4YHHC

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4yhhC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4yhhC02
4DR3C 1KKGA 3OTOC 4X62C 4LFCC 1XNQC 2PN2A 4JI4C 2F4VC 3T1YC 4DUYC 2ONFA 4JI8C 3I07A 3LUSA 2UXDC 5IT9D 3EERA 1IBMC 5FLXD 4MH4A 1N32C 3R9WA 1ZB8A 1XNRC 4GKKC 3IEUA 1UKKA 4NXNC 1QWIA 2E8CA 1FJGC 4DUZC 3J7AD 4K0KC 2VQFC 4NXMC 1WH9A 4DV4C 2E7GA 2JMPA 2OPLA 4JI3C 4X64C 2ZM6C 4DR4C 4YHHC 4LF9C 1ZB9A 1ML8A 4B3TC 2UUBC 4DCTA 1HH2P 2UUAC 3R9XA 4DV2C 4DCUA 3AF6A 4DV6C 2UU9C 4JI7C 1USPA 1IBLC 4JV5C 4B3RC 1MKYA 4NOZA 4B3MC 1VLAA 3J81D 1K0RA 4LFBC 3GKUA 5A2QD 2ASBA 3JAMD 2E5LC 1JOSA 4LF8C 4DV0C 4XX2A 2EGTA 1EGAA 4DCSA 4JI1C 4X66C 4LF4C 2UUCC 5LMNC 1N2FA 1HR0C 4OX9C 1N36C 4DV3C 4X65C 1IBKC 4DV5C 4LFAC 4JI2C 4JYAC 1NYEA 3AF5A 4LF7C 4DR7C 2CXCA 3J80D 4LF6C 2QL8A 4JI0C 4DV7C 1PA4A 4AQYC 4KHPC 2UXBC 1USPB 3IEVA 2KZFA 2PT7G 4DCVA 4MTNA 4DV1C 1I94C 4DR1C 1N33C 2E8FA 1L2FA 2VQEC 5IWAC 4JI6C 5LMUC 4BSZA 4DR2C 2BJOA 1HNZC 2OPLB 2YCBA 1LQLA 2E8EA 3CJEA 5BR8C 2HHHC 4DR6C 4GKJC 2CY1A 1XMQC 2ATWA 2D7VA 4JI5C 4DR5C 1XMOC 2UXCC 2DYJA 2HJGA 2XR1A 1HNXC 1WF3A 1HNWC 1J5EC 4YY3C 4LF5C 3T1HC 1N34C 4B3SC
chains in the Genus database with same CATH superfamily
1KKGA 4RMNA 2AYAA 3TR3A 1PG4A 5BSVA 1N32C 1ZB8A 3IEUA 1UKKA 4NXNC 1QWIA 4K0KC 1XHJA 1MD9A 4FTFA 4DV4C 2E7GA 5A1GA 4X64C 4DR4C 4YHHC 4LF9C 1TH5A 4D4IA 1ML8A 1VEHA 4B3TC 5IFIA 1PU1A 1HH2P 1PG3A 4DCTA 4DV6C 2UU9C 4PHTA 4RLQA 4JI7C 1USPA 4B3MC 1K0RA 2ASBA 3ETOA 3JAMD 3KXWA 4LE5A 4DV0C 3CQ1A 4JI1C 4WV3A 5A1IA 3PESA 5LMNC 4PUHA 3EQ6A 4OX9C 4DV3C 5AE3A 4D4GA 5H9UA 3UX2A 4KTVA 3AF5A 3DLPX 2WP0C 2P2QA 1O92A 2QL8A 1MXAA 1YJ7A 3IEVA 1I94C 2Y27A 4BC9A 1QM4A 3GR1A 1L2FA 2Y4NA 5AE2A 1HNZC 3LNVA 3RV2A 3B7WA 1NY8A 1MXBA 3UOWA 5GTDA 2HHHC 4IR7A 3K6RA 1MDBA 3DHVA 5E7QA 4R1MA 2UXCC 4FUTA 1HNXC 2ZTBA 1HNWC 1J5EC 2P2JA 3G7SA 2Y4OA 4GS5A 1XRAA 3OTOC 3E7WA 2BH1X 1XNQC 2CU6A 2PN2A 4IZ6A 2F4VC 4OYCA 4PUGA 2D1QA 2MCQA 4ZLPA 2ONFA 5BSUA 3L8CA 2UXDC 3TDEA 4HPVA 3LGXA 1XNRC 3NPDA 2E8CA 1FJGC 2YWBA 4RM3A 2QVYX 4R0MA 1XDXA 2YX1A 1WH9A 1XS3A 2JMPA 1FUGA 3N2QA 3ETCA 5BUSA 2DHMA 4TPSB 2P2MA 5AE1A 5KYVA 5KEIA 5BSRA 2UUAC 3R9XA 3RG2A 2D27A 3IMLA 3A25A 3A9UA 2V7BA 1MKYA 2VZEA 3SO4A 4LFBC 3GKUA 2E5LC 5BSMA 4LF8C 1V25A 2D1RA 4ISBA 4L4QA 2D28C 1N2FA 1N36C 5DV9A 2OO4A 1IB8A 3FCEA 4JYAC 3J80D 3L95X 4JI0C 5CZVA 4DV7C 4KHPC 2UXBC 1USPB 1O90A 3NI2A 3IPLA 4DV1C 4RLFA 5K85A 4L2ZA 4RVNA 2BJOA 2OPLB 1LQLA 2KZ0A 5BR8C 4DR6C 4BCAA 3H2TA 5BSTA 2P2BA 2DYJA 2HJGA 1M6XC 4U5YD 1WF3A 1T5DX 1XRBA 4YY3C 2PG1E 1UWDA 4KTTA 5CZXA 1MXCA 5T8TA 4DR3C 5LCIA 4L7IA 3N54B 4JI8C 3I07A 4PZPA 3EERA 1IBMC 4MH4A 4GKKC 1RY2A 3A26A 2D1TA 3TQIA 2QW0X 4D57A 4DUZC 3UEBA 3J7AD 3FCCA 3A4IA 3CW8X 4DG8A 2M5HA 5BUQA 4R1LA 2ZM6C 3C5EA 1ZB9A 3O2EA 2M5OA 2UUBC 4DV2C 4DCUA 3AF6A 3PROC 2P2FA 1IBLC 2P02A 3J81D 1T5HX 3PBKA 1EGAA 4DCSA 4G36A 4LF4C 2UUCC 1HR0C 3AY0A 3E7XA 3DAYA 3UZ0A 1GPMA 1O9TA 1IBKC 4DV5C 1NYEA 4LF7C 1PA4A 4I9FA 3CQ3A 5BSWA 3GPCA 2PT7G 1MDFA 4DCVA 4MTNA 1LCIA 2D1SA 1N33C 2E8FA 2ZZMA 1V60A 5IWAC 5LMUC 4BSZA 4K0BA 4DR2C 5ADZA 2YCBA 2E8EA 3CJEA 5BURA 2ZZNA 1O93A 1YGTA 3LNOA 4JI5C 1XMOC 1RG9A 1XRCA 2XR1A 5JRHA 2MMAB 1N34C 4PROC 3GR0A 4PUIA 3R44A 4B3SC 2YWCA 4NDNA 4X62C 4LFCC 2WD9A 4JI4C 2NCLA 3T1YC 4ODJA 3I08A 3VNSA 4DUYC 4DG9A 3LUSA 4G37A 5IT9D 4RM2A 5FLXD 3R9WA 3S82A 4EATA 1WCJA 3LAXA 2VQFC 3TUFA 4NXMC 3NYQA 3CQ2A 2OPLA 4JI3C 4GXQA 4BBYA 1M6XA 2QVZX 2JNVA 3UX3A 3VNRA 4JV5C 3CW9A 4B3RC 4NOZA 1VLAA 4RVOA 5A2QD 3FM7A 3VNQA 4G1IA 2VSQA 4JM1A 1P4EC 1JOSA 4FUQA 3A9VA 4XX2A 5KYTA 2EGTA 5K8FA 2KDNA 4OXIA 4X66C 2E0GA 4X65C 5A19A 4LFAC 4ZJZA 4JI2C 1P4EA 2CXCA 4DR7C 4LF6C 1FLOA 4AQYC 2MM9A 2P20A 2KZFA 4D56A 4DR1C 1P7LA 2PROA 4BC7A 2VQEC 4JI6C 1AMUA 1V26A 1BA3A 2QVXX 5T8SA 4GKJC 2CY1A 1XMQC 1ULTA 2ATWA 2D7VA 4DR5C 3NYRA 2OBVA 4GXRA 4I9GA 4WS9A 4LF5C 2DPLA 3T1HC 2Z51A
chains in the Genus database with same CATH topology
1KKGA 4RMNA 2AYAA 1PG4A 5BSVA 1N32C 1ZB8A 3IEUA 1UKKA 4NXNC 1QWIA 4K0KC 1MD9A 4FTFA 4DV4C 2E7GA 5A1GA 4X64C 4DR4C 4YHHC 4LF9C 4D4IA 1ML8A 4B3TC 5IFIA 4DCTA 1HH2P 1PG3A 4DV6C 2UU9C 4PHTA 4RLQA 4JI7C 1USPA 4B3MC 1K0RA 2ASBA 3ETOA 3JAMD 3KXWA 4LE5A 4DV0C 4JI1C 4WV3A 5A1IA 3PESA 5LMNC 3EQ6A 4OX9C 4DV3C 5AE3A 4D4GA 5H9UA 4KTVA 3AF5A 3DLPX 2WP0C 2P2QA 1O92A 2QL8A 1MXAA 1YJ7A 3IEVA 1I94C 2Y27A 4BC9A 1QM4A 3GR1A 1L2FA 2Y4NA 5AE2A 1HNZC 3LNVA 3RV2A 3B7WA 1MXBA 3UOWA 5GTDA 2HHHC 4IR7A 1MDBA 3DHVA 5E7QA 4R1MA 2UXCC 4FUTA 1HNXC 1HNWC 1J5EC 2P2JA 3G7SA 2Y4OA 4GS5A 1XRAA 3OTOC 3E7WA 2BH1X 1XNQC 2PN2A 4IZ6A 2F4VC 4OYCA 2D1QA 4ZLPA 2ONFA 5BSUA 3L8CA 2UXDC 3TDEA 4HPVA 3LGXA 1XNRC 3NPDA 2E8CA 1FJGC 2YWBA 4RM3A 2QVYX 4R0MA 1WH9A 2JMPA 1FUGA 3N2QA 3ETCA 5BUSA 4TPSB 2P2MA 5AE1A 5KYVA 5KEIA 5BSRA 2UUAC 3R9XA 3RG2A 2D27A 3IMLA 3A9UA 2V7BA 1MKYA 2VZEA 3SO4A 4LFBC 3GKUA 2E5LC 5BSMA 4LF8C 1V25A 2D1RA 4ISBA 4L4QA 2D28C 1N2FA 1N36C 5DV9A 2OO4A 3FCEA 4JYAC 3J80D 3L95X 4JI0C 5CZVA 4DV7C 4KHPC 2UXBC 1USPB 1O90A 3NI2A 3IPLA 4DV1C 4RLFA 5K85A 4L2ZA 4RVNA 2BJOA 2OPLB 1LQLA 5BR8C 4DR6C 4BCAA 3H2TA 5BSTA 2P2BA 2DYJA 2HJGA 4U5YD 1WF3A 1T5DX 1XRBA 4YY3C 4KTTA 5CZXA 1MXCA 5T8TA 4DR3C 4L7IA 3N54B 4JI8C 3I07A 4PZPA 3EERA 1IBMC 4MH4A 4GKKC 1RY2A 2D1TA 3TQIA 2QW0X 4D57A 4DUZC 3J7AD 3FCCA 3A4IA 3CW8X 4DG8A 5BUQA 4R1LA 2ZM6C 3C5EA 1ZB9A 2UUBC 4DV2C 4DCUA 3AF6A 3PROC 2P2FA 1IBLC 2P02A 3J81D 1T5HX 3PBKA 1EGAA 4DCSA 4G36A 4LF4C 2UUCC 1HR0C 3E7XA 3DAYA 3UZ0A 1GPMA 1O9TA 1IBKC 4DV5C 1NYEA 4LF7C 1PA4A 4I9FA 5BSWA 3GPCA 2PT7G 1MDFA 4DCVA 4MTNA 1LCIA 2D1SA 1N33C 2E8FA 5IWAC 5LMUC 4BSZA 4K0BA 4DR2C 5ADZA 2YCBA 2E8EA 3CJEA 5BURA 1O93A 4JI5C 1XMOC 1RG9A 1XRCA 2XR1A 5JRHA 1N34C 4PROC 3GR0A 3R44A 4B3SC 2YWCA 4NDNA 4X62C 4LFCC 2WD9A 4JI4C 3T1YC 4ODJA 3I08A 3VNSA 4DUYC 4DG9A 3LUSA 4G37A 5IT9D 4RM2A 5FLXD 3R9WA 3S82A 4EATA 3LAXA 2VQFC 3TUFA 4NXMC 3NYQA 2OPLA 4JI3C 4GXQA 4BBYA 2QVZX 3VNRA 4JV5C 3CW9A 4B3RC 4NOZA 1VLAA 4RVOA 5A2QD 3VNQA 4G1IA 2VSQA 4JM1A 1JOSA 4FUQA 3A9VA 4XX2A 5KYTA 2EGTA 5K8FA 4X66C 4OXIA 2E0GA 4X65C 5A19A 4LFAC 4ZJZA 4JI2C 4DR7C 2CXCA 4LF6C 4AQYC 2P20A 2KZFA 4D56A 4DR1C 1P7LA 2PROA 4BC7A 2VQEC 4JI6C 1AMUA 1V26A 1BA3A 2QVXX 5T8SA 4GKJC 2CY1A 1XMQC 1ULTA 2ATWA 2D7VA 4DR5C 3NYRA 2OBVA 4GXRA 4I9GA 4WS9A 4LF5C 2DPLA 3T1HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 C;  1KKG A;  3OTO C;  4X62 C;  4LFC C;  1XNQ C;  2PN2 A;  4JI4 C;  2F4V C;  3T1Y C;  4DUY C;  2ONF A;  4JI8 C;  3I07 A;  3LUS A;  2UXD C;  5IT9 D;  3EER A;  1IBM C;  5FLX D;  4MH4 A;  1N32 C;  3R9W A;  1ZB8 A;  1XNR C;  4GKK C;  3IEU A;  1UKK A;  4NXN C;  1QWI A;  2E8C A;  1FJG C;  4DUZ C;  3J7A D;  4K0K C;  2VQF C;  4NXM C;  1WH9 A;  4DV4 C;  2E7G A;  2JMP A;  2OPL A;  4JI3 C;  4X64 C;  2ZM6 C;  4DR4 C;  4YHH C;  4LF9 C;  1ZB9 A;  1ML8 A;  4B3T C;  2UUB C;  4DCT A;  1HH2 P;  2UUA C;  3R9X A;  4DV2 C;  4DCU A;  3AF6 A;  4DV6 C;  2UU9 C;  4JI7 C;  1USP A;  1IBL C;  4JV5 C;  4B3R C;  1MKY A;  4NOZ A;  4B3M C;  1VLA A;  3J81 D;  1K0R A;  4LFB C;  3GKU A;  5A2Q D;  2ASB A;  3JAM D;  2E5L C;  1JOS A;  4LF8 C;  4DV0 C;  4XX2 A;  2EGT A;  1EGA A;  4DCS A;  4JI1 C;  4X66 C;  4LF4 C;  2UUC C;  5LMN C;  1N2F A;  1HR0 C;  4OX9 C;  1N36 C;  4DV3 C;  4X65 C;  1IBK C;  4DV5 C;  4LFA C;  4JI2 C;  4JYA C;  1NYE A;  3AF5 A;  4LF7 C;  4DR7 C;  2CXC A;  3J80 D;  4LF6 C;  2QL8 A;  4JI0 C;  4DV7 C;  1PA4 A;  4AQY C;  4KHP C;  2UXB C;  1USP B;  3IEV A;  2KZF A;  2PT7 G;  4DCV A;  4MTN A;  4DV1 C;  1I94 C;  4DR1 C;  1N33 C;  2E8F A;  1L2F A;  2VQE C;  5IWA C;  4JI6 C;  5LMU C;  4BSZ A;  4DR2 C;  2BJO A;  1HNZ C;  2OPL B;  2YCB A;  1LQL A;  2E8E A;  3CJE A;  5BR8 C;  2HHH C;  4DR6 C;  4GKJ C;  2CY1 A;  1XMQ C;  2ATW A;  2D7V A;  4JI5 C;  4DR5 C;  1XMO C;  2UXC C;  2DYJ A;  2HJG A;  2XR1 A;  1HNX C;  1WF3 A;  1HNW C;  1J5E C;  4YY3 C;  4LF5 C;  3T1H C;  1N34 C;  4B3S C; 
#chains in the Genus database with same CATH topology
 1KKG A;  4RMN A;  2AYA A;  3TR3 A;  1PG4 A;  5BSV A;  1N32 C;  1ZB8 A;  3IEU A;  1UKK A;  4NXN C;  1QWI A;  4K0K C;  1XHJ A;  1MD9 A;  4FTF A;  4DV4 C;  2E7G A;  5A1G A;  4X64 C;  4DR4 C;  4YHH C;  4LF9 C;  1TH5 A;  4D4I A;  1ML8 A;  1VEH A;  4B3T C;  5IFI A;  1PU1 A;  1HH2 P;  1PG3 A;  4DCT A;  4DV6 C;  2UU9 C;  4PHT A;  4RLQ A;  4JI7 C;  1USP A;  4B3M C;  1K0R A;  2ASB A;  3ETO A;  3JAM D;  3KXW A;  4LE5 A;  4DV0 C;  3CQ1 A;  4JI1 C;  4WV3 A;  5A1I A;  3PES A;  5LMN C;  4PUH A;  3EQ6 A;  4OX9 C;  4DV3 C;  5AE3 A;  4D4G A;  5H9U A;  3UX2 A;  4KTV A;  3AF5 A;  3DLP X;  2WP0 C;  2P2Q A;  1O92 A;  2QL8 A;  1MXA A;  1YJ7 A;  3IEV A;  1I94 C;  2Y27 A;  4BC9 A;  1QM4 A;  3GR1 A;  1L2F A;  2Y4N A;  5AE2 A;  1HNZ C;  3LNV A;  3RV2 A;  3B7W A;  1NY8 A;  1MXB A;  3UOW A;  5GTD A;  2HHH C;  4IR7 A;  3K6R A;  1MDB A;  3DHV A;  5E7Q A;  4R1M A;  2UXC C;  4FUT A;  1HNX C;  2ZTB A;  1HNW C;  1J5E C;  2P2J A;  3G7S A;  2Y4O A;  4GS5 A;  1XRA A;  3OTO C;  3E7W A;  2BH1 X;  1XNQ C;  2CU6 A;  2PN2 A;  4IZ6 A;  2F4V C;  4OYC A;  4PUG A;  2D1Q A;  2MCQ A;  4ZLP A;  2ONF A;  5BSU A;  3L8C A;  2UXD C;  3TDE A;  4HPV A;  3LGX A;  1XNR C;  3NPD A;  2E8C A;  1FJG C;  2YWB A;  4RM3 A;  2QVY X;  4R0M A;  1XDX A;  2YX1 A;  1WH9 A;  1XS3 A;  2JMP A;  1FUG A;  3N2Q A;  3ETC A;  5BUS A;  2DHM A;  4TPS B;  2P2M A;  5AE1 A;  5KYV A;  5KEI A;  5BSR A;  2UUA C;  3R9X A;  3RG2 A;  2D27 A;  3IML A;  3A25 A;  3A9U A;  2V7B A;  1MKY A;  2VZE A;  3SO4 A;  4LFB C;  3GKU A;  2E5L C;  5BSM A;  4LF8 C;  1V25 A;  2D1R A;  4ISB A;  4L4Q A;  2D28 C;  1N2F A;  1N36 C;  5DV9 A;  2OO4 A;  1IB8 A;  3FCE A;  4JYA C;  3J80 D;  3L95 X;  4JI0 C;  5CZV A;  4DV7 C;  4KHP C;  2UXB C;  1USP B;  1O90 A;  3NI2 A;  3IPL A;  4DV1 C;  4RLF A;  5K85 A;  4L2Z A;  4RVN A;  2BJO A;  2OPL B;  1LQL A;  2KZ0 A;  5BR8 C;  4DR6 C;  4BCA A;  3H2T A;  5BST A;  2P2B A;  2DYJ A;  2HJG A;  1M6X C;  4U5Y D;  1WF3 A;  1T5D X;  1XRB A;  4YY3 C;  2PG1 E;  1UWD A;  4KTT A;  5CZX A;  1MXC A;  5T8T A;  4DR3 C;  5LCI A;  4L7I A;  3N54 B;  4JI8 C;  3I07 A;  4PZP A;  3EER A;  1IBM C;  4MH4 A;  4GKK C;  1RY2 A;  3A26 A;  2D1T A;  3TQI A;  2QW0 X;  4D57 A;  4DUZ C;  3UEB A;  3J7A D;  3FCC A;  3A4I A;  3CW8 X;  4DG8 A;  2M5H A;  5BUQ A;  4R1L A;  2ZM6 C;  3C5E A;  1ZB9 A;  3O2E A;  2M5O A;  2UUB C;  4DV2 C;  4DCU A;  3AF6 A;  3PRO C;  2P2F A;  1IBL C;  2P02 A;  3J81 D;  1T5H X;  3PBK A;  1EGA A;  4DCS A;  4G36 A;  4LF4 C;  2UUC C;  1HR0 C;  3AY0 A;  3E7X A;  3DAY A;  3UZ0 A;  1GPM A;  1O9T A;  1IBK C;  4DV5 C;  1NYE A;  4LF7 C;  1PA4 A;  4I9F A;  3CQ3 A;  5BSW A;  3GPC A;  2PT7 G;  1MDF A;  4DCV A;  4MTN A;  1LCI A;  2D1S A;  1N33 C;  2E8F A;  2ZZM A;  1V60 A;  5IWA C;  5LMU C;  4BSZ A;  4K0B A;  4DR2 C;  5ADZ A;  2YCB A;  2E8E A;  3CJE A;  5BUR A;  2ZZN A;  1O93 A;  1YGT A;  3LNO A;  4JI5 C;  1XMO C;  1RG9 A;  1XRC A;  2XR1 A;  5JRH A;  2MMA B;  1N34 C;  4PRO C;  3GR0 A;  4PUI A;  3R44 A;  4B3S C;  2YWC A;  4NDN A;  4X62 C;  4LFC C;  2WD9 A;  4JI4 C;  2NCL A;  3T1Y C;  4ODJ A;  3I08 A;  3VNS A;  4DUY C;  4DG9 A;  3LUS A;  4G37 A;  5IT9 D;  4RM2 A;  5FLX D;  3R9W A;  3S82 A;  4EAT A;  1WCJ A;  3LAX A;  2VQF C;  3TUF A;  4NXM C;  3NYQ A;  3CQ2 A;  2OPL A;  4JI3 C;  4GXQ A;  4BBY A;  1M6X A;  2QVZ X;  2JNV A;  3UX3 A;  3VNR A;  4JV5 C;  3CW9 A;  4B3R C;  4NOZ A;  1VLA A;  4RVO A;  5A2Q D;  3FM7 A;  3VNQ A;  4G1I A;  2VSQ A;  4JM1 A;  1P4E C;  1JOS A;  4FUQ A;  3A9V A;  4XX2 A;  5KYT A;  2EGT A;  5K8F A;  2KDN A;  4OXI A;  4X66 C;  2E0G A;  4X65 C;  5A19 A;  4LFA C;  4ZJZ A;  4JI2 C;  1P4E A;  2CXC A;  4DR7 C;  4LF6 C;  1FLO A;  4AQY C;  2MM9 A;  2P20 A;  2KZF A;  4D56 A;  4DR1 C;  1P7L A;  2PRO A;  4BC7 A;  2VQE C;  4JI6 C;  1AMU A;  1V26 A;  1BA3 A;  2QVX X;  5T8S A;  4GKJ C;  2CY1 A;  1XMQ C;  1ULT A;  2ATW A;  2D7V A;  4DR5 C;  3NYR A;  2OBV A;  4GXR A;  4I9G A;  4WS9 A;  4LF5 C;  2DPL A;  3T1H C;  2Z51 A; 
#chains in the Genus database with same CATH homology
 1KKG A;  4RMN A;  2AYA A;  1PG4 A;  5BSV A;  1N32 C;  1ZB8 A;  3IEU A;  1UKK A;  4NXN C;  1QWI A;  4K0K C;  1MD9 A;  4FTF A;  4DV4 C;  2E7G A;  5A1G A;  4X64 C;  4DR4 C;  4YHH C;  4LF9 C;  4D4I A;  1ML8 A;  4B3T C;  5IFI A;  4DCT A;  1HH2 P;  1PG3 A;  4DV6 C;  2UU9 C;  4PHT A;  4RLQ A;  4JI7 C;  1USP A;  4B3M C;  1K0R A;  2ASB A;  3ETO A;  3JAM D;  3KXW A;  4LE5 A;  4DV0 C;  4JI1 C;  4WV3 A;  5A1I A;  3PES A;  5LMN C;  3EQ6 A;  4OX9 C;  4DV3 C;  5AE3 A;  4D4G A;  5H9U A;  4KTV A;  3AF5 A;  3DLP X;  2WP0 C;  2P2Q A;  1O92 A;  2QL8 A;  1MXA A;  1YJ7 A;  3IEV A;  1I94 C;  2Y27 A;  4BC9 A;  1QM4 A;  3GR1 A;  1L2F A;  2Y4N A;  5AE2 A;  1HNZ C;  3LNV A;  3RV2 A;  3B7W A;  1MXB A;  3UOW A;  5GTD A;  2HHH C;  4IR7 A;  1MDB A;  3DHV A;  5E7Q A;  4R1M A;  2UXC C;  4FUT A;  1HNX C;  1HNW C;  1J5E C;  2P2J A;  3G7S A;  2Y4O A;  4GS5 A;  1XRA A;  3OTO C;  3E7W A;  2BH1 X;  1XNQ C;  2PN2 A;  4IZ6 A;  2F4V C;  4OYC A;  2D1Q A;  4ZLP A;  2ONF A;  5BSU A;  3L8C A;  2UXD C;  3TDE A;  4HPV A;  3LGX A;  1XNR C;  3NPD A;  2E8C A;  1FJG C;  2YWB A;  4RM3 A;  2QVY X;  4R0M A;  1WH9 A;  2JMP A;  1FUG A;  3N2Q A;  3ETC A;  5BUS A;  4TPS B;  2P2M A;  5AE1 A;  5KYV A;  5KEI A;  5BSR A;  2UUA C;  3R9X A;  3RG2 A;  2D27 A;  3IML A;  3A9U A;  2V7B A;  1MKY A;  2VZE A;  3SO4 A;  4LFB C;  3GKU A;  2E5L C;  5BSM A;  4LF8 C;  1V25 A;  2D1R A;  4ISB A;  4L4Q A;  2D28 C;  1N2F A;  1N36 C;  5DV9 A;  2OO4 A;  3FCE A;  4JYA C;  3J80 D;  3L95 X;  4JI0 C;  5CZV A;  4DV7 C;  4KHP C;  2UXB C;  1USP B;  1O90 A;  3NI2 A;  3IPL A;  4DV1 C;  4RLF A;  5K85 A;  4L2Z A;  4RVN A;  2BJO A;  2OPL B;  1LQL A;  5BR8 C;  4DR6 C;  4BCA A;  3H2T A;  5BST A;  2P2B A;  2DYJ A;  2HJG A;  4U5Y D;  1WF3 A;  1T5D X;  1XRB A;  4YY3 C;  4KTT A;  5CZX A;  1MXC A;  5T8T A;  4DR3 C;  4L7I A;  3N54 B;  4JI8 C;  3I07 A;  4PZP A;  3EER A;  1IBM C;  4MH4 A;  4GKK C;  1RY2 A;  2D1T A;  3TQI A;  2QW0 X;  4D57 A;  4DUZ C;  3J7A D;  3FCC A;  3A4I A;  3CW8 X;  4DG8 A;  5BUQ A;  4R1L A;  2ZM6 C;  3C5E A;  1ZB9 A;  2UUB C;  4DV2 C;  4DCU A;  3AF6 A;  3PRO C;  2P2F A;  1IBL C;  2P02 A;  3J81 D;  1T5H X;  3PBK A;  1EGA A;  4DCS A;  4G36 A;  4LF4 C;  2UUC C;  1HR0 C;  3E7X A;  3DAY A;  3UZ0 A;  1GPM A;  1O9T A;  1IBK C;  4DV5 C;  1NYE A;  4LF7 C;  1PA4 A;  4I9F A;  5BSW A;  3GPC A;  2PT7 G;  1MDF A;  4DCV A;  4MTN A;  1LCI A;  2D1S A;  1N33 C;  2E8F A;  5IWA C;  5LMU C;  4BSZ A;  4K0B A;  4DR2 C;  5ADZ A;  2YCB A;  2E8E A;  3CJE A;  5BUR A;  1O93 A;  4JI5 C;  1XMO C;  1RG9 A;  1XRC A;  2XR1 A;  5JRH A;  1N34 C;  4PRO C;  3GR0 A;  3R44 A;  4B3S C;  2YWC A;  4NDN A;  4X62 C;  4LFC C;  2WD9 A;  4JI4 C;  3T1Y C;  4ODJ A;  3I08 A;  3VNS A;  4DUY C;  4DG9 A;  3LUS A;  4G37 A;  5IT9 D;  4RM2 A;  5FLX D;  3R9W A;  3S82 A;  4EAT A;  3LAX A;  2VQF C;  3TUF A;  4NXM C;  3NYQ A;  2OPL A;  4JI3 C;  4GXQ A;  4BBY A;  2QVZ X;  3VNR A;  4JV5 C;  3CW9 A;  4B3R C;  4NOZ A;  1VLA A;  4RVO A;  5A2Q D;  3VNQ A;  4G1I A;  2VSQ A;  4JM1 A;  1JOS A;  4FUQ A;  3A9V A;  4XX2 A;  5KYT A;  2EGT A;  5K8F A;  4X66 C;  4OXI A;  2E0G A;  4X65 C;  5A19 A;  4LFA C;  4ZJZ A;  4JI2 C;  4DR7 C;  2CXC A;  4LF6 C;  4AQY C;  2P20 A;  2KZF A;  4D56 A;  4DR1 C;  1P7L A;  2PRO A;  4BC7 A;  2VQE C;  4JI6 C;  1AMU A;  1V26 A;  1BA3 A;  2QVX X;  5T8S A;  4GKJ C;  2CY1 A;  1XMQ C;  1ULT A;  2ATW A;  2D7V A;  4DR5 C;  3NYR A;  2OBV A;  4GXR A;  4I9G A;  4WS9 A;  4LF5 C;  2DPL A;  3T1H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...