4JI7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji7C02
1N2FA 1HNZC 2VQFC 4X65C 1QWIA 4DV4C 4DV2C 2UXDC 3J7AD 4JI6C 1XMOC 3OTOC 4DV0C 2HHHC 1WF3A 3R9XA 4LF9C 2E7GA 4DR7C 4JI1C 4NXMC 3AF6A 2PN2A 4DCTA 2D7VA 2KZFA 1USPA 2YCBA 1IBKC 4B3TC 3T1HC 2ASBA 3IEVA 4JI3C 2UU9C 4DCUA 3LUSA 4DR6C 4JYAC 4DV6C 4YY3C 4DUYC 4OX9C 2ONFA 2EGTA 5BR8C 1IBMC 5LMUC 1XMQC 1VLAA 5FLXD 2BJOA 1L2FA 1JOSA 1HNXC 4B3SC 4YHHC 2E5LC 1FJGC 2VQEC 4GKKC 5LMNC 2UXCC 1XNRC 1K0RA 4DV1C 3GKUA 4JI7C 4LF7C 2OPLA 2HJGA 1XNQC 4NOZA 4X66C 2CXCA 4DCVA 4DR4C 2UUAC 4DV5C 3CJEA 1HNWC 4DV7C 1ML8A 4JI2C 2DYJA 4NXNC 1LQLA 4DR5C 4DR1C 4BSZA 4B3MC 1N33C 2ZM6C 1MKYA 2F4VC 1HH2P 1ZB9A 4DUZC 3AF5A 4LFBC 2JMPA 1WH9A 4DR3C 1NYEA 4LFAC 4LF4C 3T1YC 1IBLC 1UKKA 4LF5C 4LF6C 4X64C 4JI8C 3J81D 3EERA 2E8FA 1J5EC 1PA4A 4DV3C 1USPB 3J80D 4KHPC 2UUBC 1EGAA 4DR2C 3JAMD 3I07A 2ATWA 5A2QD 2UXBC 3IEUA 5IT9D 2E8EA 1N32C 4LFCC 2CY1A 4GKJC 4JV5C 2QL8A 4XX2A 4JI4C 4MH4A 2UUCC 1N36C 4X62C 3R9WA 1HR0C 2E8CA 2PT7G 4DCSA 1I94C 5IWAC 1ZB8A 4JI5C 2OPLB 4B3RC 4AQYC 4LF8C 4K0KC 1KKGA 4MTNA 1N34C 2XR1A 4JI0C
chains in the Genus database with same CATH superfamily
4L2ZA 4X65C 1QWIA 2ZZNA 4DV2C 3UZ0A 2MMAB 2UXDC 1M6XA 3KXWA 5BSTA 4NXMC 2PN2A 2D7VA 5BUQA 1IBKC 4B3TC 3GR0A 3LUSA 4DV6C 3K6RA 5BR8C 1RG9A 3AY0A 1IBMC 1TH5A 1XMQC 1YGTA 2YX1A 4RM3A 4ZLPA 4KTTA 2QW0X 1MD9A 4R1LA 3FCEA 1HNXC 2YWBA 3H2TA 5KEIA 1BA3A 2VQEC 2Z51A 2DPLA 4FUTA 4LE5A 5LMNC 3ETCA 3L95X 1XNRC 3PESA 4LF7C 4DR4C 2UUAC 1LCIA 1HNWC 1ML8A 4JI2C 4PHTA 1MDFA 4BSZA 4DUZC 2JMPA 1ULTA 4DR3C 3NYQA 3T1YC 3A25A 4LF6C 5AE2A 4U5YD 1MDBA 1EGAA 5BSVA 1XRBA 5GTDA 2ATWA 1IB8A 5A2QD 5DV9A 2M5OA 3EQ6A 5IT9D 4FUQA 3E7WA 4DG9A 2OBVA 4GXQA 4XX2A 2UUCC 3R9WA 1HR0C 5BUSA 4G1IA 1I94C 4D56A 2P2JA 2PG1E 3B7WA 5CZVA 3TDEA 4K0KC 3PROC 2D1QA 1V25A 2P20A 2BH1X 1QM4A 1AMUA 1HNZC 3UOWA 2Y27A 3CW9A 4L7IA 5ADZA 2HHHC 1WF3A 4LF9C 4BBYA 2KDNA 4JI1C 5K85A 3LGXA 4DCTA 1NY8A 2KZFA 1USPA 2P2FA 3L8CA 3NI2A 4JI3C 4YY3C 3LNOA 4R0MA 4NDNA 1XS3A 4L4QA 4G37A 3SO4A 1PG4A 4KTVA 4G36A 3TQIA 1XRCA 2E5LC 1FJGC 4GKKC 4RVNA 5AE1A 3GKUA 1XNQC 4NOZA 1FLOA 1GPMA 4DV7C 2CU6A 3FCCA 4NXNC 1LQLA 4DR5C 4DR1C 3GPCA 4B3MC 1N33C 2ZM6C 2F4VC 1HH2P 3AF5A 1VEHA 2PROA 4WV3A 3S82A 2P2QA 4GXRA 4LFAC 2VSQA 1IBLC 1UKKA 3VNSA 4LF5C 4JI8C 2QVXX 2E8FA 4DV3C 1USPB 1MXCA 4KHPC 3LAXA 3N54B 3I07A 2D1TA 2D28C 2YWCA 3NPDA 2UXBC 4FTFA 3CQ3A 2NCLA 4D4GA 4WS9A 5A19A 2QL8A 4MH4A 1V26A 2AYAA 2D1RA 4PROC 4DG8A 1O93A 3C5EA 4I9FA 5IWAC 1ZB8A 4AQYC 3RG2A 2QVZX 2XR1A 2VZEA 1WCJA 2WD9A 1UWDA 2VQFC 3ETOA 2E0GA 5CZXA 3DHVA 4DV0C 1O9TA 2E7GA 4PUIA 3A26A 4PUHA 3AF6A 5IFIA 4EATA 3DAYA 4ISBA 3T1HC 1MXBA 3UX2A 3UX3A 3IEVA 2UU9C 4DCUA 4DR6C 4RVOA 4PUGA 4OXIA 5LMUC 4OYCA 3O2EA 1VLAA 2BJOA 2M5HA 1JOSA 5KYVA 4RLQA 4YHHC 1FUGA 4BC9A 5BSUA 2UXCC 1P4EC 3A9VA 3CQ2A 4BCAA 4JI7C 4X66C 4RM2A 2Y4OA 3VNQA 2DYJA 3LNVA 1MKYA 5LCIA 4LFBC 3RV2A 1WH9A 1T5DX 5T8TA 4D4IA 4D57A 2MM9A 3I08A 4HPVA 3J81D 1J5EC 1PA4A 5BSMA 3A9UA 2UUBC 3JAMD 5H9UA 1XDXA 2ZTBA 3TUFA 5BSRA 2E8EA 2CY1A 4PZPA 4GKJC 2OO4A 4JV5C 2QVYX 4JI4C 4BC7A 1N36C 5E7QA 4RLFA 3E7XA 4GS5A 2E8CA 2P2BA 1V60A 3N2QA 4B3RC 1XHJA 1KKGA 1N34C 3IMLA 2JNVA 4RMNA 5JRHA 1N2FA 1YJ7A 4TPSB 4I9GA 4DV4C 2P02A 3NYRA 3GR1A 3J7AD 3PBKA 2Y4NA 4ZJZA 4K0BA 3FM7A 4JI6C 1XMOC 1MXAA 3OTOC 3R9XA 3R44A 4DR7C 5BSWA 2YCBA 1T5HX 1XRAA 2ASBA 2D27A 4IZ6A 4JYAC 4DUYC 4OX9C 2EGTA 2ONFA 5FLXD 1L2FA 2D1SA 2WP0C 4B3SC 3CQ1A 4JM1A 3G7SA 1K0RA 4DV1C 3TR3A 1O92A 1O90A 2HJGA 2OPLA 2CXCA 3CW8X 4DCVA 4DV5C 3CJEA 3VNRA 4R1MA 2ZZMA 3IPLA 5BURA 1ZB9A 1NYEA 4LF4C 2V7BA 4ODJA 4X64C 3EERA 1P7LA 2P2MA 5A1GA 3J80D 3A4IA 4DR2C 1PG3A 2KZ0A 1P4EA 3IEUA 5AE3A 5K8FA 1N32C 4LFCC 2DHMA 1RY2A 4X62C 2MCQA 2PT7G 4DCSA 1M6XC 4JI5C 2OPLB 1PU1A 3UEBA 5KYTA 4LF8C 5A1IA 4IR7A 3DLPX 4MTNA 5T8SA 4JI0C
chains in the Genus database with same CATH topology
4L2ZA 4X65C 1QWIA 4DV2C 3UZ0A 2UXDC 3KXWA 5BSTA 4NXMC 2PN2A 2D7VA 5BUQA 1IBKC 4B3TC 3GR0A 3LUSA 4DV6C 5BR8C 1RG9A 1IBMC 1XMQC 4ZLPA 4RM3A 4KTTA 2QW0X 1MD9A 4R1LA 3FCEA 1HNXC 2YWBA 3H2TA 5KEIA 1BA3A 2VQEC 2DPLA 4FUTA 4LE5A 5LMNC 3ETCA 3L95X 1XNRC 3PESA 4LF7C 4DR4C 2UUAC 1LCIA 1HNWC 1ML8A 4JI2C 4PHTA 1MDFA 4BSZA 4DUZC 2JMPA 1ULTA 4DR3C 3NYQA 3T1YC 4LF6C 5AE2A 4U5YD 1MDBA 1EGAA 5BSVA 1XRBA 5GTDA 2ATWA 5A2QD 5DV9A 3EQ6A 5IT9D 4FUQA 3E7WA 4DG9A 2OBVA 4GXQA 4XX2A 2UUCC 3R9WA 1HR0C 5BUSA 4G1IA 1I94C 4D56A 2P2JA 3B7WA 5CZVA 3TDEA 4K0KC 3PROC 2D1QA 1V25A 2P20A 2BH1X 1QM4A 1AMUA 1HNZC 3UOWA 2Y27A 3CW9A 4L7IA 5ADZA 2HHHC 1WF3A 4LF9C 4BBYA 4JI1C 5K85A 3LGXA 4DCTA 2KZFA 1USPA 2P2FA 3L8CA 3NI2A 4JI3C 4YY3C 4R0MA 4NDNA 4L4QA 4G37A 3SO4A 1PG4A 4KTVA 4G36A 3TQIA 1XRCA 2E5LC 1FJGC 4GKKC 4RVNA 5AE1A 3GKUA 1XNQC 4NOZA 1GPMA 4DV7C 3FCCA 4NXNC 1LQLA 4DR5C 4DR1C 3GPCA 4B3MC 1N33C 2ZM6C 2F4VC 1HH2P 3AF5A 2PROA 4WV3A 3S82A 2P2QA 4GXRA 4LFAC 2VSQA 1IBLC 1UKKA 3VNSA 4LF5C 4JI8C 2QVXX 2E8FA 4DV3C 1USPB 1MXCA 4KHPC 3LAXA 3N54B 3I07A 2D1TA 2D28C 2YWCA 3NPDA 2UXBC 4FTFA 4D4GA 4WS9A 5A19A 2QL8A 4MH4A 1V26A 2AYAA 2D1RA 4PROC 4DG8A 1O93A 3C5EA 4I9FA 5IWAC 1ZB8A 4AQYC 3RG2A 2QVZX 2XR1A 2VZEA 2WD9A 2VQFC 3ETOA 2E0GA 5CZXA 3DHVA 4DV0C 1O9TA 2E7GA 3AF6A 5IFIA 4EATA 3DAYA 4ISBA 3T1HC 1MXBA 3IEVA 2UU9C 4DCUA 4DR6C 4RVOA 4OXIA 5LMUC 4OYCA 1VLAA 2BJOA 1JOSA 5KYVA 4RLQA 4YHHC 1FUGA 4BC9A 5BSUA 2UXCC 3A9VA 4BCAA 4JI7C 4X66C 4RM2A 2Y4OA 3VNQA 2DYJA 3LNVA 1MKYA 4LFBC 3RV2A 1WH9A 1T5DX 5T8TA 4D4IA 4D57A 3I08A 4HPVA 3J81D 1J5EC 1PA4A 5BSMA 3A9UA 2UUBC 3JAMD 5H9UA 3TUFA 5BSRA 2E8EA 2CY1A 4PZPA 4GKJC 2OO4A 4JV5C 2QVYX 4JI4C 4BC7A 1N36C 5E7QA 4RLFA 3E7XA 4GS5A 2E8CA 2P2BA 3N2QA 4B3RC 1KKGA 1N34C 3IMLA 4RMNA 5JRHA 1N2FA 1YJ7A 4TPSB 4I9GA 4DV4C 2P02A 3NYRA 3GR1A 3J7AD 3PBKA 2Y4NA 4ZJZA 4K0BA 4JI6C 1XMOC 1MXAA 3OTOC 3R9XA 3R44A 4DR7C 5BSWA 2YCBA 1T5HX 1XRAA 2ASBA 2D27A 4IZ6A 4JYAC 4DUYC 4OX9C 2ONFA 2EGTA 5FLXD 1L2FA 2D1SA 2WP0C 4B3SC 4JM1A 3G7SA 1K0RA 4DV1C 1O92A 1O90A 2HJGA 2OPLA 2CXCA 3CW8X 4DCVA 4DV5C 3CJEA 3VNRA 4R1MA 3IPLA 5BURA 1ZB9A 1NYEA 4LF4C 2V7BA 4ODJA 4X64C 3EERA 1P7LA 2P2MA 5A1GA 3J80D 3A4IA 4DR2C 1PG3A 3IEUA 5AE3A 5K8FA 1N32C 4LFCC 1RY2A 4X62C 2PT7G 4DCSA 4JI5C 2OPLB 5KYTA 4LF8C 5A1IA 4IR7A 3DLPX 4MTNA 5T8SA 4JI0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  1HNZ C;  2VQF C;  4X65 C;  1QWI A;  4DV4 C;  4DV2 C;  2UXD C;  3J7A D;  4JI6 C;  1XMO C;  3OTO C;  4DV0 C;  2HHH C;  1WF3 A;  3R9X A;  4LF9 C;  2E7G A;  4DR7 C;  4JI1 C;  4NXM C;  3AF6 A;  2PN2 A;  4DCT A;  2D7V A;  2KZF A;  1USP A;  2YCB A;  1IBK C;  4B3T C;  3T1H C;  2ASB A;  3IEV A;  4JI3 C;  2UU9 C;  4DCU A;  3LUS A;  4DR6 C;  4JYA C;  4DV6 C;  4YY3 C;  4DUY C;  4OX9 C;  2ONF A;  2EGT A;  5BR8 C;  1IBM C;  5LMU C;  1XMQ C;  1VLA A;  5FLX D;  2BJO A;  1L2F A;  1JOS A;  1HNX C;  4B3S C;  4YHH C;  2E5L C;  1FJG C;  2VQE C;  4GKK C;  5LMN C;  2UXC C;  1XNR C;  1K0R A;  4DV1 C;  3GKU A;  4JI7 C;  4LF7 C;  2OPL A;  2HJG A;  1XNQ C;  4NOZ A;  4X66 C;  2CXC A;  4DCV A;  4DR4 C;  2UUA C;  4DV5 C;  3CJE A;  1HNW C;  4DV7 C;  1ML8 A;  4JI2 C;  2DYJ A;  4NXN C;  1LQL A;  4DR5 C;  4DR1 C;  4BSZ A;  4B3M C;  1N33 C;  2ZM6 C;  1MKY A;  2F4V C;  1HH2 P;  1ZB9 A;  4DUZ C;  3AF5 A;  4LFB C;  2JMP A;  1WH9 A;  4DR3 C;  1NYE A;  4LFA C;  4LF4 C;  3T1Y C;  1IBL C;  1UKK A;  4LF5 C;  4LF6 C;  4X64 C;  4JI8 C;  3J81 D;  3EER A;  2E8F A;  1J5E C;  1PA4 A;  4DV3 C;  1USP B;  3J80 D;  4KHP C;  2UUB C;  1EGA A;  4DR2 C;  3JAM D;  3I07 A;  2ATW A;  5A2Q D;  2UXB C;  3IEU A;  5IT9 D;  2E8E A;  1N32 C;  4LFC C;  2CY1 A;  4GKJ C;  4JV5 C;  2QL8 A;  4XX2 A;  4JI4 C;  4MH4 A;  2UUC C;  1N36 C;  4X62 C;  3R9W A;  1HR0 C;  2E8C A;  2PT7 G;  4DCS A;  1I94 C;  5IWA C;  1ZB8 A;  4JI5 C;  2OPL B;  4B3R C;  4AQY C;  4LF8 C;  4K0K C;  1KKG A;  4MTN A;  1N34 C;  2XR1 A;  4JI0 C; 
#chains in the Genus database with same CATH topology
 4L2Z A;  4X65 C;  1QWI A;  2ZZN A;  4DV2 C;  3UZ0 A;  2MMA B;  2UXD C;  1M6X A;  3KXW A;  5BST A;  4NXM C;  2PN2 A;  2D7V A;  5BUQ A;  1IBK C;  4B3T C;  3GR0 A;  3LUS A;  4DV6 C;  3K6R A;  5BR8 C;  1RG9 A;  3AY0 A;  1IBM C;  1TH5 A;  1XMQ C;  1YGT A;  2YX1 A;  4RM3 A;  4ZLP A;  4KTT A;  2QW0 X;  1MD9 A;  4R1L A;  3FCE A;  1HNX C;  2YWB A;  3H2T A;  5KEI A;  1BA3 A;  2VQE C;  2Z51 A;  2DPL A;  4FUT A;  4LE5 A;  5LMN C;  3ETC A;  3L95 X;  1XNR C;  3PES A;  4LF7 C;  4DR4 C;  2UUA C;  1LCI A;  1HNW C;  1ML8 A;  4JI2 C;  4PHT A;  1MDF A;  4BSZ A;  4DUZ C;  2JMP A;  1ULT A;  4DR3 C;  3NYQ A;  3T1Y C;  3A25 A;  4LF6 C;  5AE2 A;  4U5Y D;  1MDB A;  1EGA A;  5BSV A;  1XRB A;  5GTD A;  2ATW A;  1IB8 A;  5A2Q D;  5DV9 A;  2M5O A;  3EQ6 A;  5IT9 D;  4FUQ A;  3E7W A;  4DG9 A;  2OBV A;  4GXQ A;  4XX2 A;  2UUC C;  3R9W A;  1HR0 C;  5BUS A;  4G1I A;  1I94 C;  4D56 A;  2P2J A;  2PG1 E;  3B7W A;  5CZV A;  3TDE A;  4K0K C;  3PRO C;  2D1Q A;  1V25 A;  2P20 A;  2BH1 X;  1QM4 A;  1AMU A;  1HNZ C;  3UOW A;  2Y27 A;  3CW9 A;  4L7I A;  5ADZ A;  2HHH C;  1WF3 A;  4LF9 C;  4BBY A;  2KDN A;  4JI1 C;  5K85 A;  3LGX A;  4DCT A;  1NY8 A;  2KZF A;  1USP A;  2P2F A;  3L8C A;  3NI2 A;  4JI3 C;  4YY3 C;  3LNO A;  4R0M A;  4NDN A;  1XS3 A;  4L4Q A;  4G37 A;  3SO4 A;  1PG4 A;  4KTV A;  4G36 A;  3TQI A;  1XRC A;  2E5L C;  1FJG C;  4GKK C;  4RVN A;  5AE1 A;  3GKU A;  1XNQ C;  4NOZ A;  1FLO A;  1GPM A;  4DV7 C;  2CU6 A;  3FCC A;  4NXN C;  1LQL A;  4DR5 C;  4DR1 C;  3GPC A;  4B3M C;  1N33 C;  2ZM6 C;  2F4V C;  1HH2 P;  3AF5 A;  1VEH A;  2PRO A;  4WV3 A;  3S82 A;  2P2Q A;  4GXR A;  4LFA C;  2VSQ A;  1IBL C;  1UKK A;  3VNS A;  4LF5 C;  4JI8 C;  2QVX X;  2E8F A;  4DV3 C;  1USP B;  1MXC A;  4KHP C;  3LAX A;  3N54 B;  3I07 A;  2D1T A;  2D28 C;  2YWC A;  3NPD A;  2UXB C;  4FTF A;  3CQ3 A;  2NCL A;  4D4G A;  4WS9 A;  5A19 A;  2QL8 A;  4MH4 A;  1V26 A;  2AYA A;  2D1R A;  4PRO C;  4DG8 A;  1O93 A;  3C5E A;  4I9F A;  5IWA C;  1ZB8 A;  4AQY C;  3RG2 A;  2QVZ X;  2XR1 A;  2VZE A;  1WCJ A;  2WD9 A;  1UWD A;  2VQF C;  3ETO A;  2E0G A;  5CZX A;  3DHV A;  4DV0 C;  1O9T A;  2E7G A;  4PUI A;  3A26 A;  4PUH A;  3AF6 A;  5IFI A;  4EAT A;  3DAY A;  4ISB A;  3T1H C;  1MXB A;  3UX2 A;  3UX3 A;  3IEV A;  2UU9 C;  4DCU A;  4DR6 C;  4RVO A;  4PUG A;  4OXI A;  5LMU C;  4OYC A;  3O2E A;  1VLA A;  2BJO A;  2M5H A;  1JOS A;  5KYV A;  4RLQ A;  4YHH C;  1FUG A;  4BC9 A;  5BSU A;  2UXC C;  1P4E C;  3A9V A;  3CQ2 A;  4BCA A;  4JI7 C;  4X66 C;  4RM2 A;  2Y4O A;  3VNQ A;  2DYJ A;  3LNV A;  1MKY A;  5LCI A;  4LFB C;  3RV2 A;  1WH9 A;  1T5D X;  5T8T A;  4D4I A;  4D57 A;  2MM9 A;  3I08 A;  4HPV A;  3J81 D;  1J5E C;  1PA4 A;  5BSM A;  3A9U A;  2UUB C;  3JAM D;  5H9U A;  1XDX A;  2ZTB A;  3TUF A;  5BSR A;  2E8E A;  2CY1 A;  4PZP A;  4GKJ C;  2OO4 A;  4JV5 C;  2QVY X;  4JI4 C;  4BC7 A;  1N36 C;  5E7Q A;  4RLF A;  3E7X A;  4GS5 A;  2E8C A;  2P2B A;  1V60 A;  3N2Q A;  4B3R C;  1XHJ A;  1KKG A;  1N34 C;  3IML A;  2JNV A;  4RMN A;  5JRH A;  1N2F A;  1YJ7 A;  4TPS B;  4I9G A;  4DV4 C;  2P02 A;  3NYR A;  3GR1 A;  3J7A D;  3PBK A;  2Y4N A;  4ZJZ A;  4K0B A;  3FM7 A;  4JI6 C;  1XMO C;  1MXA A;  3OTO C;  3R9X A;  3R44 A;  4DR7 C;  5BSW A;  2YCB A;  1T5H X;  1XRA A;  2ASB A;  2D27 A;  4IZ6 A;  4JYA C;  4DUY C;  4OX9 C;  2EGT A;  2ONF A;  5FLX D;  1L2F A;  2D1S A;  2WP0 C;  4B3S C;  3CQ1 A;  4JM1 A;  3G7S A;  1K0R A;  4DV1 C;  3TR3 A;  1O92 A;  1O90 A;  2HJG A;  2OPL A;  2CXC A;  3CW8 X;  4DCV A;  4DV5 C;  3CJE A;  3VNR A;  4R1M A;  2ZZM A;  3IPL A;  5BUR A;  1ZB9 A;  1NYE A;  4LF4 C;  2V7B A;  4ODJ A;  4X64 C;  3EER A;  1P7L A;  2P2M A;  5A1G A;  3J80 D;  3A4I A;  4DR2 C;  1PG3 A;  2KZ0 A;  1P4E A;  3IEU A;  5AE3 A;  5K8F A;  1N32 C;  4LFC C;  2DHM A;  1RY2 A;  4X62 C;  2MCQ A;  2PT7 G;  4DCS A;  1M6X C;  4JI5 C;  2OPL B;  1PU1 A;  3UEB A;  5KYT A;  4LF8 C;  5A1I A;  4IR7 A;  3DLP X;  4MTN A;  5T8S A;  4JI0 C; 
#chains in the Genus database with same CATH homology
 4L2Z A;  4X65 C;  1QWI A;  4DV2 C;  3UZ0 A;  2UXD C;  3KXW A;  5BST A;  4NXM C;  2PN2 A;  2D7V A;  5BUQ A;  1IBK C;  4B3T C;  3GR0 A;  3LUS A;  4DV6 C;  5BR8 C;  1RG9 A;  1IBM C;  1XMQ C;  4ZLP A;  4RM3 A;  4KTT A;  2QW0 X;  1MD9 A;  4R1L A;  3FCE A;  1HNX C;  2YWB A;  3H2T A;  5KEI A;  1BA3 A;  2VQE C;  2DPL A;  4FUT A;  4LE5 A;  5LMN C;  3ETC A;  3L95 X;  1XNR C;  3PES A;  4LF7 C;  4DR4 C;  2UUA C;  1LCI A;  1HNW C;  1ML8 A;  4JI2 C;  4PHT A;  1MDF A;  4BSZ A;  4DUZ C;  2JMP A;  1ULT A;  4DR3 C;  3NYQ A;  3T1Y C;  4LF6 C;  5AE2 A;  4U5Y D;  1MDB A;  1EGA A;  5BSV A;  1XRB A;  5GTD A;  2ATW A;  5A2Q D;  5DV9 A;  3EQ6 A;  5IT9 D;  4FUQ A;  3E7W A;  4DG9 A;  2OBV A;  4GXQ A;  4XX2 A;  2UUC C;  3R9W A;  1HR0 C;  5BUS A;  4G1I A;  1I94 C;  4D56 A;  2P2J A;  3B7W A;  5CZV A;  3TDE A;  4K0K C;  3PRO C;  2D1Q A;  1V25 A;  2P20 A;  2BH1 X;  1QM4 A;  1AMU A;  1HNZ C;  3UOW A;  2Y27 A;  3CW9 A;  4L7I A;  5ADZ A;  2HHH C;  1WF3 A;  4LF9 C;  4BBY A;  4JI1 C;  5K85 A;  3LGX A;  4DCT A;  2KZF A;  1USP A;  2P2F A;  3L8C A;  3NI2 A;  4JI3 C;  4YY3 C;  4R0M A;  4NDN A;  4L4Q A;  4G37 A;  3SO4 A;  1PG4 A;  4KTV A;  4G36 A;  3TQI A;  1XRC A;  2E5L C;  1FJG C;  4GKK C;  4RVN A;  5AE1 A;  3GKU A;  1XNQ C;  4NOZ A;  1GPM A;  4DV7 C;  3FCC A;  4NXN C;  1LQL A;  4DR5 C;  4DR1 C;  3GPC A;  4B3M C;  1N33 C;  2ZM6 C;  2F4V C;  1HH2 P;  3AF5 A;  2PRO A;  4WV3 A;  3S82 A;  2P2Q A;  4GXR A;  4LFA C;  2VSQ A;  1IBL C;  1UKK A;  3VNS A;  4LF5 C;  4JI8 C;  2QVX X;  2E8F A;  4DV3 C;  1USP B;  1MXC A;  4KHP C;  3LAX A;  3N54 B;  3I07 A;  2D1T A;  2D28 C;  2YWC A;  3NPD A;  2UXB C;  4FTF A;  4D4G A;  4WS9 A;  5A19 A;  2QL8 A;  4MH4 A;  1V26 A;  2AYA A;  2D1R A;  4PRO C;  4DG8 A;  1O93 A;  3C5E A;  4I9F A;  5IWA C;  1ZB8 A;  4AQY C;  3RG2 A;  2QVZ X;  2XR1 A;  2VZE A;  2WD9 A;  2VQF C;  3ETO A;  2E0G A;  5CZX A;  3DHV A;  4DV0 C;  1O9T A;  2E7G A;  3AF6 A;  5IFI A;  4EAT A;  3DAY A;  4ISB A;  3T1H C;  1MXB A;  3IEV A;  2UU9 C;  4DCU A;  4DR6 C;  4RVO A;  4OXI A;  5LMU C;  4OYC A;  1VLA A;  2BJO A;  1JOS A;  5KYV A;  4RLQ A;  4YHH C;  1FUG A;  4BC9 A;  5BSU A;  2UXC C;  3A9V A;  4BCA A;  4JI7 C;  4X66 C;  4RM2 A;  2Y4O A;  3VNQ A;  2DYJ A;  3LNV A;  1MKY A;  4LFB C;  3RV2 A;  1WH9 A;  1T5D X;  5T8T A;  4D4I A;  4D57 A;  3I08 A;  4HPV A;  3J81 D;  1J5E C;  1PA4 A;  5BSM A;  3A9U A;  2UUB C;  3JAM D;  5H9U A;  3TUF A;  5BSR A;  2E8E A;  2CY1 A;  4PZP A;  4GKJ C;  2OO4 A;  4JV5 C;  2QVY X;  4JI4 C;  4BC7 A;  1N36 C;  5E7Q A;  4RLF A;  3E7X A;  4GS5 A;  2E8C A;  2P2B A;  3N2Q A;  4B3R C;  1KKG A;  1N34 C;  3IML A;  4RMN A;  5JRH A;  1N2F A;  1YJ7 A;  4TPS B;  4I9G A;  4DV4 C;  2P02 A;  3NYR A;  3GR1 A;  3J7A D;  3PBK A;  2Y4N A;  4ZJZ A;  4K0B A;  4JI6 C;  1XMO C;  1MXA A;  3OTO C;  3R9X A;  3R44 A;  4DR7 C;  5BSW A;  2YCB A;  1T5H X;  1XRA A;  2ASB A;  2D27 A;  4IZ6 A;  4JYA C;  4DUY C;  4OX9 C;  2ONF A;  2EGT A;  5FLX D;  1L2F A;  2D1S A;  2WP0 C;  4B3S C;  4JM1 A;  3G7S A;  1K0R A;  4DV1 C;  1O92 A;  1O90 A;  2HJG A;  2OPL A;  2CXC A;  3CW8 X;  4DCV A;  4DV5 C;  3CJE A;  3VNR A;  4R1M A;  3IPL A;  5BUR A;  1ZB9 A;  1NYE A;  4LF4 C;  2V7B A;  4ODJ A;  4X64 C;  3EER A;  1P7L A;  2P2M A;  5A1G A;  3J80 D;  3A4I A;  4DR2 C;  1PG3 A;  3IEU A;  5AE3 A;  5K8F A;  1N32 C;  4LFC C;  1RY2 A;  4X62 C;  2PT7 G;  4DCS A;  4JI5 C;  2OPL B;  5KYT A;  4LF8 C;  5A1I A;  4IR7 A;  3DLP X;  4MTN A;  5T8S A;  4JI0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...