1IBLC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1iblC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1iblC02
1XMOC 2CXCA 1HH2P 1QWIA 1K0RA 2XR1A 4DR7C 1IBKC 4DCTA 4LF6C 4DR6C 2ATWA 1ML8A 2D7VA 3J80D 1J5EC 4LFCC 4B3MC 1XNQC 4DV1C 1USPB 3AF6A 4X62C 5LMNC 2ASBA 2UUAC 4DUZC 4LF8C 4DR5C 1IBLC 4JYAC 2E5LC 4JV5C 4DV0C 1MKYA 4JI3C 3AF5A 1USPA 1ZB8A 4DR1C 2UU9C 5A2QD 4JI2C 4JI5C 4B3SC 3GKUA 4DR3C 2F4VC 4X66C 2E7GA 4LF4C 4BSZA 1N34C 1I94C 1VLAA 4DV2C 4NOZA 1IBMC 3T1HC 4YY3C 5IT9D 3LUSA 4JI0C 5LMUC 4JI1C 5IWAC 4KHPC 4DV6C 2UXDC 4GKKC 4K0KC 2BJOA 2OPLA 2PN2A 2VQEC 1HNXC 3EERA 4X64C 2UUCC 2E8FA 4LF7C 2DYJA 1HR0C 4JI7C 4JI4C 1JOSA 1FJGC 1L2FA 4B3RC 1WF3A 3T1YC 4DCSA 1HNZC 2ONFA 2HHHC 2PT7G 2E8EA 1EGAA 2UUBC 4JI8C 4OX9C 4DV3C 4DR2C 1WH9A 1XMQC 4LFAC 3IEUA 3JAMD 2ZM6C 2HJGA 4NXMC 4DV4C 4GKJC 4YHHC 2E8CA 4LF9C 1N32C 3OTOC 3J81D 4DCVA 1PA4A 4XX2A 4MH4A 2OPLB 1XNRC 1ZB9A 2UXCC 1NYEA 4DV5C 4LF5C 1KKGA 4JI6C 2JMPA 1LQLA 3I07A 2QL8A 4NXNC 1N36C 4X65C 5FLXD 3CJEA 1UKKA 3R9XA 4LFBC 1N2FA 2YCBA 4DUYC 2EGTA 4AQYC 4DV7C 3IEVA 1HNWC 5BR8C 2CY1A 4DCUA 1N33C 2KZFA 2UXBC 4MTNA 4B3TC 3R9WA 4DR4C 3J7AD 2VQFC
chains in the Genus database with same CATH superfamily
1M6XA 2ZTBA 3EQ6A 2CXCA 1HH2P 1QWIA 3UX2A 4KTVA 4IZ6A 1IBKC 1ML8A 4B3MC 4BCAA 2PROA 4EATA 4X62C 2E5LC 4JV5C 3I08A 4RM2A 4D4GA 3AF5A 1USPA 2P2QA 2UU9C 4OXIA 4JI5C 5CZVA 3K6RA 1MDBA 4DR3C 3LGXA 5K8FA 1RY2A 4DV2C 1T5DX 4PUHA 2P2MA 5H9UA 1IB8A 5IT9D 2YWCA 4JI0C 4GKKC 2BH1X 1MD9A 2PN2A 1HNXC 5CZXA 4X64C 2E8FA 1M6XC 5BSTA 5BSUA 3NPDA 4D4IA 1FJGC 4B3RC 5K85A 2UUBC 3CW8X 4OX9C 2YX1A 1FUGA 4D56A 1O92A 4DV4C 4GKJC 4DG9A 2E8CA 2PG1E 3J81D 4XX2A 1XNRC 1ZB9A 1XS3A 4LF5C 1KKGA 1RG9A 5BUSA 1T5HX 1PG4A 5FLXD 3CJEA 2YCBA 2EGTA 4WV3A 2MMAB 1MXBA 1BA3A 4R0MA 4MTNA 3NI2A 4B3TC 3ETCA 4RVOA 2YWBA 3TQIA 3UX3A 1TH5A 5BSVA 2XR1A 1K0RA 3DHVA 5T8TA 4TPSB 1XDXA 4LF6C 4G1IA 3O2EA 4RMNA 2ZZMA 2P2JA 4BC7A 1O9TA 4RLFA 3FCCA 3AF6A 2CU6A 3R44A 4ODJA 2WP0C 4JYAC 2M5OA 4JI3C 4DG8A 3ETOA 5A2QD 4U5YD 4OYCA 3VNRA 2Y27A 1PG3A 4LF4C 1YGTA 5AE3A 2VSQA 4HPVA 3NYRA 1I94C 4NOZA 4PUIA 2Z51A 5AE2A 5IWAC 1MDFA 1UWDA 1V26A 4KHPC 3TUFA 2UXDC 4FTFA 1O90A 4NDNA 4K0KC 3N2QA 2VQEC 4KTTA 2UUCC 1O93A 1HR0C 3N54B 3NYQA 1JOSA 3LNOA 1WF3A 3UOWA 2D28C 2NCLA 2E8EA 2DHMA 3C5EA 3DAYA 3RG2A 3S82A 4ZJZA 3H2TA 2HJGA 2MCQA 4LF9C 4GXRA 3OTOC 2AYAA 3CQ2A 2OPLB 1XHJA 3L8CA 2UXCC 3FCEA 5KEIA 4D57A 5T8SA 1LQLA 2QL8A 4NXNC 1N36C 3VNSA 4LFBC 3R9XA 1N2FA 4JM1A 4RLQA 4PHTA 3IEVA 1HNWC 5BR8C 1V25A 3LNVA 2KZFA 3A9VA 3R9WA 4DR4C 1FLOA 2D27A 2MM9A 1XMOC 3SO4A 3UEBA 2Y4OA 4DR7C 4PUGA 2ATWA 2D7VA 1J5EC 1XRAA 4PZPA 3A4IA 4PROC 4DV1C 4IR7A 2QW0X 5LMNC 1MXCA 5ADZA 2UUAC 3AY0A 3PBKA 4LF8C 4DR5C 3L95X 5KYVA 4DV0C 2D1QA 1ZB8A 1ULTA 4JI2C 4FUQA 1MXAA 3GKUA 2QVXX 5BURA 1P7LA 4BSZA 4RM3A 1GPMA 2P2BA 3TDEA 1IBMC 2KDNA 4JI1C 1V60A 5A1GA 4G36A 2DPLA 2KZ0A 3GR1A 4DV6C 4BBYA 2OO4A 2BJOA 2ZZNA 2OPLA 5BSWA 3CQ3A 5A1IA 3EERA 4WS9A 1LCIA 4I9FA 2DYJA 3GPCA 1NY8A 1L2FA 3T1YC 2ONFA 2PT7G 4R1MA 5DV9A 1PU1A 4LE5A 4JI8C 4DR2C 1WH9A 5A19A 3IEUA 3JAMD 2ZM6C 4YHHC 3DLPX 4G37A 1N32C 4DCVA 4L2ZA 3E7XA 3KXWA 1NYEA 2JNVA 3A25A 1YJ7A 2JMPA 3E7WA 4X65C 2QVYX 4GXQA 3LAXA 3RV2A 2D1TA 2CY1A 3FM7A 2UXBC 4FUTA 2VZEA 4ISBA 5E7QA 3B7WA 4DCTA 4DR6C 4K0BA 4ZLPA 3J80D 4LFCC 1XNQC 1USPB 2D1RA 1VEHA 2ASBA 2P02A 3CQ1A 4DUZC 1IBLC 2E0GA 2M5HA 5GTDA 1MKYA 4DR1C 3GR0A 5BUQA 3CW9A 4B3SC 3A9UA 2F4VC 1XRBA 4X66C 2E7GA 1N34C 1VLAA 5JRHA 3T1HC 3PROC 4YY3C 3LUSA 1WCJA 5LMUC 1P4EA 4R1LA 1XRCA 1QM4A 3PESA 2QVZX 3VNQA 4I9GA 4LF7C 4JI7C 4JI4C 1HNZC 4DCSA 2HHHC 4BC9A 1EGAA 1P4EC 4DV3C 3UZ0A 5KYTA 2D1SA 3IMLA 4L7IA 1XMQC 4LFAC 3IPLA 4NXMC 3G7SA 3TR3A 2WD9A 1PA4A 1AMUA 5BSRA 4MH4A 5AE1A 5IFIA 4DV5C 2P2FA 4GS5A 4JI6C 3I07A 5BSMA 5LCIA 1UKKA 3A26A 4L4QA 4DUYC 4AQYC 2V7BA 4DV7C 2Y4NA 2P20A 2OBVA 4DCUA 1N33C 4RVNA 3J7AD 2VQFC
chains in the Genus database with same CATH topology
3EQ6A 2CXCA 1HH2P 1QWIA 4KTVA 4IZ6A 1IBKC 1ML8A 4B3MC 4BCAA 2PROA 4EATA 4X62C 2E5LC 4JV5C 3I08A 4RM2A 4D4GA 3AF5A 1USPA 2P2QA 2UU9C 4OXIA 4JI5C 5CZVA 1MDBA 4DR3C 3LGXA 5K8FA 1RY2A 4DV2C 1T5DX 2P2MA 5H9UA 5IT9D 2YWCA 4JI0C 4GKKC 2BH1X 1MD9A 2PN2A 1HNXC 5CZXA 4X64C 2E8FA 5BSTA 5BSUA 3NPDA 4D4IA 1FJGC 4B3RC 5K85A 2UUBC 3CW8X 4OX9C 1FUGA 4D56A 1O92A 4DV4C 4GKJC 4DG9A 2E8CA 3J81D 4XX2A 1XNRC 1ZB9A 4LF5C 1KKGA 1RG9A 5BUSA 1T5HX 1PG4A 5FLXD 3CJEA 2YCBA 2EGTA 4WV3A 1MXBA 1BA3A 4R0MA 4MTNA 3NI2A 4B3TC 3ETCA 4RVOA 2YWBA 3TQIA 5BSVA 2XR1A 1K0RA 3DHVA 5T8TA 4TPSB 4LF6C 4G1IA 4RMNA 2P2JA 4BC7A 1O9TA 4RLFA 3FCCA 3AF6A 3R44A 4ODJA 2WP0C 4JYAC 4JI3C 4DG8A 3ETOA 5A2QD 4U5YD 4OYCA 3VNRA 2Y27A 1PG3A 4LF4C 5AE3A 2VSQA 4HPVA 1I94C 3NYRA 4NOZA 5AE2A 5IWAC 1MDFA 1V26A 4KHPC 3TUFA 2UXDC 4FTFA 1O90A 4NDNA 4K0KC 3N2QA 2VQEC 4KTTA 2UUCC 1O93A 1HR0C 3N54B 3NYQA 1JOSA 1WF3A 3UOWA 2D28C 2E8EA 3C5EA 3DAYA 3RG2A 3S82A 4ZJZA 3H2TA 2HJGA 4LF9C 4GXRA 3OTOC 2AYAA 2OPLB 3L8CA 2UXCC 3FCEA 5KEIA 4D57A 5T8SA 1LQLA 2QL8A 4NXNC 1N36C 3VNSA 4LFBC 3R9XA 1N2FA 4JM1A 4RLQA 4PHTA 3IEVA 1HNWC 5BR8C 1V25A 3LNVA 2KZFA 3A9VA 3R9WA 4DR4C 2D27A 1XMOC 3SO4A 2Y4OA 4DR7C 2ATWA 2D7VA 1J5EC 1XRAA 4PZPA 3A4IA 4PROC 4DV1C 4IR7A 2QW0X 5LMNC 1MXCA 5ADZA 2UUAC 3PBKA 4LF8C 4DR5C 3L95X 5KYVA 4DV0C 2D1QA 1ZB8A 1ULTA 4JI2C 4FUQA 1MXAA 3GKUA 2QVXX 5BURA 1P7LA 4BSZA 4RM3A 1GPMA 2P2BA 3TDEA 1IBMC 4JI1C 5A1GA 4G36A 2DPLA 3GR1A 4DV6C 4BBYA 2OO4A 2BJOA 2OPLA 5BSWA 5A1IA 3EERA 4WS9A 1LCIA 4I9FA 2DYJA 3GPCA 1L2FA 3T1YC 2ONFA 2PT7G 4R1MA 5DV9A 4LE5A 4JI8C 4DR2C 1WH9A 5A19A 3IEUA 3JAMD 2ZM6C 4YHHC 3DLPX 4G37A 1N32C 4DCVA 4L2ZA 3E7XA 3KXWA 1NYEA 1YJ7A 2JMPA 3E7WA 4X65C 2QVYX 4GXQA 3LAXA 3RV2A 2D1TA 2CY1A 2UXBC 4FUTA 2VZEA 4ISBA 5E7QA 3B7WA 4DCTA 4DR6C 4K0BA 4ZLPA 3J80D 4LFCC 1XNQC 1USPB 2D1RA 2ASBA 2P02A 4DUZC 1IBLC 2E0GA 5GTDA 1MKYA 4DR1C 3GR0A 5BUQA 3CW9A 4B3SC 3A9UA 2F4VC 1XRBA 4X66C 2E7GA 1N34C 1VLAA 5JRHA 3T1HC 3PROC 4YY3C 3LUSA 5LMUC 4R1LA 1XRCA 1QM4A 3PESA 2QVZX 3VNQA 4I9GA 4LF7C 4JI7C 4JI4C 1HNZC 4DCSA 2HHHC 4BC9A 1EGAA 4DV3C 3UZ0A 5KYTA 2D1SA 3IMLA 4L7IA 1XMQC 4LFAC 3IPLA 4NXMC 3G7SA 2WD9A 1PA4A 1AMUA 5BSRA 4MH4A 5AE1A 5IFIA 4DV5C 2P2FA 4GS5A 4JI6C 3I07A 5BSMA 1UKKA 4L4QA 4DUYC 4AQYC 2V7BA 4DV7C 2Y4NA 2P20A 2OBVA 4DCUA 1N33C 4RVNA 3J7AD 2VQFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO C;  2CXC A;  1HH2 P;  1QWI A;  1K0R A;  2XR1 A;  4DR7 C;  1IBK C;  4DCT A;  4LF6 C;  4DR6 C;  2ATW A;  1ML8 A;  2D7V A;  3J80 D;  1J5E C;  4LFC C;  4B3M C;  1XNQ C;  4DV1 C;  1USP B;  3AF6 A;  4X62 C;  5LMN C;  2ASB A;  2UUA C;  4DUZ C;  4LF8 C;  4DR5 C;  1IBL C;  4JYA C;  2E5L C;  4JV5 C;  4DV0 C;  1MKY A;  4JI3 C;  3AF5 A;  1USP A;  1ZB8 A;  4DR1 C;  2UU9 C;  5A2Q D;  4JI2 C;  4JI5 C;  4B3S C;  3GKU A;  4DR3 C;  2F4V C;  4X66 C;  2E7G A;  4LF4 C;  4BSZ A;  1N34 C;  1I94 C;  1VLA A;  4DV2 C;  4NOZ A;  1IBM C;  3T1H C;  4YY3 C;  5IT9 D;  3LUS A;  4JI0 C;  5LMU C;  4JI1 C;  5IWA C;  4KHP C;  4DV6 C;  2UXD C;  4GKK C;  4K0K C;  2BJO A;  2OPL A;  2PN2 A;  2VQE C;  1HNX C;  3EER A;  4X64 C;  2UUC C;  2E8F A;  4LF7 C;  2DYJ A;  1HR0 C;  4JI7 C;  4JI4 C;  1JOS A;  1FJG C;  1L2F A;  4B3R C;  1WF3 A;  3T1Y C;  4DCS A;  1HNZ C;  2ONF A;  2HHH C;  2PT7 G;  2E8E A;  1EGA A;  2UUB C;  4JI8 C;  4OX9 C;  4DV3 C;  4DR2 C;  1WH9 A;  1XMQ C;  4LFA C;  3IEU A;  3JAM D;  2ZM6 C;  2HJG A;  4NXM C;  4DV4 C;  4GKJ C;  4YHH C;  2E8C A;  4LF9 C;  1N32 C;  3OTO C;  3J81 D;  4DCV A;  1PA4 A;  4XX2 A;  4MH4 A;  2OPL B;  1XNR C;  1ZB9 A;  2UXC C;  1NYE A;  4DV5 C;  4LF5 C;  1KKG A;  4JI6 C;  2JMP A;  1LQL A;  3I07 A;  2QL8 A;  4NXN C;  1N36 C;  4X65 C;  5FLX D;  3CJE A;  1UKK A;  3R9X A;  4LFB C;  1N2F A;  2YCB A;  4DUY C;  2EGT A;  4AQY C;  4DV7 C;  3IEV A;  1HNW C;  5BR8 C;  2CY1 A;  4DCU A;  1N33 C;  2KZF A;  2UXB C;  4MTN A;  4B3T C;  3R9W A;  4DR4 C;  3J7A D;  2VQF C; 
#chains in the Genus database with same CATH topology
 1M6X A;  2ZTB A;  3EQ6 A;  2CXC A;  1HH2 P;  1QWI A;  3UX2 A;  4KTV A;  4IZ6 A;  1IBK C;  1ML8 A;  4B3M C;  4BCA A;  2PRO A;  4EAT A;  4X62 C;  2E5L C;  4JV5 C;  3I08 A;  4RM2 A;  4D4G A;  3AF5 A;  1USP A;  2P2Q A;  2UU9 C;  4OXI A;  4JI5 C;  5CZV A;  3K6R A;  1MDB A;  4DR3 C;  3LGX A;  5K8F A;  1RY2 A;  4DV2 C;  1T5D X;  4PUH A;  2P2M A;  5H9U A;  1IB8 A;  5IT9 D;  2YWC A;  4JI0 C;  4GKK C;  2BH1 X;  1MD9 A;  2PN2 A;  1HNX C;  5CZX A;  4X64 C;  2E8F A;  1M6X C;  5BST A;  5BSU A;  3NPD A;  4D4I A;  1FJG C;  4B3R C;  5K85 A;  2UUB C;  3CW8 X;  4OX9 C;  2YX1 A;  1FUG A;  4D56 A;  1O92 A;  4DV4 C;  4GKJ C;  4DG9 A;  2E8C A;  2PG1 E;  3J81 D;  4XX2 A;  1XNR C;  1ZB9 A;  1XS3 A;  4LF5 C;  1KKG A;  1RG9 A;  5BUS A;  1T5H X;  1PG4 A;  5FLX D;  3CJE A;  2YCB A;  2EGT A;  4WV3 A;  2MMA B;  1MXB A;  1BA3 A;  4R0M A;  4MTN A;  3NI2 A;  4B3T C;  3ETC A;  4RVO A;  2YWB A;  3TQI A;  3UX3 A;  1TH5 A;  5BSV A;  2XR1 A;  1K0R A;  3DHV A;  5T8T A;  4TPS B;  1XDX A;  4LF6 C;  4G1I A;  3O2E A;  4RMN A;  2ZZM A;  2P2J A;  4BC7 A;  1O9T A;  4RLF A;  3FCC A;  3AF6 A;  2CU6 A;  3R44 A;  4ODJ A;  2WP0 C;  4JYA C;  2M5O A;  4JI3 C;  4DG8 A;  3ETO A;  5A2Q D;  4U5Y D;  4OYC A;  3VNR A;  2Y27 A;  1PG3 A;  4LF4 C;  1YGT A;  5AE3 A;  2VSQ A;  4HPV A;  3NYR A;  1I94 C;  4NOZ A;  4PUI A;  2Z51 A;  5AE2 A;  5IWA C;  1MDF A;  1UWD A;  1V26 A;  4KHP C;  3TUF A;  2UXD C;  4FTF A;  1O90 A;  4NDN A;  4K0K C;  3N2Q A;  2VQE C;  4KTT A;  2UUC C;  1O93 A;  1HR0 C;  3N54 B;  3NYQ A;  1JOS A;  3LNO A;  1WF3 A;  3UOW A;  2D28 C;  2NCL A;  2E8E A;  2DHM A;  3C5E A;  3DAY A;  3RG2 A;  3S82 A;  4ZJZ A;  3H2T A;  2HJG A;  2MCQ A;  4LF9 C;  4GXR A;  3OTO C;  2AYA A;  3CQ2 A;  2OPL B;  1XHJ A;  3L8C A;  2UXC C;  3FCE A;  5KEI A;  4D57 A;  5T8S A;  1LQL A;  2QL8 A;  4NXN C;  1N36 C;  3VNS A;  4LFB C;  3R9X A;  1N2F A;  4JM1 A;  4RLQ A;  4PHT A;  3IEV A;  1HNW C;  5BR8 C;  1V25 A;  3LNV A;  2KZF A;  3A9V A;  3R9W A;  4DR4 C;  1FLO A;  2D27 A;  2MM9 A;  1XMO C;  3SO4 A;  3UEB A;  2Y4O A;  4DR7 C;  4PUG A;  2ATW A;  2D7V A;  1J5E C;  1XRA A;  4PZP A;  3A4I A;  4PRO C;  4DV1 C;  4IR7 A;  2QW0 X;  5LMN C;  1MXC A;  5ADZ A;  2UUA C;  3AY0 A;  3PBK A;  4LF8 C;  4DR5 C;  3L95 X;  5KYV A;  4DV0 C;  2D1Q A;  1ZB8 A;  1ULT A;  4JI2 C;  4FUQ A;  1MXA A;  3GKU A;  2QVX X;  5BUR A;  1P7L A;  4BSZ A;  4RM3 A;  1GPM A;  2P2B A;  3TDE A;  1IBM C;  2KDN A;  4JI1 C;  1V60 A;  5A1G A;  4G36 A;  2DPL A;  2KZ0 A;  3GR1 A;  4DV6 C;  4BBY A;  2OO4 A;  2BJO A;  2ZZN A;  2OPL A;  5BSW A;  3CQ3 A;  5A1I A;  3EER A;  4WS9 A;  1LCI A;  4I9F A;  2DYJ A;  3GPC A;  1NY8 A;  1L2F A;  3T1Y C;  2ONF A;  2PT7 G;  4R1M A;  5DV9 A;  1PU1 A;  4LE5 A;  4JI8 C;  4DR2 C;  1WH9 A;  5A19 A;  3IEU A;  3JAM D;  2ZM6 C;  4YHH C;  3DLP X;  4G37 A;  1N32 C;  4DCV A;  4L2Z A;  3E7X A;  3KXW A;  1NYE A;  2JNV A;  3A25 A;  1YJ7 A;  2JMP A;  3E7W A;  4X65 C;  2QVY X;  4GXQ A;  3LAX A;  3RV2 A;  2D1T A;  2CY1 A;  3FM7 A;  2UXB C;  4FUT A;  2VZE A;  4ISB A;  5E7Q A;  3B7W A;  4DCT A;  4DR6 C;  4K0B A;  4ZLP A;  3J80 D;  4LFC C;  1XNQ C;  1USP B;  2D1R A;  1VEH A;  2ASB A;  2P02 A;  3CQ1 A;  4DUZ C;  1IBL C;  2E0G A;  2M5H A;  5GTD A;  1MKY A;  4DR1 C;  3GR0 A;  5BUQ A;  3CW9 A;  4B3S C;  3A9U A;  2F4V C;  1XRB A;  4X66 C;  2E7G A;  1N34 C;  1VLA A;  5JRH A;  3T1H C;  3PRO C;  4YY3 C;  3LUS A;  1WCJ A;  5LMU C;  1P4E A;  4R1L A;  1XRC A;  1QM4 A;  3PES A;  2QVZ X;  3VNQ A;  4I9G A;  4LF7 C;  4JI7 C;  4JI4 C;  1HNZ C;  4DCS A;  2HHH C;  4BC9 A;  1EGA A;  1P4E C;  4DV3 C;  3UZ0 A;  5KYT A;  2D1S A;  3IML A;  4L7I A;  1XMQ C;  4LFA C;  3IPL A;  4NXM C;  3G7S A;  3TR3 A;  2WD9 A;  1PA4 A;  1AMU A;  5BSR A;  4MH4 A;  5AE1 A;  5IFI A;  4DV5 C;  2P2F A;  4GS5 A;  4JI6 C;  3I07 A;  5BSM A;  5LCI A;  1UKK A;  3A26 A;  4L4Q A;  4DUY C;  4AQY C;  2V7B A;  4DV7 C;  2Y4N A;  2P20 A;  2OBV A;  4DCU A;  1N33 C;  4RVN A;  3J7A D;  2VQF C; 
#chains in the Genus database with same CATH homology
 3EQ6 A;  2CXC A;  1HH2 P;  1QWI A;  4KTV A;  4IZ6 A;  1IBK C;  1ML8 A;  4B3M C;  4BCA A;  2PRO A;  4EAT A;  4X62 C;  2E5L C;  4JV5 C;  3I08 A;  4RM2 A;  4D4G A;  3AF5 A;  1USP A;  2P2Q A;  2UU9 C;  4OXI A;  4JI5 C;  5CZV A;  1MDB A;  4DR3 C;  3LGX A;  5K8F A;  1RY2 A;  4DV2 C;  1T5D X;  2P2M A;  5H9U A;  5IT9 D;  2YWC A;  4JI0 C;  4GKK C;  2BH1 X;  1MD9 A;  2PN2 A;  1HNX C;  5CZX A;  4X64 C;  2E8F A;  5BST A;  5BSU A;  3NPD A;  4D4I A;  1FJG C;  4B3R C;  5K85 A;  2UUB C;  3CW8 X;  4OX9 C;  1FUG A;  4D56 A;  1O92 A;  4DV4 C;  4GKJ C;  4DG9 A;  2E8C A;  3J81 D;  4XX2 A;  1XNR C;  1ZB9 A;  4LF5 C;  1KKG A;  1RG9 A;  5BUS A;  1T5H X;  1PG4 A;  5FLX D;  3CJE A;  2YCB A;  2EGT A;  4WV3 A;  1MXB A;  1BA3 A;  4R0M A;  4MTN A;  3NI2 A;  4B3T C;  3ETC A;  4RVO A;  2YWB A;  3TQI A;  5BSV A;  2XR1 A;  1K0R A;  3DHV A;  5T8T A;  4TPS B;  4LF6 C;  4G1I A;  4RMN A;  2P2J A;  4BC7 A;  1O9T A;  4RLF A;  3FCC A;  3AF6 A;  3R44 A;  4ODJ A;  2WP0 C;  4JYA C;  4JI3 C;  4DG8 A;  3ETO A;  5A2Q D;  4U5Y D;  4OYC A;  3VNR A;  2Y27 A;  1PG3 A;  4LF4 C;  5AE3 A;  2VSQ A;  4HPV A;  1I94 C;  3NYR A;  4NOZ A;  5AE2 A;  5IWA C;  1MDF A;  1V26 A;  4KHP C;  3TUF A;  2UXD C;  4FTF A;  1O90 A;  4NDN A;  4K0K C;  3N2Q A;  2VQE C;  4KTT A;  2UUC C;  1O93 A;  1HR0 C;  3N54 B;  3NYQ A;  1JOS A;  1WF3 A;  3UOW A;  2D28 C;  2E8E A;  3C5E A;  3DAY A;  3RG2 A;  3S82 A;  4ZJZ A;  3H2T A;  2HJG A;  4LF9 C;  4GXR A;  3OTO C;  2AYA A;  2OPL B;  3L8C A;  2UXC C;  3FCE A;  5KEI A;  4D57 A;  5T8S A;  1LQL A;  2QL8 A;  4NXN C;  1N36 C;  3VNS A;  4LFB C;  3R9X A;  1N2F A;  4JM1 A;  4RLQ A;  4PHT A;  3IEV A;  1HNW C;  5BR8 C;  1V25 A;  3LNV A;  2KZF A;  3A9V A;  3R9W A;  4DR4 C;  2D27 A;  1XMO C;  3SO4 A;  2Y4O A;  4DR7 C;  2ATW A;  2D7V A;  1J5E C;  1XRA A;  4PZP A;  3A4I A;  4PRO C;  4DV1 C;  4IR7 A;  2QW0 X;  5LMN C;  1MXC A;  5ADZ A;  2UUA C;  3PBK A;  4LF8 C;  4DR5 C;  3L95 X;  5KYV A;  4DV0 C;  2D1Q A;  1ZB8 A;  1ULT A;  4JI2 C;  4FUQ A;  1MXA A;  3GKU A;  2QVX X;  5BUR A;  1P7L A;  4BSZ A;  4RM3 A;  1GPM A;  2P2B A;  3TDE A;  1IBM C;  4JI1 C;  5A1G A;  4G36 A;  2DPL A;  3GR1 A;  4DV6 C;  4BBY A;  2OO4 A;  2BJO A;  2OPL A;  5BSW A;  5A1I A;  3EER A;  4WS9 A;  1LCI A;  4I9F A;  2DYJ A;  3GPC A;  1L2F A;  3T1Y C;  2ONF A;  2PT7 G;  4R1M A;  5DV9 A;  4LE5 A;  4JI8 C;  4DR2 C;  1WH9 A;  5A19 A;  3IEU A;  3JAM D;  2ZM6 C;  4YHH C;  3DLP X;  4G37 A;  1N32 C;  4DCV A;  4L2Z A;  3E7X A;  3KXW A;  1NYE A;  1YJ7 A;  2JMP A;  3E7W A;  4X65 C;  2QVY X;  4GXQ A;  3LAX A;  3RV2 A;  2D1T A;  2CY1 A;  2UXB C;  4FUT A;  2VZE A;  4ISB A;  5E7Q A;  3B7W A;  4DCT A;  4DR6 C;  4K0B A;  4ZLP A;  3J80 D;  4LFC C;  1XNQ C;  1USP B;  2D1R A;  2ASB A;  2P02 A;  4DUZ C;  1IBL C;  2E0G A;  5GTD A;  1MKY A;  4DR1 C;  3GR0 A;  5BUQ A;  3CW9 A;  4B3S C;  3A9U A;  2F4V C;  1XRB A;  4X66 C;  2E7G A;  1N34 C;  1VLA A;  5JRH A;  3T1H C;  3PRO C;  4YY3 C;  3LUS A;  5LMU C;  4R1L A;  1XRC A;  1QM4 A;  3PES A;  2QVZ X;  3VNQ A;  4I9G A;  4LF7 C;  4JI7 C;  4JI4 C;  1HNZ C;  4DCS A;  2HHH C;  4BC9 A;  1EGA A;  4DV3 C;  3UZ0 A;  5KYT A;  2D1S A;  3IML A;  4L7I A;  1XMQ C;  4LFA C;  3IPL A;  4NXM C;  3G7S A;  2WD9 A;  1PA4 A;  1AMU A;  5BSR A;  4MH4 A;  5AE1 A;  5IFI A;  4DV5 C;  2P2F A;  4GS5 A;  4JI6 C;  3I07 A;  5BSM A;  1UKK A;  4L4Q A;  4DUY C;  4AQY C;  2V7B A;  4DV7 C;  2Y4N A;  2P20 A;  2OBV A;  4DCU A;  1N33 C;  4RVN A;  3J7A D;  2VQF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...