1IBLC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1iblC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1iblC02
4LF8C 4B3MC 4AQYC 1HNXC 3J80D 1VLAA 4DV3C 1IBMC 4JI5C 4LF7C 4JI7C 1LQLA 4DR4C 4X64C 4X62C 3LUSA 2PT7G 4JI0C 1HNZC 3EERA 3T1HC 4DR6C 3AF5A 4LFBC 4JI2C 4JI4C 4X66C 4JI3C 4XX2A 4NXMC 2HHHC 4DV7C 1XMQC 3J7AD 2E7GA 4LF6C 5FLXD 5LMUC 4MTNA 5LMNC 1ML8A 2ASBA 1I94C 1IBKC 2BJOA 2OPLA 5IWAC 2ATWA 2CXCA 2VQFC 3IEVA 3IEUA 4B3RC 2ZM6C 1NYEA 1N2FA 2OPLB 4DV0C 5BR8C 3T1YC 4B3SC 4DV4C 3AF6A 4DR2C 4DV1C 2E5LC 2UXDC 1UKKA 4LF4C 3GKUA 2UU9C 1MKYA 4NXNC 4DR7C 4DV5C 4DV6C 2UUAC 4K0KC 2E8CA 4LFAC 2UXBC 4DUYC 4DR1C 2EGTA 4DCTA 1N32C 4DR3C 1J5EC 4DCVA 1ZB8A 2VQEC 1ZB9A 4NOZA 2YCBA 1XNQC 4DCUA 4OX9C 4LF5C 1FJGC 4DUZC 1KKGA 1JOSA 4LF9C 4GKJC 2F4VC 4YHHC 3R9WA 4JI8C 4DCSA 4DV2C 3CJEA 5IT9D 4MH4A 2E8FA 1QWIA 2UUBC 2JMPA 2CY1A 4JI1C 4LFCC 4X65C 3J81D 4JV5C 1EGAA 2DYJA 1WF3A 1WH9A 4GKKC 2XR1A 1XNRC 1K0RA 4BSZA 3I07A 1N36C 1N34C 4YY3C 2UUCC 4B3TC 2PN2A 4KHPC 1HH2P 1L2FA 2D7VA 2QL8A 1PA4A 2KZFA 2ONFA 2UXCC 3OTOC 3R9XA 1USPA 1N33C 4JYAC 2E8EA 1XMOC 1IBLC 1HR0C 4JI6C 1USPB 1HNWC 2HJGA 3JAMD 4DR5C 5A2QD
chains in the Genus database with same CATH superfamily
4G1IA 4L7IA 3CW9A 3VNQA 4AQYC 3J80D 4DV3C 3TUFA 4L2ZA 1LQLA 1YJ7A 4LE5A 2QVYX 2Z51A 3KXWA 3T1HC 3LGXA 4JI2C 4X66C 4G36A 1V60A 4JI3C 3G7SA 5FLXD 3A25A 1ML8A 1I94C 1IBKC 1FLOA 3ETCA 1AMUA 4FTFA 2OPLA 3IMLA 4RLQA 4IR7A 1UWDA 5BURA 3L95X 3A9UA 1MKYA 4DV6C 4K0KC 4LFAC 2UXBC 4DCTA 2YWCA 2P2JA 4DR3C 1ZB9A 1XHJA 1XRCA 2YWBA 3UZ0A 4LF9C 4GKJC 2F4VC 3R9WA 4JI8C 2ZTBA 4TPSB 3K6RA 4KTVA 2D27A 2Y4OA 3CW8X 4JV5C 1WH9A 4GKKC 1XNRC 1K0RA 5AE1A 4BSZA 5KYTA 4KHPC 3E7XA 4RM3A 1PU1A 4PROC 3AY0A 2KZFA 2UXCC 3O2EA 3TDEA 1RG9A 5AE2A 3ETOA 1MDFA 4G37A 3RG2A 3VNRA 2D1SA 3PESA 1IBLC 4JI6C 1USPB 1HNWC 4DR5C 4D56A 4LF8C 3A9VA 5GTDA 2E0GA 1VLAA 5BSRA 2ZZNA 4DR4C 3TR3A 1PG4A 4XX2A 1XMQC 2P2FA 3FCEA 5LMUC 4MTNA 2ATWA 1P4EC 4JM1A 2VQFC 4ZLPA 4B3RC 2ZM6C 4DV0C 2M5HA 5BR8C 3B7WA 4DV4C 4DV1C 5IFIA 3DLPX 3IPLA 4DR7C 4I9FA 1O90A 1VEHA 4DR1C 1J5EC 2VQEC 2D28C 1XNQC 4HPVA 2Y27A 4KTTA 1KKGA 5T8TA 1MXAA 4DV2C 3GR1A 1MXCA 3UX2A 5A1GA 2PROA 3J81D 2D1RA 5ADZA 4BCAA 4ISBA 3CQ1A 1O92A 4RMNA 2QVXX 1L2FA 2D1TA 1PA4A 2ONFA 3NPDA 4BC9A 2Y4NA 4JYAC 3PBKA 4RM2A 4IZ6A 2HJGA 4I9GA 4PUIA 3JAMD 5A2QD 2D1QA 2KZ0A 3A4IA 4B3MC 2V7BA 4RLFA 1HNXC 3UOWA 4RVNA 3L8CA 4JI5C 4LF7C 3CQ2A 4U5YD 2QW0X 5KYVA 2PT7G 3A26A 1O9TA 1XS3A 3EERA 3RV2A 4DR6C 4LFBC 4EATA 3R44A 4NXMC 4DV7C 5CZXA 2E7GA 1M6XA 1T5DX 4GXQA 1T5HX 5BSVA 4BBYA 1BA3A 2CXCA 2MM9A 3PROC 3IEVA 3C5EA 1NYEA 1LCIA 2OPLB 3S82A 2P20A 4DR2C 2AYAA 1M6XC 2UXDC 1UKKA 4LF4C 2MMAB 4NXNC 4DG8A 5JRHA 2KDNA 2UUAC 2EGTA 4R1MA 1N32C 2M5OA 3TQIA 3SO4A 5H9UA 4D4IA 4ZJZA 1ZB8A 2JNVA 1YGTA 3DHVA 1QM4A 2P2BA 4DCUA 4LF5C 1JOSA 1WCJA 4FUQA 4YHHC 3UEBA 4K0BA 4DCSA 4GXRA 3CJEA 5A19A 5IT9D 4MH4A 4DG9A 2E8FA 1QWIA 2JMPA 3FM7A 4LFCC 3GPCA 1EGAA 1IB8A 2XR1A 2DPLA 1NY8A 2YX1A 3I07A 1N36C 4YY3C 4B3TC 2PN2A 3I08A 4WS9A 3DAYA 1ULTA 2D7VA 3R9XA 1USPA 1XRBA 2MCQA 4PUHA 1XMOC 5BSTA 4FUTA 1XDXA 3E7WA 1HR0C 5K8FA 2OBVA 1P7LA 5T8SA 1FUGA 5BSMA 3H2TA 3NI2A 1IBMC 4JI7C 5K85A 3EQ6A 4OXIA 4X64C 4X62C 3LUSA 1PG3A 4JI0C 1HNZC 2DHMA 3AF5A 5CZVA 4JI4C 2OO4A 2HHHC 3LNVA 3FCCA 3J7AD 4PUGA 5BUSA 4LF6C 5AE3A 5LMNC 2ASBA 4RVOA 2BJOA 5IWAC 1GPMA 2VSQA 4R0MA 3IEUA 2QVZX 5A1IA 1N2FA 4D4GA 2P2MA 3T1YC 4B3SC 3AF6A 2E5LC 2BH1X 3CQ3A 3GKUA 2UU9C 1MDBA 4DV5C 2E8CA 4ODJA 5LCIA 4DUYC 4PZPA 1V26A 2P2QA 5BSWA 4DCVA 4GS5A 1V25A 1MD9A 4NOZA 2YCBA 5BUQA 2PG1E 4OX9C 2WP0C 1FJGC 4DUZC 5E7QA 3LNOA 5DV9A 3LAXA 3NYRA 4PHTA 2UUBC 4D57A 1RY2A 1XRAA 2CY1A 4JI1C 2ZZMA 2CU6A 4X65C 2DYJA 3UX3A 1WF3A 4L4QA 5BSUA 1MXBA 1O93A 4NDNA 1N34C 3VNSA 2UUCC 1TH5A 2VZEA 4WV3A 3GR0A 1P4EA 1HH2P 2QL8A 4OYCA 2WD9A 5KEIA 3OTOC 1N33C 3N54B 2E8EA 4R1LA 2P02A 2NCLA 3N2QA 4BC7A 3NYQA
chains in the Genus database with same CATH topology
4G1IA 4L7IA 3CW9A 3VNQA 4AQYC 3J80D 4DV3C 3TUFA 4L2ZA 1LQLA 1YJ7A 4LE5A 2QVYX 3KXWA 3T1HC 3LGXA 4JI2C 4X66C 4G36A 4JI3C 3G7SA 5FLXD 1ML8A 1I94C 1IBKC 3ETCA 1AMUA 4FTFA 2OPLA 3IMLA 4RLQA 4IR7A 5BURA 3L95X 3A9UA 1MKYA 4DV6C 4K0KC 4LFAC 2UXBC 4DCTA 2YWCA 2P2JA 4DR3C 1ZB9A 1XRCA 2YWBA 3UZ0A 4LF9C 4GKJC 2F4VC 3R9WA 4JI8C 4TPSB 4KTVA 2D27A 2Y4OA 3CW8X 4JV5C 1WH9A 4GKKC 1XNRC 1K0RA 5AE1A 4BSZA 5KYTA 4KHPC 3E7XA 4RM3A 4PROC 2KZFA 2UXCC 3TDEA 1RG9A 5AE2A 3ETOA 1MDFA 4G37A 3RG2A 3VNRA 2D1SA 3PESA 1IBLC 4JI6C 1USPB 1HNWC 4DR5C 4D56A 4LF8C 3A9VA 5GTDA 2E0GA 1VLAA 5BSRA 4DR4C 1PG4A 4XX2A 1XMQC 2P2FA 3FCEA 5LMUC 4MTNA 2ATWA 4JM1A 2VQFC 4ZLPA 4B3RC 2ZM6C 4DV0C 5BR8C 3B7WA 4DV4C 4DV1C 5IFIA 3DLPX 3IPLA 4DR7C 4I9FA 1O90A 4DR1C 1J5EC 2VQEC 2D28C 1XNQC 4HPVA 2Y27A 4KTTA 1KKGA 5T8TA 1MXAA 4DV2C 3GR1A 1MXCA 5A1GA 2PROA 3J81D 2D1RA 5ADZA 4BCAA 4ISBA 1O92A 4RMNA 2QVXX 1L2FA 2D1TA 1PA4A 2ONFA 3NPDA 4BC9A 2Y4NA 4JYAC 3PBKA 4RM2A 4IZ6A 2HJGA 4I9GA 3JAMD 5A2QD 2D1QA 3A4IA 4B3MC 2V7BA 4RLFA 1HNXC 3UOWA 4RVNA 3L8CA 4JI5C 4LF7C 4U5YD 2QW0X 5KYVA 2PT7G 1O9TA 3EERA 3RV2A 4DR6C 4LFBC 4EATA 3R44A 4NXMC 4DV7C 5CZXA 2E7GA 1T5DX 4GXQA 1T5HX 5BSVA 4BBYA 1BA3A 2CXCA 3PROC 3IEVA 3C5EA 1NYEA 1LCIA 2OPLB 3S82A 2P20A 4DR2C 2AYAA 2UXDC 1UKKA 4LF4C 4NXNC 4DG8A 5JRHA 2UUAC 2EGTA 4R1MA 1N32C 3TQIA 3SO4A 5H9UA 4D4IA 4ZJZA 1ZB8A 3DHVA 1QM4A 2P2BA 4DCUA 4LF5C 1JOSA 4FUQA 4YHHC 4K0BA 4DCSA 4GXRA 3CJEA 5A19A 5IT9D 4MH4A 4DG9A 2E8FA 1QWIA 2JMPA 4LFCC 3GPCA 1EGAA 2XR1A 2DPLA 3I07A 1N36C 4YY3C 4B3TC 2PN2A 3I08A 4WS9A 3DAYA 1ULTA 2D7VA 3R9XA 1USPA 1XRBA 1XMOC 5BSTA 4FUTA 3E7WA 1HR0C 5K8FA 2OBVA 1P7LA 5T8SA 1FUGA 5BSMA 3H2TA 3NI2A 1IBMC 4JI7C 5K85A 3EQ6A 4OXIA 4X64C 4X62C 3LUSA 1PG3A 4JI0C 1HNZC 3AF5A 5CZVA 4JI4C 2OO4A 2HHHC 3LNVA 3FCCA 3J7AD 5BUSA 4LF6C 5AE3A 5LMNC 2ASBA 4RVOA 2BJOA 5IWAC 1GPMA 2VSQA 4R0MA 3IEUA 2QVZX 5A1IA 1N2FA 4D4GA 2P2MA 3T1YC 4B3SC 3AF6A 2E5LC 2BH1X 3GKUA 2UU9C 1MDBA 4DV5C 2E8CA 4ODJA 4DUYC 4PZPA 1V26A 2P2QA 5BSWA 4DCVA 4GS5A 1V25A 1MD9A 4NOZA 2YCBA 5BUQA 4OX9C 2WP0C 1FJGC 4DUZC 5E7QA 5DV9A 3LAXA 3NYRA 4PHTA 2UUBC 4D57A 1RY2A 1XRAA 2CY1A 4JI1C 4X65C 2DYJA 1WF3A 4L4QA 5BSUA 1MXBA 1O93A 4NDNA 1N34C 3VNSA 2UUCC 2VZEA 4WV3A 3GR0A 1HH2P 2QL8A 4OYCA 2WD9A 5KEIA 3OTOC 1N33C 3N54B 2E8EA 4R1LA 2P02A 3N2QA 4BC7A 3NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 C;  4B3M C;  4AQY C;  1HNX C;  3J80 D;  1VLA A;  4DV3 C;  1IBM C;  4JI5 C;  4LF7 C;  4JI7 C;  1LQL A;  4DR4 C;  4X64 C;  4X62 C;  3LUS A;  2PT7 G;  4JI0 C;  1HNZ C;  3EER A;  3T1H C;  4DR6 C;  3AF5 A;  4LFB C;  4JI2 C;  4JI4 C;  4X66 C;  4JI3 C;  4XX2 A;  4NXM C;  2HHH C;  4DV7 C;  1XMQ C;  3J7A D;  2E7G A;  4LF6 C;  5FLX D;  5LMU C;  4MTN A;  5LMN C;  1ML8 A;  2ASB A;  1I94 C;  1IBK C;  2BJO A;  2OPL A;  5IWA C;  2ATW A;  2CXC A;  2VQF C;  3IEV A;  3IEU A;  4B3R C;  2ZM6 C;  1NYE A;  1N2F A;  2OPL B;  4DV0 C;  5BR8 C;  3T1Y C;  4B3S C;  4DV4 C;  3AF6 A;  4DR2 C;  4DV1 C;  2E5L C;  2UXD C;  1UKK A;  4LF4 C;  3GKU A;  2UU9 C;  1MKY A;  4NXN C;  4DR7 C;  4DV5 C;  4DV6 C;  2UUA C;  4K0K C;  2E8C A;  4LFA C;  2UXB C;  4DUY C;  4DR1 C;  2EGT A;  4DCT A;  1N32 C;  4DR3 C;  1J5E C;  4DCV A;  1ZB8 A;  2VQE C;  1ZB9 A;  4NOZ A;  2YCB A;  1XNQ C;  4DCU A;  4OX9 C;  4LF5 C;  1FJG C;  4DUZ C;  1KKG A;  1JOS A;  4LF9 C;  4GKJ C;  2F4V C;  4YHH C;  3R9W A;  4JI8 C;  4DCS A;  4DV2 C;  3CJE A;  5IT9 D;  4MH4 A;  2E8F A;  1QWI A;  2UUB C;  2JMP A;  2CY1 A;  4JI1 C;  4LFC C;  4X65 C;  3J81 D;  4JV5 C;  1EGA A;  2DYJ A;  1WF3 A;  1WH9 A;  4GKK C;  2XR1 A;  1XNR C;  1K0R A;  4BSZ A;  3I07 A;  1N36 C;  1N34 C;  4YY3 C;  2UUC C;  4B3T C;  2PN2 A;  4KHP C;  1HH2 P;  1L2F A;  2D7V A;  2QL8 A;  1PA4 A;  2KZF A;  2ONF A;  2UXC C;  3OTO C;  3R9X A;  1USP A;  1N33 C;  4JYA C;  2E8E A;  1XMO C;  1IBL C;  1HR0 C;  4JI6 C;  1USP B;  1HNW C;  2HJG A;  3JAM D;  4DR5 C;  5A2Q D; 
#chains in the Genus database with same CATH topology
 4G1I A;  4L7I A;  3CW9 A;  3VNQ A;  4AQY C;  3J80 D;  4DV3 C;  3TUF A;  4L2Z A;  1LQL A;  1YJ7 A;  4LE5 A;  2QVY X;  2Z51 A;  3KXW A;  3T1H C;  3LGX A;  4JI2 C;  4X66 C;  4G36 A;  1V60 A;  4JI3 C;  3G7S A;  5FLX D;  3A25 A;  1ML8 A;  1I94 C;  1IBK C;  1FLO A;  3ETC A;  1AMU A;  4FTF A;  2OPL A;  3IML A;  4RLQ A;  4IR7 A;  1UWD A;  5BUR A;  3L95 X;  3A9U A;  1MKY A;  4DV6 C;  4K0K C;  4LFA C;  2UXB C;  4DCT A;  2YWC A;  2P2J A;  4DR3 C;  1ZB9 A;  1XHJ A;  1XRC A;  2YWB A;  3UZ0 A;  4LF9 C;  4GKJ C;  2F4V C;  3R9W A;  4JI8 C;  2ZTB A;  4TPS B;  3K6R A;  4KTV A;  2D27 A;  2Y4O A;  3CW8 X;  4JV5 C;  1WH9 A;  4GKK C;  1XNR C;  1K0R A;  5AE1 A;  4BSZ A;  5KYT A;  4KHP C;  3E7X A;  4RM3 A;  1PU1 A;  4PRO C;  3AY0 A;  2KZF A;  2UXC C;  3O2E A;  3TDE A;  1RG9 A;  5AE2 A;  3ETO A;  1MDF A;  4G37 A;  3RG2 A;  3VNR A;  2D1S A;  3PES A;  1IBL C;  4JI6 C;  1USP B;  1HNW C;  4DR5 C;  4D56 A;  4LF8 C;  3A9V A;  5GTD A;  2E0G A;  1VLA A;  5BSR A;  2ZZN A;  4DR4 C;  3TR3 A;  1PG4 A;  4XX2 A;  1XMQ C;  2P2F A;  3FCE A;  5LMU C;  4MTN A;  2ATW A;  1P4E C;  4JM1 A;  2VQF C;  4ZLP A;  4B3R C;  2ZM6 C;  4DV0 C;  2M5H A;  5BR8 C;  3B7W A;  4DV4 C;  4DV1 C;  5IFI A;  3DLP X;  3IPL A;  4DR7 C;  4I9F A;  1O90 A;  1VEH A;  4DR1 C;  1J5E C;  2VQE C;  2D28 C;  1XNQ C;  4HPV A;  2Y27 A;  4KTT A;  1KKG A;  5T8T A;  1MXA A;  4DV2 C;  3GR1 A;  1MXC A;  3UX2 A;  5A1G A;  2PRO A;  3J81 D;  2D1R A;  5ADZ A;  4BCA A;  4ISB A;  3CQ1 A;  1O92 A;  4RMN A;  2QVX X;  1L2F A;  2D1T A;  1PA4 A;  2ONF A;  3NPD A;  4BC9 A;  2Y4N A;  4JYA C;  3PBK A;  4RM2 A;  4IZ6 A;  2HJG A;  4I9G A;  4PUI A;  3JAM D;  5A2Q D;  2D1Q A;  2KZ0 A;  3A4I A;  4B3M C;  2V7B A;  4RLF A;  1HNX C;  3UOW A;  4RVN A;  3L8C A;  4JI5 C;  4LF7 C;  3CQ2 A;  4U5Y D;  2QW0 X;  5KYV A;  2PT7 G;  3A26 A;  1O9T A;  1XS3 A;  3EER A;  3RV2 A;  4DR6 C;  4LFB C;  4EAT A;  3R44 A;  4NXM C;  4DV7 C;  5CZX A;  2E7G A;  1M6X A;  1T5D X;  4GXQ A;  1T5H X;  5BSV A;  4BBY A;  1BA3 A;  2CXC A;  2MM9 A;  3PRO C;  3IEV A;  3C5E A;  1NYE A;  1LCI A;  2OPL B;  3S82 A;  2P20 A;  4DR2 C;  2AYA A;  1M6X C;  2UXD C;  1UKK A;  4LF4 C;  2MMA B;  4NXN C;  4DG8 A;  5JRH A;  2KDN A;  2UUA C;  2EGT A;  4R1M A;  1N32 C;  2M5O A;  3TQI A;  3SO4 A;  5H9U A;  4D4I A;  4ZJZ A;  1ZB8 A;  2JNV A;  1YGT A;  3DHV A;  1QM4 A;  2P2B A;  4DCU A;  4LF5 C;  1JOS A;  1WCJ A;  4FUQ A;  4YHH C;  3UEB A;  4K0B A;  4DCS A;  4GXR A;  3CJE A;  5A19 A;  5IT9 D;  4MH4 A;  4DG9 A;  2E8F A;  1QWI A;  2JMP A;  3FM7 A;  4LFC C;  3GPC A;  1EGA A;  1IB8 A;  2XR1 A;  2DPL A;  1NY8 A;  2YX1 A;  3I07 A;  1N36 C;  4YY3 C;  4B3T C;  2PN2 A;  3I08 A;  4WS9 A;  3DAY A;  1ULT A;  2D7V A;  3R9X A;  1USP A;  1XRB A;  2MCQ A;  4PUH A;  1XMO C;  5BST A;  4FUT A;  1XDX A;  3E7W A;  1HR0 C;  5K8F A;  2OBV A;  1P7L A;  5T8S A;  1FUG A;  5BSM A;  3H2T A;  3NI2 A;  1IBM C;  4JI7 C;  5K85 A;  3EQ6 A;  4OXI A;  4X64 C;  4X62 C;  3LUS A;  1PG3 A;  4JI0 C;  1HNZ C;  2DHM A;  3AF5 A;  5CZV A;  4JI4 C;  2OO4 A;  2HHH C;  3LNV A;  3FCC A;  3J7A D;  4PUG A;  5BUS A;  4LF6 C;  5AE3 A;  5LMN C;  2ASB A;  4RVO A;  2BJO A;  5IWA C;  1GPM A;  2VSQ A;  4R0M A;  3IEU A;  2QVZ X;  5A1I A;  1N2F A;  4D4G A;  2P2M A;  3T1Y C;  4B3S C;  3AF6 A;  2E5L C;  2BH1 X;  3CQ3 A;  3GKU A;  2UU9 C;  1MDB A;  4DV5 C;  2E8C A;  4ODJ A;  5LCI A;  4DUY C;  4PZP A;  1V26 A;  2P2Q A;  5BSW A;  4DCV A;  4GS5 A;  1V25 A;  1MD9 A;  4NOZ A;  2YCB A;  5BUQ A;  2PG1 E;  4OX9 C;  2WP0 C;  1FJG C;  4DUZ C;  5E7Q A;  3LNO A;  5DV9 A;  3LAX A;  3NYR A;  4PHT A;  2UUB C;  4D57 A;  1RY2 A;  1XRA A;  2CY1 A;  4JI1 C;  2ZZM A;  2CU6 A;  4X65 C;  2DYJ A;  3UX3 A;  1WF3 A;  4L4Q A;  5BSU A;  1MXB A;  1O93 A;  4NDN A;  1N34 C;  3VNS A;  2UUC C;  1TH5 A;  2VZE A;  4WV3 A;  3GR0 A;  1P4E A;  1HH2 P;  2QL8 A;  4OYC A;  2WD9 A;  5KEI A;  3OTO C;  1N33 C;  3N54 B;  2E8E A;  4R1L A;  2P02 A;  2NCL A;  3N2Q A;  4BC7 A;  3NYQ A; 
#chains in the Genus database with same CATH homology
 4G1I A;  4L7I A;  3CW9 A;  3VNQ A;  4AQY C;  3J80 D;  4DV3 C;  3TUF A;  4L2Z A;  1LQL A;  1YJ7 A;  4LE5 A;  2QVY X;  3KXW A;  3T1H C;  3LGX A;  4JI2 C;  4X66 C;  4G36 A;  4JI3 C;  3G7S A;  5FLX D;  1ML8 A;  1I94 C;  1IBK C;  3ETC A;  1AMU A;  4FTF A;  2OPL A;  3IML A;  4RLQ A;  4IR7 A;  5BUR A;  3L95 X;  3A9U A;  1MKY A;  4DV6 C;  4K0K C;  4LFA C;  2UXB C;  4DCT A;  2YWC A;  2P2J A;  4DR3 C;  1ZB9 A;  1XRC A;  2YWB A;  3UZ0 A;  4LF9 C;  4GKJ C;  2F4V C;  3R9W A;  4JI8 C;  4TPS B;  4KTV A;  2D27 A;  2Y4O A;  3CW8 X;  4JV5 C;  1WH9 A;  4GKK C;  1XNR C;  1K0R A;  5AE1 A;  4BSZ A;  5KYT A;  4KHP C;  3E7X A;  4RM3 A;  4PRO C;  2KZF A;  2UXC C;  3TDE A;  1RG9 A;  5AE2 A;  3ETO A;  1MDF A;  4G37 A;  3RG2 A;  3VNR A;  2D1S A;  3PES A;  1IBL C;  4JI6 C;  1USP B;  1HNW C;  4DR5 C;  4D56 A;  4LF8 C;  3A9V A;  5GTD A;  2E0G A;  1VLA A;  5BSR A;  4DR4 C;  1PG4 A;  4XX2 A;  1XMQ C;  2P2F A;  3FCE A;  5LMU C;  4MTN A;  2ATW A;  4JM1 A;  2VQF C;  4ZLP A;  4B3R C;  2ZM6 C;  4DV0 C;  5BR8 C;  3B7W A;  4DV4 C;  4DV1 C;  5IFI A;  3DLP X;  3IPL A;  4DR7 C;  4I9F A;  1O90 A;  4DR1 C;  1J5E C;  2VQE C;  2D28 C;  1XNQ C;  4HPV A;  2Y27 A;  4KTT A;  1KKG A;  5T8T A;  1MXA A;  4DV2 C;  3GR1 A;  1MXC A;  5A1G A;  2PRO A;  3J81 D;  2D1R A;  5ADZ A;  4BCA A;  4ISB A;  1O92 A;  4RMN A;  2QVX X;  1L2F A;  2D1T A;  1PA4 A;  2ONF A;  3NPD A;  4BC9 A;  2Y4N A;  4JYA C;  3PBK A;  4RM2 A;  4IZ6 A;  2HJG A;  4I9G A;  3JAM D;  5A2Q D;  2D1Q A;  3A4I A;  4B3M C;  2V7B A;  4RLF A;  1HNX C;  3UOW A;  4RVN A;  3L8C A;  4JI5 C;  4LF7 C;  4U5Y D;  2QW0 X;  5KYV A;  2PT7 G;  1O9T A;  3EER A;  3RV2 A;  4DR6 C;  4LFB C;  4EAT A;  3R44 A;  4NXM C;  4DV7 C;  5CZX A;  2E7G A;  1T5D X;  4GXQ A;  1T5H X;  5BSV A;  4BBY A;  1BA3 A;  2CXC A;  3PRO C;  3IEV A;  3C5E A;  1NYE A;  1LCI A;  2OPL B;  3S82 A;  2P20 A;  4DR2 C;  2AYA A;  2UXD C;  1UKK A;  4LF4 C;  4NXN C;  4DG8 A;  5JRH A;  2UUA C;  2EGT A;  4R1M A;  1N32 C;  3TQI A;  3SO4 A;  5H9U A;  4D4I A;  4ZJZ A;  1ZB8 A;  3DHV A;  1QM4 A;  2P2B A;  4DCU A;  4LF5 C;  1JOS A;  4FUQ A;  4YHH C;  4K0B A;  4DCS A;  4GXR A;  3CJE A;  5A19 A;  5IT9 D;  4MH4 A;  4DG9 A;  2E8F A;  1QWI A;  2JMP A;  4LFC C;  3GPC A;  1EGA A;  2XR1 A;  2DPL A;  3I07 A;  1N36 C;  4YY3 C;  4B3T C;  2PN2 A;  3I08 A;  4WS9 A;  3DAY A;  1ULT A;  2D7V A;  3R9X A;  1USP A;  1XRB A;  1XMO C;  5BST A;  4FUT A;  3E7W A;  1HR0 C;  5K8F A;  2OBV A;  1P7L A;  5T8S A;  1FUG A;  5BSM A;  3H2T A;  3NI2 A;  1IBM C;  4JI7 C;  5K85 A;  3EQ6 A;  4OXI A;  4X64 C;  4X62 C;  3LUS A;  1PG3 A;  4JI0 C;  1HNZ C;  3AF5 A;  5CZV A;  4JI4 C;  2OO4 A;  2HHH C;  3LNV A;  3FCC A;  3J7A D;  5BUS A;  4LF6 C;  5AE3 A;  5LMN C;  2ASB A;  4RVO A;  2BJO A;  5IWA C;  1GPM A;  2VSQ A;  4R0M A;  3IEU A;  2QVZ X;  5A1I A;  1N2F A;  4D4G A;  2P2M A;  3T1Y C;  4B3S C;  3AF6 A;  2E5L C;  2BH1 X;  3GKU A;  2UU9 C;  1MDB A;  4DV5 C;  2E8C A;  4ODJ A;  4DUY C;  4PZP A;  1V26 A;  2P2Q A;  5BSW A;  4DCV A;  4GS5 A;  1V25 A;  1MD9 A;  4NOZ A;  2YCB A;  5BUQ A;  4OX9 C;  2WP0 C;  1FJG C;  4DUZ C;  5E7Q A;  5DV9 A;  3LAX A;  3NYR A;  4PHT A;  2UUB C;  4D57 A;  1RY2 A;  1XRA A;  2CY1 A;  4JI1 C;  4X65 C;  2DYJ A;  1WF3 A;  4L4Q A;  5BSU A;  1MXB A;  1O93 A;  4NDN A;  1N34 C;  3VNS A;  2UUC C;  2VZE A;  4WV3 A;  3GR0 A;  1HH2 P;  2QL8 A;  4OYC A;  2WD9 A;  5KEI A;  3OTO C;  1N33 C;  3N54 B;  2E8E A;  4R1L A;  2P02 A;  3N2Q A;  4BC7 A;  3NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...