1IBLC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1iblC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1iblC02
1ZB8A 4B3SC 1JOSA 4DV5C 3CJEA 4DV1C 2E7GA 1N33C 1PA4A 4LF4C 5LMNC 1XMOC 5A2QD 4JI4C 4LF6C 1N2FA 1LQLA 4B3MC 2QL8A 4DR3C 3J7AD 3AF5A 4MH4A 2ZM6C 3J81D 3AF6A 4JI1C 1IBLC 1WH9A 2UUBC 1HNZC 4LFAC 4JI6C 1ML8A 2PT7G 4NXNC 5LMUC 4X66C 1J5EC 2OPLA 4DV0C 2ONFA 1UKKA 4DCTA 4JI5C 2YCBA 3IEUA 4DCSA 3JAMD 1IBKC 4X62C 4GKJC 1WF3A 4DV7C 4GKKC 4K0KC 4DCUA 1USPA 2PN2A 2HJGA 4DR6C 2D7VA 3LUSA 1MKYA 4MTNA 1XNQC 4LFBC 3GKUA 1KKGA 2E5LC 4DR7C 4X64C 2UUAC 2JMPA 4DUYC 2ATWA 4B3RC 4BSZA 1QWIA 1HH2P 1XNRC 2KZFA 4XX2A 3OTOC 2UUCC 1ZB9A 1USPB 4JV5C 4JI3C 4AQYC 4OX9C 3IEVA 3I07A 1HNWC 3J80D 4DR1C 2E8FA 1FJGC 1N32C 4DV2C 2BJOA 2CXCA 2OPLB 4LF7C 1VLAA 2XR1A 4DV6C 4DR5C 2DYJA 2CY1A 1EGAA 4LF8C 2ASBA 3T1YC 3EERA 5IWAC 1HR0C 4JI7C 4X65C 2VQFC 2F4VC 4NOZA 4LF9C 3R9XA 2E8CA 4B3TC 1HNXC 5IT9D 4YY3C 4JI8C 4KHPC 4DR4C 4JI0C 2VQEC 4JI2C 2UXDC 1NYEA 1XMQC 1L2FA 4DR2C 4LF5C 1IBMC 1N34C 4DCVA 4LFCC 5FLXD 2E8EA 4DV4C 4YHHC 2UU9C 2EGTA 4NXMC 3T1HC 2UXBC 4DUZC 4DV3C 2HHHC 5BR8C 1N36C 1K0RA 2UXCC 3R9WA 1I94C 4JYAC
chains in the Genus database with same CATH superfamily
1JOSA 5BUSA 3NPDA 2YWBA 2JNVA 2D28C 1PA4A 5DV9A 5A2QD 1XHJA 4I9GA 4ISBA 3TUFA 3UX3A 5ADZA 2QL8A 4GXRA 3N2QA 4JI1C 1XDXA 2M5OA 2M5HA 5LCIA 5AE1A 2D1SA 4ODJA 4BC9A 5LMUC 4X66C 1UKKA 4DCTA 4JI5C 2KDNA 4I9FA 4D57A 3IEUA 1WF3A 3A9VA 5GTDA 1USPA 3UEBA 4G1IA 2D7VA 1IB8A 1XNQC 3E7WA 5A1GA 4DG8A 1KKGA 4DR7C 4RMNA 4X64C 3KXWA 2ATWA 4D4IA 2PG1E 1V25A 4XX2A 3CQ3A 4JI3C 1O9TA 1TH5A 3L95X 3PBKA 3A25A 4DR1C 1FLOA 2E8FA 1FJGC 4DV2C 1O93A 2OPLB 3FCCA 2ZZNA 2ASBA 4PZPA 3AY0A 4JI7C 3TDEA 1HR0C 2QVYX 4LF9C 3R9XA 2E8CA 5IT9D 4KHPC 2MMAB 4KTVA 4RLFA 1P7LA 4OXIA 3LGXA 1XMQC 1L2FA 1ULTA 3C5EA 4TPSB 4FTFA 4DV4C 4DG9A 4DUZC 3DAYA 2HHHC 3TQIA 1K0RA 2P2FA 4PUGA 1XRAA 1XRCA 2YX1A 4DV5C 1LCIA 4DV1C 4LF4C 1WCJA 2DPLA 2OO4A 3VNSA 1LQLA 4D56A 4B3MC 3K6RA 5BSVA 2QVZX 3UZ0A 4RLQA 2MCQA 4L2ZA 2DHMA 4IZ6A 2Y4NA 3E7XA 1V60A 2OPLA 2Y27A 2ONFA 1GPMA 5KYTA 2YCBA 2NCLA 3JAMD 5JRHA 4KTTA 5AE2A 2E0GA 1V26A 4GKKC 4DCUA 2P2MA 2PROA 2PN2A 2P2QA 4BC7A 1PG4A 3GKUA 5BUQA 2UUAC 1MXBA 1RG9A 4PROC 5A19A 4RM3A 1HH2P 5A1IA 4K0BA 4L4QA 3B7WA 3IEVA 3I07A 3J80D 5E7QA 3NYQA 5H9UA 5BSTA 2BJOA 2CXCA 4LF7C 3RV2A 3N54B 3GR1A 5IFIA 2CY1A 5T8TA 3T1YC 3LNOA 3EERA 1NY8A 1XS3A 3IMLA 4BCAA 4YY3C 5BSRA 4JI8C 2UXDC 4JI2C 2P2JA 1AMUA 4RM2A 5CZXA 4ZJZA 1N34C 4DCVA 5BSUA 4U5YD 2BH1X 2P2BA 4RVNA 2UXBC 3R44A 1P4EA 1BA3A 4HPVA 4G36A 3R9WA 4JYAC 1ZB8A 2VSQA 2QVXX 1P4EC 3CJEA 1T5HX 2YWCA 2QW0X 3CW8X 5LMNC 4WS9A 1XMOC 4PUIA 2Y4OA 1MDFA 4LF6C 4FUQA 1O92A 4DR3C 2ZM6C 1IBLC 1VEHA 1HNZC 2WD9A 4OYCA 5AE3A 4LFAC 1FUGA 1MXAA 1ML8A 2PT7G 3CQ2A 4L7IA 4NXNC 1PG3A 3CQ1A 1J5EC 5T8SA 5K85A 4RVOA 4DCSA 1IBKC 4DV7C 1M6XC 4EATA 4K0KC 3L8CA 3UOWA 4FUTA 3I08A 1MKYA 4MTNA 2D27A 4IR7A 1YJ7A 4LFBC 2E5LC 3NYRA 2JMPA 2D1QA 4B3RC 4BSZA 1QWIA 1XNRC 2KZFA 3OTOC 1ZB9A 1USPB 4JV5C 4R0MA 3TR3A 4PHTA 3PESA 3GR0A 4BBYA 2D1TA 3VNRA 1N32C 4GXQA 3DHVA 1YGTA 3FCEA 2XR1A 4DV6C 4DR5C 1EGAA 1M6XA 4X65C 1MDBA 4NOZA 1O90A 4B3TC 3A4IA 4DR4C 2VQEC 1NYEA 4LF5C 3G7SA 3LNVA 2CU6A 3SO4A 4LFCC 5FLXD 2E8EA 4YHHC 3ETCA 4JM1A 2UU9C 2EGTA 2KZ0A 3UX2A 2Z51A 5BURA 4WV3A 2P02A 3O2EA 4B3SC 4NDNA 3PROC 2E7GA 1N33C 3H2TA 5BSMA 3FM7A 4JI4C 3S82A 3NI2A 5CZVA 1N2FA 4LE5A 2ZZMA 2D1RA 3DLPX 1RY2A 3A9UA 3J7AD 3AF5A 4MH4A 3J81D 3AF6A 1XRBA 1WH9A 2UUBC 4ZLPA 4JI6C 2WP0C 2VZEA 3ETOA 4DV0C 2AYAA 2ZTBA 4X62C 4GKJC 5K8FA 2HJGA 4DR6C 3CW9A 3LUSA 3VNQA 1MXCA 4DUYC 4R1LA 1T5DX 2UUCC 3GPCA 4G37A 4R1MA 4AQYC 4OX9C 1HNWC 1MD9A 4D4GA 3RG2A 1VLAA 5BSWA 2DYJA 4LF8C 4PUHA 2MM9A 3LAXA 5IWAC 2VQFC 2F4VC 1PU1A 1HNXC 4JI0C 4DR2C 1IBMC 5KYVA 1UWDA 4GS5A 2OBVA 1QM4A 4NXMC 5KEIA 3T1HC 3IPLA 4DV3C 2V7BA 5BR8C 1N36C 2P20A 3A26A 2UXCC 1I94C 3EQ6A
chains in the Genus database with same CATH topology
1JOSA 5BUSA 3NPDA 2YWBA 2D28C 1PA4A 5DV9A 5A2QD 4I9GA 4ISBA 3TUFA 5ADZA 2QL8A 4GXRA 3N2QA 4JI1C 5AE1A 2D1SA 4ODJA 4BC9A 5LMUC 4X66C 1UKKA 4DCTA 4JI5C 4I9FA 4D57A 3IEUA 1WF3A 3A9VA 5GTDA 1USPA 4G1IA 2D7VA 1XNQC 3E7WA 5A1GA 4DG8A 1KKGA 4DR7C 4RMNA 4X64C 3KXWA 2ATWA 4D4IA 1V25A 4XX2A 4JI3C 1O9TA 3L95X 3PBKA 4DR1C 2E8FA 1FJGC 4DV2C 1O93A 2OPLB 3FCCA 2ASBA 4PZPA 4JI7C 3TDEA 1HR0C 2QVYX 4LF9C 3R9XA 2E8CA 5IT9D 4KHPC 4KTVA 4RLFA 1P7LA 4OXIA 1XMQC 3LGXA 1L2FA 1ULTA 3C5EA 4TPSB 4FTFA 4DV4C 4DG9A 4DUZC 3DAYA 2HHHC 3TQIA 1K0RA 2P2FA 1XRAA 1XRCA 4DV5C 1LCIA 4DV1C 4LF4C 2DPLA 2OO4A 3VNSA 1LQLA 4D56A 4B3MC 5BSVA 2QVZX 3UZ0A 4RLQA 4L2ZA 4IZ6A 2Y4NA 3E7XA 2OPLA 2Y27A 2ONFA 1GPMA 5KYTA 2YCBA 3JAMD 5JRHA 4KTTA 5AE2A 2E0GA 1V26A 4GKKC 4DCUA 2P2MA 2PROA 2PN2A 2P2QA 4BC7A 1PG4A 3GKUA 5BUQA 2UUAC 1MXBA 1RG9A 4PROC 5A19A 4RM3A 1HH2P 5A1IA 4K0BA 4L4QA 3B7WA 3IEVA 3I07A 3J80D 5E7QA 3NYQA 5H9UA 5BSTA 2BJOA 2CXCA 4LF7C 3RV2A 3N54B 3GR1A 5IFIA 2CY1A 5T8TA 3T1YC 3EERA 3IMLA 4BCAA 4YY3C 5BSRA 4JI8C 2UXDC 4JI2C 2P2JA 1AMUA 4RM2A 5CZXA 4ZJZA 1N34C 4DCVA 5BSUA 4U5YD 2BH1X 2P2BA 4RVNA 2UXBC 3R44A 1BA3A 4HPVA 4G36A 3R9WA 4JYAC 1ZB8A 2VSQA 2QVXX 3CJEA 1T5HX 2YWCA 2QW0X 3CW8X 5LMNC 4WS9A 1XMOC 2Y4OA 1MDFA 4LF6C 4FUQA 1O92A 4DR3C 2ZM6C 1IBLC 1HNZC 2WD9A 4OYCA 5AE3A 4LFAC 1FUGA 1MXAA 1ML8A 2PT7G 4L7IA 4NXNC 1PG3A 1J5EC 5T8SA 5K85A 4RVOA 4DCSA 1IBKC 4DV7C 4EATA 4K0KC 3L8CA 3UOWA 4FUTA 3I08A 1MKYA 4MTNA 2D27A 4IR7A 1YJ7A 4LFBC 2E5LC 3NYRA 2JMPA 2D1QA 4B3RC 4BSZA 1QWIA 1XNRC 2KZFA 3OTOC 1ZB9A 1USPB 4JV5C 4R0MA 4PHTA 3PESA 3GR0A 4BBYA 2D1TA 3VNRA 1N32C 4GXQA 3DHVA 3FCEA 2XR1A 4DV6C 4DR5C 1EGAA 4X65C 1MDBA 4NOZA 1O90A 4B3TC 3A4IA 4DR4C 2VQEC 4LF5C 1NYEA 3G7SA 3LNVA 3SO4A 4LFCC 5FLXD 2E8EA 4YHHC 3ETCA 4JM1A 2UU9C 2EGTA 5BURA 4WV3A 2P02A 4B3SC 4NDNA 3PROC 2E7GA 1N33C 3H2TA 5BSMA 4JI4C 3S82A 3NI2A 5CZVA 1N2FA 4LE5A 2D1RA 3DLPX 1RY2A 3A9UA 3J7AD 3AF5A 4MH4A 3J81D 3AF6A 1XRBA 1WH9A 2UUBC 4ZLPA 4JI6C 2WP0C 2VZEA 3ETOA 4DV0C 2AYAA 4X62C 4GKJC 5K8FA 2HJGA 4DR6C 3CW9A 3LUSA 3VNQA 1MXCA 4DUYC 4R1LA 1T5DX 2UUCC 3GPCA 4G37A 4R1MA 4AQYC 4OX9C 1HNWC 1MD9A 4D4GA 3RG2A 1VLAA 5BSWA 2DYJA 4LF8C 3LAXA 5IWAC 2VQFC 2F4VC 1HNXC 4JI0C 4DR2C 1IBMC 5KYVA 4GS5A 2OBVA 1QM4A 4NXMC 5KEIA 3T1HC 3IPLA 4DV3C 2V7BA 5BR8C 1N36C 2P20A 2UXCC 1I94C 3EQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB8 A;  4B3S C;  1JOS A;  4DV5 C;  3CJE A;  4DV1 C;  2E7G A;  1N33 C;  1PA4 A;  4LF4 C;  5LMN C;  1XMO C;  5A2Q D;  4JI4 C;  4LF6 C;  1N2F A;  1LQL A;  4B3M C;  2QL8 A;  4DR3 C;  3J7A D;  3AF5 A;  4MH4 A;  2ZM6 C;  3J81 D;  3AF6 A;  4JI1 C;  1IBL C;  1WH9 A;  2UUB C;  1HNZ C;  4LFA C;  4JI6 C;  1ML8 A;  2PT7 G;  4NXN C;  5LMU C;  4X66 C;  1J5E C;  2OPL A;  4DV0 C;  2ONF A;  1UKK A;  4DCT A;  4JI5 C;  2YCB A;  3IEU A;  4DCS A;  3JAM D;  1IBK C;  4X62 C;  4GKJ C;  1WF3 A;  4DV7 C;  4GKK C;  4K0K C;  4DCU A;  1USP A;  2PN2 A;  2HJG A;  4DR6 C;  2D7V A;  3LUS A;  1MKY A;  4MTN A;  1XNQ C;  4LFB C;  3GKU A;  1KKG A;  2E5L C;  4DR7 C;  4X64 C;  2UUA C;  2JMP A;  4DUY C;  2ATW A;  4B3R C;  4BSZ A;  1QWI A;  1HH2 P;  1XNR C;  2KZF A;  4XX2 A;  3OTO C;  2UUC C;  1ZB9 A;  1USP B;  4JV5 C;  4JI3 C;  4AQY C;  4OX9 C;  3IEV A;  3I07 A;  1HNW C;  3J80 D;  4DR1 C;  2E8F A;  1FJG C;  1N32 C;  4DV2 C;  2BJO A;  2CXC A;  2OPL B;  4LF7 C;  1VLA A;  2XR1 A;  4DV6 C;  4DR5 C;  2DYJ A;  2CY1 A;  1EGA A;  4LF8 C;  2ASB A;  3T1Y C;  3EER A;  5IWA C;  1HR0 C;  4JI7 C;  4X65 C;  2VQF C;  2F4V C;  4NOZ A;  4LF9 C;  3R9X A;  2E8C A;  4B3T C;  1HNX C;  5IT9 D;  4YY3 C;  4JI8 C;  4KHP C;  4DR4 C;  4JI0 C;  2VQE C;  4JI2 C;  2UXD C;  1NYE A;  1XMQ C;  1L2F A;  4DR2 C;  4LF5 C;  1IBM C;  1N34 C;  4DCV A;  4LFC C;  5FLX D;  2E8E A;  4DV4 C;  4YHH C;  2UU9 C;  2EGT A;  4NXM C;  3T1H C;  2UXB C;  4DUZ C;  4DV3 C;  2HHH C;  5BR8 C;  1N36 C;  1K0R A;  2UXC C;  3R9W A;  1I94 C;  4JYA C; 
#chains in the Genus database with same CATH topology
 1JOS A;  5BUS A;  3NPD A;  2YWB A;  2JNV A;  2D28 C;  1PA4 A;  5DV9 A;  5A2Q D;  1XHJ A;  4I9G A;  4ISB A;  3TUF A;  3UX3 A;  5ADZ A;  2QL8 A;  4GXR A;  3N2Q A;  4JI1 C;  1XDX A;  2M5O A;  2M5H A;  5LCI A;  5AE1 A;  2D1S A;  4ODJ A;  4BC9 A;  5LMU C;  4X66 C;  1UKK A;  4DCT A;  4JI5 C;  2KDN A;  4I9F A;  4D57 A;  3IEU A;  1WF3 A;  3A9V A;  5GTD A;  1USP A;  3UEB A;  4G1I A;  2D7V A;  1IB8 A;  1XNQ C;  3E7W A;  5A1G A;  4DG8 A;  1KKG A;  4DR7 C;  4RMN A;  4X64 C;  3KXW A;  2ATW A;  4D4I A;  2PG1 E;  1V25 A;  4XX2 A;  3CQ3 A;  4JI3 C;  1O9T A;  1TH5 A;  3L95 X;  3PBK A;  3A25 A;  4DR1 C;  1FLO A;  2E8F A;  1FJG C;  4DV2 C;  1O93 A;  2OPL B;  3FCC A;  2ZZN A;  2ASB A;  4PZP A;  3AY0 A;  4JI7 C;  3TDE A;  1HR0 C;  2QVY X;  4LF9 C;  3R9X A;  2E8C A;  5IT9 D;  4KHP C;  2MMA B;  4KTV A;  4RLF A;  1P7L A;  4OXI A;  3LGX A;  1XMQ C;  1L2F A;  1ULT A;  3C5E A;  4TPS B;  4FTF A;  4DV4 C;  4DG9 A;  4DUZ C;  3DAY A;  2HHH C;  3TQI A;  1K0R A;  2P2F A;  4PUG A;  1XRA A;  1XRC A;  2YX1 A;  4DV5 C;  1LCI A;  4DV1 C;  4LF4 C;  1WCJ A;  2DPL A;  2OO4 A;  3VNS A;  1LQL A;  4D56 A;  4B3M C;  3K6R A;  5BSV A;  2QVZ X;  3UZ0 A;  4RLQ A;  2MCQ A;  4L2Z A;  2DHM A;  4IZ6 A;  2Y4N A;  3E7X A;  1V60 A;  2OPL A;  2Y27 A;  2ONF A;  1GPM A;  5KYT A;  2YCB A;  2NCL A;  3JAM D;  5JRH A;  4KTT A;  5AE2 A;  2E0G A;  1V26 A;  4GKK C;  4DCU A;  2P2M A;  2PRO A;  2PN2 A;  2P2Q A;  4BC7 A;  1PG4 A;  3GKU A;  5BUQ A;  2UUA C;  1MXB A;  1RG9 A;  4PRO C;  5A19 A;  4RM3 A;  1HH2 P;  5A1I A;  4K0B A;  4L4Q A;  3B7W A;  3IEV A;  3I07 A;  3J80 D;  5E7Q A;  3NYQ A;  5H9U A;  5BST A;  2BJO A;  2CXC A;  4LF7 C;  3RV2 A;  3N54 B;  3GR1 A;  5IFI A;  2CY1 A;  5T8T A;  3T1Y C;  3LNO A;  3EER A;  1NY8 A;  1XS3 A;  3IML A;  4BCA A;  4YY3 C;  5BSR A;  4JI8 C;  2UXD C;  4JI2 C;  2P2J A;  1AMU A;  4RM2 A;  5CZX A;  4ZJZ A;  1N34 C;  4DCV A;  5BSU A;  4U5Y D;  2BH1 X;  2P2B A;  4RVN A;  2UXB C;  3R44 A;  1P4E A;  1BA3 A;  4HPV A;  4G36 A;  3R9W A;  4JYA C;  1ZB8 A;  2VSQ A;  2QVX X;  1P4E C;  3CJE A;  1T5H X;  2YWC A;  2QW0 X;  3CW8 X;  5LMN C;  4WS9 A;  1XMO C;  4PUI A;  2Y4O A;  1MDF A;  4LF6 C;  4FUQ A;  1O92 A;  4DR3 C;  2ZM6 C;  1IBL C;  1VEH A;  1HNZ C;  2WD9 A;  4OYC A;  5AE3 A;  4LFA C;  1FUG A;  1MXA A;  1ML8 A;  2PT7 G;  3CQ2 A;  4L7I A;  4NXN C;  1PG3 A;  3CQ1 A;  1J5E C;  5T8S A;  5K85 A;  4RVO A;  4DCS A;  1IBK C;  4DV7 C;  1M6X C;  4EAT A;  4K0K C;  3L8C A;  3UOW A;  4FUT A;  3I08 A;  1MKY A;  4MTN A;  2D27 A;  4IR7 A;  1YJ7 A;  4LFB C;  2E5L C;  3NYR A;  2JMP A;  2D1Q A;  4B3R C;  4BSZ A;  1QWI A;  1XNR C;  2KZF A;  3OTO C;  1ZB9 A;  1USP B;  4JV5 C;  4R0M A;  3TR3 A;  4PHT A;  3PES A;  3GR0 A;  4BBY A;  2D1T A;  3VNR A;  1N32 C;  4GXQ A;  3DHV A;  1YGT A;  3FCE A;  2XR1 A;  4DV6 C;  4DR5 C;  1EGA A;  1M6X A;  4X65 C;  1MDB A;  4NOZ A;  1O90 A;  4B3T C;  3A4I A;  4DR4 C;  2VQE C;  1NYE A;  4LF5 C;  3G7S A;  3LNV A;  2CU6 A;  3SO4 A;  4LFC C;  5FLX D;  2E8E A;  4YHH C;  3ETC A;  4JM1 A;  2UU9 C;  2EGT A;  2KZ0 A;  3UX2 A;  2Z51 A;  5BUR A;  4WV3 A;  2P02 A;  3O2E A;  4B3S C;  4NDN A;  3PRO C;  2E7G A;  1N33 C;  3H2T A;  5BSM A;  3FM7 A;  4JI4 C;  3S82 A;  3NI2 A;  5CZV A;  1N2F A;  4LE5 A;  2ZZM A;  2D1R A;  3DLP X;  1RY2 A;  3A9U A;  3J7A D;  3AF5 A;  4MH4 A;  3J81 D;  3AF6 A;  1XRB A;  1WH9 A;  2UUB C;  4ZLP A;  4JI6 C;  2WP0 C;  2VZE A;  3ETO A;  4DV0 C;  2AYA A;  2ZTB A;  4X62 C;  4GKJ C;  5K8F A;  2HJG A;  4DR6 C;  3CW9 A;  3LUS A;  3VNQ A;  1MXC A;  4DUY C;  4R1L A;  1T5D X;  2UUC C;  3GPC A;  4G37 A;  4R1M A;  4AQY C;  4OX9 C;  1HNW C;  1MD9 A;  4D4G A;  3RG2 A;  1VLA A;  5BSW A;  2DYJ A;  4LF8 C;  4PUH A;  2MM9 A;  3LAX A;  5IWA C;  2VQF C;  2F4V C;  1PU1 A;  1HNX C;  4JI0 C;  4DR2 C;  1IBM C;  5KYV A;  1UWD A;  4GS5 A;  2OBV A;  1QM4 A;  4NXM C;  5KEI A;  3T1H C;  3IPL A;  4DV3 C;  2V7B A;  5BR8 C;  1N36 C;  2P20 A;  3A26 A;  2UXC C;  1I94 C;  3EQ6 A; 
#chains in the Genus database with same CATH homology
 1JOS A;  5BUS A;  3NPD A;  2YWB A;  2D28 C;  1PA4 A;  5DV9 A;  5A2Q D;  4I9G A;  4ISB A;  3TUF A;  5ADZ A;  2QL8 A;  4GXR A;  3N2Q A;  4JI1 C;  5AE1 A;  2D1S A;  4ODJ A;  4BC9 A;  5LMU C;  4X66 C;  1UKK A;  4DCT A;  4JI5 C;  4I9F A;  4D57 A;  3IEU A;  1WF3 A;  3A9V A;  5GTD A;  1USP A;  4G1I A;  2D7V A;  1XNQ C;  3E7W A;  5A1G A;  4DG8 A;  1KKG A;  4DR7 C;  4RMN A;  4X64 C;  3KXW A;  2ATW A;  4D4I A;  1V25 A;  4XX2 A;  4JI3 C;  1O9T A;  3L95 X;  3PBK A;  4DR1 C;  2E8F A;  1FJG C;  4DV2 C;  1O93 A;  2OPL B;  3FCC A;  2ASB A;  4PZP A;  4JI7 C;  3TDE A;  1HR0 C;  2QVY X;  4LF9 C;  3R9X A;  2E8C A;  5IT9 D;  4KHP C;  4KTV A;  4RLF A;  1P7L A;  4OXI A;  1XMQ C;  3LGX A;  1L2F A;  1ULT A;  3C5E A;  4TPS B;  4FTF A;  4DV4 C;  4DG9 A;  4DUZ C;  3DAY A;  2HHH C;  3TQI A;  1K0R A;  2P2F A;  1XRA A;  1XRC A;  4DV5 C;  1LCI A;  4DV1 C;  4LF4 C;  2DPL A;  2OO4 A;  3VNS A;  1LQL A;  4D56 A;  4B3M C;  5BSV A;  2QVZ X;  3UZ0 A;  4RLQ A;  4L2Z A;  4IZ6 A;  2Y4N A;  3E7X A;  2OPL A;  2Y27 A;  2ONF A;  1GPM A;  5KYT A;  2YCB A;  3JAM D;  5JRH A;  4KTT A;  5AE2 A;  2E0G A;  1V26 A;  4GKK C;  4DCU A;  2P2M A;  2PRO A;  2PN2 A;  2P2Q A;  4BC7 A;  1PG4 A;  3GKU A;  5BUQ A;  2UUA C;  1MXB A;  1RG9 A;  4PRO C;  5A19 A;  4RM3 A;  1HH2 P;  5A1I A;  4K0B A;  4L4Q A;  3B7W A;  3IEV A;  3I07 A;  3J80 D;  5E7Q A;  3NYQ A;  5H9U A;  5BST A;  2BJO A;  2CXC A;  4LF7 C;  3RV2 A;  3N54 B;  3GR1 A;  5IFI A;  2CY1 A;  5T8T A;  3T1Y C;  3EER A;  3IML A;  4BCA A;  4YY3 C;  5BSR A;  4JI8 C;  2UXD C;  4JI2 C;  2P2J A;  1AMU A;  4RM2 A;  5CZX A;  4ZJZ A;  1N34 C;  4DCV A;  5BSU A;  4U5Y D;  2BH1 X;  2P2B A;  4RVN A;  2UXB C;  3R44 A;  1BA3 A;  4HPV A;  4G36 A;  3R9W A;  4JYA C;  1ZB8 A;  2VSQ A;  2QVX X;  3CJE A;  1T5H X;  2YWC A;  2QW0 X;  3CW8 X;  5LMN C;  4WS9 A;  1XMO C;  2Y4O A;  1MDF A;  4LF6 C;  4FUQ A;  1O92 A;  4DR3 C;  2ZM6 C;  1IBL C;  1HNZ C;  2WD9 A;  4OYC A;  5AE3 A;  4LFA C;  1FUG A;  1MXA A;  1ML8 A;  2PT7 G;  4L7I A;  4NXN C;  1PG3 A;  1J5E C;  5T8S A;  5K85 A;  4RVO A;  4DCS A;  1IBK C;  4DV7 C;  4EAT A;  4K0K C;  3L8C A;  3UOW A;  4FUT A;  3I08 A;  1MKY A;  4MTN A;  2D27 A;  4IR7 A;  1YJ7 A;  4LFB C;  2E5L C;  3NYR A;  2JMP A;  2D1Q A;  4B3R C;  4BSZ A;  1QWI A;  1XNR C;  2KZF A;  3OTO C;  1ZB9 A;  1USP B;  4JV5 C;  4R0M A;  4PHT A;  3PES A;  3GR0 A;  4BBY A;  2D1T A;  3VNR A;  1N32 C;  4GXQ A;  3DHV A;  3FCE A;  2XR1 A;  4DV6 C;  4DR5 C;  1EGA A;  4X65 C;  1MDB A;  4NOZ A;  1O90 A;  4B3T C;  3A4I A;  4DR4 C;  2VQE C;  4LF5 C;  1NYE A;  3G7S A;  3LNV A;  3SO4 A;  4LFC C;  5FLX D;  2E8E A;  4YHH C;  3ETC A;  4JM1 A;  2UU9 C;  2EGT A;  5BUR A;  4WV3 A;  2P02 A;  4B3S C;  4NDN A;  3PRO C;  2E7G A;  1N33 C;  3H2T A;  5BSM A;  4JI4 C;  3S82 A;  3NI2 A;  5CZV A;  1N2F A;  4LE5 A;  2D1R A;  3DLP X;  1RY2 A;  3A9U A;  3J7A D;  3AF5 A;  4MH4 A;  3J81 D;  3AF6 A;  1XRB A;  1WH9 A;  2UUB C;  4ZLP A;  4JI6 C;  2WP0 C;  2VZE A;  3ETO A;  4DV0 C;  2AYA A;  4X62 C;  4GKJ C;  5K8F A;  2HJG A;  4DR6 C;  3CW9 A;  3LUS A;  3VNQ A;  1MXC A;  4DUY C;  4R1L A;  1T5D X;  2UUC C;  3GPC A;  4G37 A;  4R1M A;  4AQY C;  4OX9 C;  1HNW C;  1MD9 A;  4D4G A;  3RG2 A;  1VLA A;  5BSW A;  2DYJ A;  4LF8 C;  3LAX A;  5IWA C;  2VQF C;  2F4V C;  1HNX C;  4JI0 C;  4DR2 C;  1IBM C;  5KYV A;  4GS5 A;  2OBV A;  1QM4 A;  4NXM C;  5KEI A;  3T1H C;  3IPL A;  4DV3 C;  2V7B A;  5BR8 C;  1N36 C;  2P20 A;  2UXC C;  1I94 C;  3EQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...