ZLP A;  4D4I A;  3IEU A;  4G37 A;  2E8C A;  1FJG C;  4JI0 C;  1XRC A;  4DCS A;  4YHH C;  4JYA C;  3A9U A;  3TUF A;  4D4G A;  3T1Y C;  1JOS A;  1WF3 A;  3CQ3 A;  2BH1 X;  1TH5 A;  3UZ0 A;  1IBK C;  3RG2 A;  1XNQ C;  4DR3 C;  1XS3 A;  5A2Q D;  2ZZM A;  3A4I A;  3LNV A;  1XMQ C;  3EQ6 A;  5JRH A;  5FLX D;  2UUA C;  5BR8 C;  3AF5 A;  2MMA B;  1T5H X;  2YX1 A;  5ADZ A;  1WCJ A;  4LFB C;  2MCQ A;  4NOZ A;  3G7S A;  2KDN A;  4BCA A;  3IPL A;  1RY2 A;  1PU1 A;  4IZ6 A;  3JAM D;  3T1H C;  4EAT A;  1EGA A;  4BBY A;  3LAX A;  3CQ1 A;  2ZZN A;  4X65 C;  5GTD A;  3FCC A;  3EER A;  4JI5 C;  4B3T C;  1O9T A;  3CW9 A;  3AY0 A;  4RVO A;  5LCI A;  2DYJ A;  4GXQ A;  3GR0 A;  3LGX A;  1O90 A;  2E8F A;  4DV7 C;  4MTN A;  3H2T A;  4JI8 C;  1XDX A;  4ODJ A;  4DCT A;  3DAY A;  3K6R A;  4LFC C;  3L8C A;  3R44 A;  3CJE A;  5BSV A;  3KXW A;  4JI7 C;  4X62 C;  1P4E A;  3J80 D;  3GPC A;  4JI1 C;  2E5L C;  3VNS A;  4DV1 C;  4JI3 C;  2P2J A;  3E7X A;  2CY1 A;  4KHP C;  3RV2 A;  1KKG A;  2UXD C;  1IBL C;  2OBV A;  4YY3 C;  2HHH C;  2VSQ A;  4K0B A;  1UKK A;  1IB8 A;  2D1R A;  1LCI A;  4DUY C;  2HJG A;  4BC9 A;  4DR1 C;  1O92 A;  5BSU A;  2YWC A;  5AE1 A;  1N2F A;  3UX2 A;  3R9X A;  4DR4 C;  2VQF C;  1UWD A;  3O2E A;  3N2Q A;  5A1I A;  1HNW C;  2BJO A;  5LMN C;  3S82 A;  2ASB A;  3R9W A;  1LQL A;  5CZX A;  2UXB C;  1XRB A;  1XMO C;  5BSR A;  4RVN A;  2D1T A;  4JV5 C;  4AQY C;  2OPL A;  1T5D X;  1VEH A;  1V26 A;  2M5O A;  4L4Q A;  4DCV A;  1J5E C;  5BSW A;  4XX2 A;  2PG1 E;  1MD9 A;  2ATW A;  1N34 C;  1HNZ C;  4RLF A;  2E8E A;  2Y4O A;  4ZJZ A;  4ISB A;  3LNO A;  4R0M A;  1MXA A;  1I94 C;  2D7V A;  3GKU A;  4RMN A;  1PG4 A;  1QWI A;  4MH4 A;  5BUQ A;  1V25 A;  3VNQ A;  2ZM6 C;  3AF6 A;  2UUB C;  2VZE A;  5K85 A;  2YCB A;  4IR7 A;  4PUG A;  2MM9 A;  3A26 A;  3NYR A;  4LFA C;  3NI2 A;  3IML A;  3I07 A;  4G1I A;  4R1M A;  4PZP A;  4GS5 A;  4OYC A;  2ONF A;  4PUI A; 
#chains in the Genus database with same CATH homology
 1O93 A;  4DV6 C;  1ZB9 A;  2JMP A;  3J7A D;  2D28 C;  1HR0 C;  4DV0 C;  1MKY A;  4DR7 C;  3PBK A;  4X64 C;  1USP A;  1AMU A;  2UU9 C;  1MXB A;  1VLA A;  4G36 A;  4NXN C;  2P2B A;  4BSZ A;  2QVZ X;  3PRO C;  3A9V A;  4L2Z A;  1XNR C;  2VQE C;  4K0K C;  3UOW A;  2P20 A;  3VNR A;  4DV2 C;  2AYA A;  4JI2 C;  3N54 B;  1HH2 P;  1MXC A;  4LE5 A;  5H9U A;  2OO4 A;  4FUT A;  2EGT A;  2E7G A;  1PA4 A;  4OX9 C;  3L95 X;  4KTT A;  2P2F A;  5IFI A;  3TDE A;  2DPL A;  1YJ7 A;  2OPL B;  5IWA C;  2D1Q A;  1BA3 A;  1N32 C;  2KZF A;  4PRO C;  4WV3 A;  1MDB A;  3DLP X;  5T8S A;  2PN2 A;  3LUS A;  5LMU C;  4JI6 C;  4RLQ A;  2Y4N A;  4PHT A;  4KTV A;  4LF5 C;  4B3R C;  1L2F A;  4R1L A;  4JM1 A;  4L7I A;  4LF4 C;  1RG9 A;  2QVY X;  2UUC C;  3PES A;  2WD9 A;  5IT9 D;  4LF9 C;  4DV4 C;  3NPD A;  4GXR A;  4HPV A;  2QW0 X;  4FUQ A;  4LF8 C;  2F4V C;  3NYQ A;  4WS9 A;  4BC7 A;  2QVX X;  4DG8 A;  4DV5 C;  1N36 C;  5E7Q A;  5KEI A;  2PT7 G;  4FTF A;  3GR1 A;  4TPS B;  5A1G A;  1USP B;  4GKJ C;  5BUR A;  5CZV A;  2E0G A;  2P02 A;  5KYV A;  1WH9 A;  5BUS A;  4D56 A;  3CW8 X;  2XR1 A;  2YWB A;  4DUZ C;  3DHV A;  2D27 A;  1N33 C;  4OXI A;  1ULT A;  2P2Q A;  3B7W A;  1NYE A;  2P2M A;  4RM3 A;  3FCE A;  5T8T A;  4D57 A;  1ZB8 A;  5A19 A;  3C5E A;  3I08 A;  4GKK C;  4I9F A;  2Y27 A;  2QL8 A;  2V7B A;  4DR6 C;  1GPM A;  5AE2 A;  1FUG A;  1QM4 A;  4I9G A;  5AE3 A;  4DCU A;  4RM2 A;  4B3M C;  3E7W A;  4U5Y D;  4NXM C;  1P7L A;  4DR2 C;  4B3S C;  1HNX C;  4DR5 C;  4DG9 A;  4JI4 C;  2D1S A;  3IEV A;  1ML8 A;  2CXC A;  1XRA A;  5DV9 A;  4NDN A;  4DV3 C;  1IBM C;  5K8F A;  4LF6 C;  3OTO C;  1PG3 A;  1K0R A;  4LF7 C;  5KYT A;  3ETC A;  3J81 D;  2UXC C;  3SO4 A;  4X66 C;  1MDF A;  3TQI A;  5BSM A;  3ETO A;  2PRO A;  2WP0 C;  5BST A;  4ZLP A;  4D4I A;  3IEU A;  4G37 A;  2E8C A;  1FJG C;  4JI0 C;  1XRC A;  4DCS A;  4YHH C;  4JYA C;  3A9U A;  3TUF A;  4D4G A;  3T1Y C;  1JOS A;  1WF3 A;  2BH1 X;  3UZ0 A;  1IBK C;  3RG2 A;  1XNQ C;  4DR3 C;  5A2Q D;  3A4I A;  3LNV A;  1XMQ C;  3EQ6 A;  5JRH A;  5FLX D;  2UUA C;  5BR8 C;  3AF5 A;  1T5H X;  5ADZ A;  4LFB C;  4NOZ A;  3G7S A;  4BCA A;  3IPL A;  3JAM D;  3T1H C;  1RY2 A;  4IZ6 A;  4EAT A;  1EGA A;  4BBY A;  3LAX A;  4X65 C;  5GTD A;  3FCC A;  3EER A;  4JI5 C;  4B3T C;  1O9T A;  3CW9 A;  4RVO A;  2DYJ A;  4GXQ A;  3GR0 A;  3LGX A;  1O90 A;  2E8F A;  4DV7 C;  4MTN A;  3H2T A;  4JI8 C;  4ODJ A;  4DCT A;  3DAY A;  4LFC C;  3L8C A;  3R44 A;  3CJE A;  5BSV A;  3KXW A;  4JI7 C;  4X62 C;  3J80 D;  3GPC A;  4JI1 C;  2E5L C;  3VNS A;  4DV1 C;  4JI3 C;  2P2J A;  3E7X A;  2CY1 A;  4KHP C;  3RV2 A;  1KKG A;  2UXD C;  1IBL C;  2OBV A;  4YY3 C;  2HHH C;  2VSQ A;  4K0B A;  1UKK A;  2D1R A;  1LCI A;  4DUY C;  2HJG A;  4BC9 A;  4DR1 C;  1O92 A;  5BSU A;  2YWC A;  5AE1 A;  1N2F A;  3R9X A;  4DR4 C;  2VQF C;  3N2Q A;  5A1I A;  1HNW C;  2BJO A;  5LMN C;  3S82 A;  2ASB A;  3R9W A;  1LQL A;  5CZX A;  2UXB C;  1XRB A;  1XMO C;  5BSR A;  4RVN A;  2D1T A;  4JV5 C;  4AQY C;  2OPL A;  1T5D X;  1V26 A;  4L4Q A;  4DCV A;  1J5E C;  5BSW A;  4XX2 A;  1MD9 A;  2ATW A;  1N34 C;  1HNZ C;  4RLF A;  2E8E A;  2Y4O A;  4ZJZ A;  4ISB A;  4R0M A;  1MXA A;  1I94 C;  2D7V A;  3GKU A;  4RMN A;  1PG4 A;  1QWI A;  4MH4 A;  5BUQ A;  1V25 A;  3VNQ A;  2ZM6 C;  3AF6 A;  2UUB C;  2VZE A;  5K85 A;  2YCB A;  4IR7 A;  3NYR A;  4LFA C;  3NI2 A;  3IML A;  3I07 A;  4G1I A;  4R1M A;  4PZP A;  4GS5 A;  4OYC A;  2ONF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...