4JI7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji7C02
4LF7C 2ATWA 3R9XA 4YY3C 1HH2P 2OPLA 1HR0C 4LF4C 4B3SC 2XR1A 1FJGC 1L2FA 3LUSA 4NXNC 1N33C 5LMNC 4B3TC 2CXCA 2OPLB 2E8CA 4DV0C 2E8FA 2UXDC 4JI2C 2PN2A 4DV6C 4X62C 2PT7G 3I07A 1WH9A 4DR3C 4BSZA 2ONFA 4AQYC 1UKKA 1USPB 4LF8C 4GKKC 1EGAA 3J80D 4DR5C 1XMOC 1HNXC 4JV5C 4JI6C 2UUCC 4JI0C 4DUZC 3OTOC 2HHHC 2ASBA 3J81D 4X66C 4LFCC 5A2QD 1QWIA 2UU9C 3IEVA 4LFAC 4DCUA 2JMPA 4DV3C 4DR2C 4DR6C 5FLXD 1XNRC 1I94C 4X65C 1LQLA 3CJEA 4JI8C 4DV1C 2UUAC 4JI5C 4DR7C 4DV4C 4X64C 2KZFA 3AF6A 4YHHC 2E5LC 4JI4C 1N2FA 4JI7C 2DYJA 1PA4A 5IWAC 1ZB8A 3J7AD 3JAMD 1MKYA 1KKGA 4NOZA 1K0RA 2QL8A 1IBMC 4B3MC 2E8EA 2HJGA 1N32C 4DV5C 4GKJC 4DCSA 2UUBC 3AF5A 4KHPC 3EERA 3GKUA 2BJOA 4LF9C 2UXBC 4MH4A 5IT9D 1VLAA 2D7VA 4DR4C 2UXCC 2EGTA 4K0KC 1ML8A 1NYEA 3R9WA 1XMQC 1JOSA 2VQEC 4JI3C 4DV7C 4JI1C 4LF6C 2CY1A 1N36C 1XNQC 4LFBC 1HNWC 1WF3A 3IEUA 4DV2C 4DR1C 1N34C 1HNZC 4DCTA 2ZM6C 1J5EC 4JYAC 2F4VC 4DUYC 1ZB9A 1USPA 2E7GA 2YCBA 4NXMC 5LMUC 4B3RC 4XX2A 3T1YC 4LF5C 1IBKC 4OX9C 4DCVA 4MTNA 2VQFC 5BR8C 3T1HC 1IBLC
chains in the Genus database with same CATH superfamily
4LF7C 3R9XA 4YY3C 3RV2A 4FUQA 2OPLA 3LAXA 2XR1A 1L2FA 3C5EA 4NXNC 5LMNC 4B3TC 4DV0C 2E8CA 3A26A 2UXDC 3G7SA 3A4IA 4IR7A 4D57A 1O90A 1V26A 2M5OA 2QVXX 4FUTA 4DR3C 3EQ6A 4KTTA 1ULTA 4JM1A 3CQ1A 3J80D 4DR5C 1HNXC 3AY0A 1XRBA 3UX3A 4ZJZA 3DLPX 2UU9C 3N2QA 2JNVA 4DR6C 4X65C 1LQLA 2WP0C 4IZ6A 4R0MA 3GR0A 4OXIA 1XRAA 4X64C 3AF6A 3FCEA 4PZPA 4JI4C 4JI7C 4L2ZA 3A25A 5IWAC 3S82A 4BC9A 4NOZA 2VSQA 2DHMA 1MXCA 4DV5C 3AF5A 4KHPC 3VNSA 4PUIA 4D4GA 2WD9A 3LNVA 4G36A 4ODJA 1BA3A 2UXCC 2OBVA 5BSMA 2YWCA 1XDXA 1ML8A 2PG1E 2V7BA 4KTVA 3RG2A 4JI3C 2Y4NA 1LCIA 3E7WA 2CY1A 1N36C 5BSUA 4LFBC 1WF3A 3IEUA 5A1GA 1N34C 4BCAA 4DCTA 1J5EC 4JYAC 5BSRA 2E7GA 2P2QA 4NXMC 4B3RC 4LF5C 2D1QA 1XRCA 4GS5A 4MTNA 4FTFA 3GPCA 2D28C 2ATWA 3TQIA 4L7IA 4B3SC 3LUSA 5BUQA 1P4EA 1N33C 3UZ0A 2QVYX 2CXCA 2E8FA 1IB8A 2PN2A 3I08A 1O92A 5KEIA 4OYCA 1P7LA 1P4EC 3SO4A 4BSZA 4AQYC 2ZTBA 4GKKC 2D1TA 3NPDA 4JV5C 2UUCC 4JI0C 4DUZC 5K85A 4ZLPA 3OTOC 2ASBA 2QW0X 3VNQA 3CQ3A 1QWIA 1PG4A 3NI2A 4G37A 3FM7A 3IEVA 4LFAC 1UWDA 5JRHA 4DV3C 1M6XA 5FLXD 1I94C 2KDNA 4DR7C 2KZFA 4PUHA 2E5LC 1M6XC 1ZB8A 4ISBA 3J7AD 4B3MC 1IBMC 5BSVA 2HJGA 1N32C 2KZ0A 3UOWA 2UUBC 3GKUA 2BJOA 2UXBC 1T5HX 3PROC 5KYVA 3H2TA 4RM2A 3NYRA 4WS9A 4DR4C 5T8SA 4EATA 5AE3A 3R9WA 1JOSA 3B7WA 4JI1C 4LF6C 2MMAB 4DR1C 2CU6A 3IMLA 4R1LA 1ZB9A 1USPA 5LMUC 3TUFA 1IBKC 4OX9C 1QM4A 4HPVA 2PROA 2VQFC 3T1HC 3DHVA 2P2FA 1YGTA 3ETCA 4LF4C 1T5DX 1FJGC 3R44A 3CW8X 4JI2C 4R1MA 4DV6C 5BUSA 4X62C 3I07A 2D1RA 2MCQA 5GTDA 5DV9A 2D27A 1USPB 1UKKA 5BSWA 4TPSB 1XMOC 2Y4OA 2HHHC 4U5YD 5H9UA 3J81D 4X66C 4LFCC 5A2QD 2P2JA 4I9GA 5BSTA 1NY8A 3GR1A 3L95X 4K0BA 4D4IA 4DCUA 4DG9A 1FUGA 4DR2C 5CZXA 3CJEA 4JI8C 3PBKA 4DV1C 4DV4C 4YHHC 4G1IA 4GXRA 3IPLA 4RLQA 2DYJA 1PA4A 2P2MA 1V25A 3TR3A 2DPLA 1TH5A 2ZZNA 2QL8A 3E7XA 2E8EA 5IFIA 2P2BA 3EERA 1RG9A 4LF9C 4MH4A 3LGXA 5IT9D 3KXWA 3A9UA 5ADZA 2QVZX 4PHTA 1YJ7A 2EGTA 1PU1A 5AE2A 1MXAA 5A1IA 1MD9A 3LNOA 2AYAA 2P20A 4DV7C 4I9FA 3FCCA 1MDFA 5A19A 1XNQC 3TDEA 1HNWC 4NDNA 4DV2C 1HNZC 1O93A 4PUGA 3CQ2A 4DUYC 5K8FA 4XX2A 4RMNA 3T1YC 4DCVA 4WV3A 1IBLC 4L4QA 1XS3A 1HH2P 3CW9A 1HR0C 2BH1X 3PESA 2OPLB 1MXBA 4RVOA 1GPMA 1RY2A 4RM3A 5T8TA 4DG8A 2PT7G 2NCLA 5CZVA 3O2EA 3L8CA 1WH9A 3UX2A 2ONFA 1WCJA 4LF8C 1EGAA 2E0GA 2MM9A 4JI6C 2YX1A 5E7QA 4RVNA 1FLOA 3NYQA 4BC7A 2P02A 2M5HA 4RLFA 2JMPA 1PG3A 5AE1A 1XNRC 3A9VA 5KYTA 2UUAC 4JI5C 2OO4A 4PROC 3VNRA 1N2FA 3DAYA 3JAMD 1MKYA 1KKGA 2D1SA 1K0RA 2YWBA 3K6RA 3ETOA 4BBYA 4GKJC 4DCSA 1AMUA 2VZEA 4LE5A 1XHJA 5LCIA 2Y27A 1O9TA 1VLAA 2D7VA 2Z51A 4K0KC 1MDBA 1NYEA 3UEBA 1XMQC 5BURA 2VQEC 1V60A 2ZM6C 2F4VC 2YCBA 1VEHA 4GXQA 3N54B 2ZZMA 4D56A 5BR8C
chains in the Genus database with same CATH topology
4LF7C 3R9XA 4YY3C 3RV2A 4FUQA 2OPLA 3LAXA 2XR1A 1L2FA 3C5EA 4NXNC 5LMNC 4B3TC 4DV0C 2E8CA 2UXDC 3G7SA 3A4IA 4IR7A 4D57A 1O90A 1V26A 2QVXX 4FUTA 4DR3C 3EQ6A 4KTTA 1ULTA 4JM1A 3J80D 4DR5C 1HNXC 1XRBA 4ZJZA 3DLPX 2UU9C 3N2QA 4DR6C 4X65C 1LQLA 2WP0C 4IZ6A 4R0MA 3GR0A 4OXIA 1XRAA 4X64C 3AF6A 3FCEA 4PZPA 4JI4C 4JI7C 4L2ZA 5IWAC 3S82A 4BC9A 4NOZA 2VSQA 1MXCA 4DV5C 3AF5A 4KHPC 3VNSA 4D4GA 2WD9A 3LNVA 4G36A 4ODJA 1BA3A 2UXCC 2OBVA 5BSMA 2YWCA 1ML8A 2V7BA 4KTVA 3RG2A 4JI3C 2Y4NA 1LCIA 3E7WA 2CY1A 1N36C 5BSUA 4LFBC 1WF3A 3IEUA 5A1GA 1N34C 4BCAA 4DCTA 1J5EC 4JYAC 5BSRA 2E7GA 2P2QA 4NXMC 4B3RC 4LF5C 2D1QA 1XRCA 4GS5A 4MTNA 4FTFA 3GPCA 2D28C 2ATWA 3TQIA 4L7IA 4B3SC 3LUSA 5BUQA 1N33C 3UZ0A 2QVYX 2CXCA 2E8FA 2PN2A 3I08A 1O92A 5KEIA 4OYCA 1P7LA 3SO4A 4BSZA 4AQYC 4GKKC 2D1TA 3NPDA 4JV5C 2UUCC 4JI0C 4DUZC 5K85A 4ZLPA 3OTOC 2ASBA 2QW0X 3VNQA 1QWIA 1PG4A 3NI2A 4G37A 3IEVA 4LFAC 5JRHA 4DV3C 5FLXD 1I94C 4DR7C 2KZFA 2E5LC 1ZB8A 4ISBA 3J7AD 4B3MC 1IBMC 5BSVA 2HJGA 1N32C 3UOWA 2UUBC 3GKUA 2BJOA 2UXBC 1T5HX 3PROC 5KYVA 3H2TA 4RM2A 3NYRA 4WS9A 4DR4C 5T8SA 4EATA 5AE3A 3R9WA 1JOSA 3B7WA 4JI1C 4LF6C 4DR1C 3IMLA 4R1LA 1ZB9A 1USPA 5LMUC 3TUFA 1IBKC 4OX9C 1QM4A 4HPVA 2PROA 2VQFC 3T1HC 3DHVA 2P2FA 3ETCA 4LF4C 1T5DX 1FJGC 3R44A 3CW8X 4JI2C 4R1MA 4DV6C 5BUSA 4X62C 3I07A 2D1RA 5GTDA 5DV9A 2D27A 1USPB 1UKKA 5BSWA 4TPSB 1XMOC 2Y4OA 2HHHC 4U5YD 5H9UA 3J81D 4X66C 4LFCC 5A2QD 2P2JA 4I9GA 5BSTA 3GR1A 3L95X 4K0BA 4D4IA 4DCUA 4DG9A 1FUGA 4DR2C 5CZXA 3CJEA 4JI8C 3PBKA 4DV1C 4DV4C 4YHHC 4G1IA 4GXRA 3IPLA 4RLQA 2DYJA 1PA4A 2P2MA 1V25A 2DPLA 2QL8A 3E7XA 2E8EA 5IFIA 2P2BA 3EERA 1RG9A 4LF9C 4MH4A 3LGXA 5IT9D 3KXWA 3A9UA 5ADZA 2QVZX 4PHTA 1YJ7A 2EGTA 5AE2A 1MXAA 5A1IA 1MD9A 2AYAA 2P20A 4DV7C 4I9FA 3FCCA 1MDFA 5A19A 1XNQC 3TDEA 1HNWC 4NDNA 4DV2C 1HNZC 1O93A 4DUYC 5K8FA 4XX2A 4RMNA 3T1YC 4DCVA 4WV3A 1IBLC 4L4QA 1HH2P 3CW9A 1HR0C 2BH1X 3PESA 2OPLB 1MXBA 4RVOA 1GPMA 1RY2A 4RM3A 5T8TA 4DG8A 2PT7G 5CZVA 3L8CA 1WH9A 2ONFA 4LF8C 1EGAA 2E0GA 4JI6C 5E7QA 4RVNA 3NYQA 4BC7A 2P02A 4RLFA 2JMPA 1PG3A 5AE1A 1XNRC 3A9VA 5KYTA 2UUAC 4JI5C 2OO4A 4PROC 3VNRA 1N2FA 3DAYA 3JAMD 1MKYA 1KKGA 2D1SA 1K0RA 2YWBA 4BBYA 3ETOA 4GKJC 4DCSA 1AMUA 2VZEA 4LE5A 2Y27A 1O9TA 1VLAA 2D7VA 4K0KC 1MDBA 1NYEA 1XMQC 5BURA 2VQEC 2ZM6C 2F4VC 2YCBA 4GXQA 3N54B 4D56A 5BR8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 C;  2ATW A;  3R9X A;  4YY3 C;  1HH2 P;  2OPL A;  1HR0 C;  4LF4 C;  4B3S C;  2XR1 A;  1FJG C;  1L2F A;  3LUS A;  4NXN C;  1N33 C;  5LMN C;  4B3T C;  2CXC A;  2OPL B;  2E8C A;  4DV0 C;  2E8F A;  2UXD C;  4JI2 C;  2PN2 A;  4DV6 C;  4X62 C;  2PT7 G;  3I07 A;  1WH9 A;  4DR3 C;  4BSZ A;  2ONF A;  4AQY C;  1UKK A;  1USP B;  4LF8 C;  4GKK C;  1EGA A;  3J80 D;  4DR5 C;  1XMO C;  1HNX C;  4JV5 C;  4JI6 C;  2UUC C;  4JI0 C;  4DUZ C;  3OTO C;  2HHH C;  2ASB A;  3J81 D;  4X66 C;  4LFC C;  5A2Q D;  1QWI A;  2UU9 C;  3IEV A;  4LFA C;  4DCU A;  2JMP A;  4DV3 C;  4DR2 C;  4DR6 C;  5FLX D;  1XNR C;  1I94 C;  4X65 C;  1LQL A;  3CJE A;  4JI8 C;  4DV1 C;  2UUA C;  4JI5 C;  4DR7 C;  4DV4 C;  4X64 C;  2KZF A;  3AF6 A;  4YHH C;  2E5L C;  4JI4 C;  1N2F A;  4JI7 C;  2DYJ A;  1PA4 A;  5IWA C;  1ZB8 A;  3J7A D;  3JAM D;  1MKY A;  1KKG A;  4NOZ A;  1K0R A;  2QL8 A;  1IBM C;  4B3M C;  2E8E A;  2HJG A;  1N32 C;  4DV5 C;  4GKJ C;  4DCS A;  2UUB C;  3AF5 A;  4KHP C;  3EER A;  3GKU A;  2BJO A;  4LF9 C;  2UXB C;  4MH4 A;  5IT9 D;  1VLA A;  2D7V A;  4DR4 C;  2UXC C;  2EGT A;  4K0K C;  1ML8 A;  1NYE A;  3R9W A;  1XMQ C;  1JOS A;  2VQE C;  4JI3 C;  4DV7 C;  4JI1 C;  4LF6 C;  2CY1 A;  1N36 C;  1XNQ C;  4LFB C;  1HNW C;  1WF3 A;  3IEU A;  4DV2 C;  4DR1 C;  1N34 C;  1HNZ C;  4DCT A;  2ZM6 C;  1J5E C;  4JYA C;  2F4V C;  4DUY C;  1ZB9 A;  1USP A;  2E7G A;  2YCB A;  4NXM C;  5LMU C;  4B3R C;  4XX2 A;  3T1Y C;  4LF5 C;  1IBK C;  4OX9 C;  4DCV A;  4MTN A;  2VQF C;  5BR8 C;  3T1H C;  1IBL C; 
#chains in the Genus database with same CATH topology
 4LF7 C;  3R9X A;  4YY3 C;  3RV2 A;  4FUQ A;  2OPL A;  3LAX A;  2XR1 A;  1L2F A;  3C5E A;  4NXN C;  5LMN C;  4B3T C;  4DV0 C;  2E8C A;  3A26 A;  2UXD C;  3G7S A;  3A4I A;  4IR7 A;  4D57 A;  1O90 A;  1V26 A;  2M5O A;  2QVX X;  4FUT A;  4DR3 C;  3EQ6 A;  4KTT A;  1ULT A;  4JM1 A;  3CQ1 A;  3J80 D;  4DR5 C;  1HNX C;  3AY0 A;  1XRB A;  3UX3 A;  4ZJZ A;  3DLP X;  2UU9 C;  3N2Q A;  2JNV A;  4DR6 C;  4X65 C;  1LQL A;  2WP0 C;  4IZ6 A;  4R0M A;  3GR0 A;  4OXI A;  1XRA A;  4X64 C;  3AF6 A;  3FCE A;  4PZP A;  4JI4 C;  4JI7 C;  4L2Z A;  3A25 A;  5IWA C;  3S82 A;  4BC9 A;  4NOZ A;  2VSQ A;  2DHM A;  1MXC A;  4DV5 C;  3AF5 A;  4KHP C;  3VNS A;  4PUI A;  4D4G A;  2WD9 A;  3LNV A;  4G36 A;  4ODJ A;  1BA3 A;  2UXC C;  2OBV A;  5BSM A;  2YWC A;  1XDX A;  1ML8 A;  2PG1 E;  2V7B A;  4KTV A;  3RG2 A;  4JI3 C;  2Y4N A;  1LCI A;  3E7W A;  2CY1 A;  1N36 C;  5BSU A;  4LFB C;  1WF3 A;  3IEU A;  5A1G A;  1N34 C;  4BCA A;  4DCT A;  1J5E C;  4JYA C;  5BSR A;  2E7G A;  2P2Q A;  4NXM C;  4B3R C;  4LF5 C;  2D1Q A;  1XRC A;  4GS5 A;  4MTN A;  4FTF A;  3GPC A;  2D28 C;  2ATW A;  3TQI A;  4L7I A;  4B3S C;  3LUS A;  5BUQ A;  1P4E A;  1N33 C;  3UZ0 A;  2QVY X;  2CXC A;  2E8F A;  1IB8 A;  2PN2 A;  3I08 A;  1O92 A;  5KEI A;  4OYC A;  1P7L A;  1P4E C;  3SO4 A;  4BSZ A;  4AQY C;  2ZTB A;  4GKK C;  2D1T A;  3NPD A;  4JV5 C;  2UUC C;  4JI0 C;  4DUZ C;  5K85 A;  4ZLP A;  3OTO C;  2ASB A;  2QW0 X;  3VNQ A;  3CQ3 A;  1QWI A;  1PG4 A;  3NI2 A;  4G37 A;  3FM7 A;  3IEV A;  4LFA C;  1UWD A;  5JRH A;  4DV3 C;  1M6X A;  5FLX D;  1I94 C;  2KDN A;  4DR7 C;  2KZF A;  4PUH A;  2E5L C;  1M6X C;  1ZB8 A;  4ISB A;  3J7A D;  4B3M C;  1IBM C;  5BSV A;  2HJG A;  1N32 C;  2KZ0 A;  3UOW A;  2UUB C;  3GKU A;  2BJO A;  2UXB C;  1T5H X;  3PRO C;  5KYV A;  3H2T A;  4RM2 A;  3NYR A;  4WS9 A;  4DR4 C;  5T8S A;  4EAT A;  5AE3 A;  3R9W A;  1JOS A;  3B7W A;  4JI1 C;  4LF6 C;  2MMA B;  4DR1 C;  2CU6 A;  3IML A;  4R1L A;  1ZB9 A;  1USP A;  5LMU C;  3TUF A;  1IBK C;  4OX9 C;  1QM4 A;  4HPV A;  2PRO A;  2VQF C;  3T1H C;  3DHV A;  2P2F A;  1YGT A;  3ETC A;  4LF4 C;  1T5D X;  1FJG C;  3R44 A;  3CW8 X;  4JI2 C;  4R1M A;  4DV6 C;  5BUS A;  4X62 C;  3I07 A;  2D1R A;  2MCQ A;  5GTD A;  5DV9 A;  2D27 A;  1USP B;  1UKK A;  5BSW A;  4TPS B;  1XMO C;  2Y4O A;  2HHH C;  4U5Y D;  5H9U A;  3J81 D;  4X66 C;  4LFC C;  5A2Q D;  2P2J A;  4I9G A;  5BST A;  1NY8 A;  3GR1 A;  3L95 X;  4K0B A;  4D4I A;  4DCU A;  4DG9 A;  1FUG A;  4DR2 C;  5CZX A;  3CJE A;  4JI8 C;  3PBK A;  4DV1 C;  4DV4 C;  4YHH C;  4G1I A;  4GXR A;  3IPL A;  4RLQ A;  2DYJ A;  1PA4 A;  2P2M A;  1V25 A;  3TR3 A;  2DPL A;  1TH5 A;  2ZZN A;  2QL8 A;  3E7X A;  2E8E A;  5IFI A;  2P2B A;  3EER A;  1RG9 A;  4LF9 C;  4MH4 A;  3LGX A;  5IT9 D;  3KXW A;  3A9U A;  5ADZ A;  2QVZ X;  4PHT A;  1YJ7 A;  2EGT A;  1PU1 A;  5AE2 A;  1MXA A;  5A1I A;  1MD9 A;  3LNO A;  2AYA A;  2P20 A;  4DV7 C;  4I9F A;  3FCC A;  1MDF A;  5A19 A;  1XNQ C;  3TDE A;  1HNW C;  4NDN A;  4DV2 C;  1HNZ C;  1O93 A;  4PUG A;  3CQ2 A;  4DUY C;  5K8F A;  4XX2 A;  4RMN A;  3T1Y C;  4DCV A;  4WV3 A;  1IBL C;  4L4Q A;  1XS3 A;  1HH2 P;  3CW9 A;  1HR0 C;  2BH1 X;  3PES A;  2OPL B;  1MXB A;  4RVO A;  1GPM A;  1RY2 A;  4RM3 A;  5T8T A;  4DG8 A;  2PT7 G;  2NCL A;  5CZV A;  3O2E A;  3L8C A;  1WH9 A;  3UX2 A;  2ONF A;  1WCJ A;  4LF8 C;  1EGA A;  2E0G A;  2MM9 A;  4JI6 C;  2YX1 A;  5E7Q A;  4RVN A;  1FLO A;  3NYQ A;  4BC7 A;  2P02 A;  2M5H A;  4RLF A;  2JMP A;  1PG3 A;  5AE1 A;  1XNR C;  3A9V A;  5KYT A;  2UUA C;  4JI5 C;  2OO4 A;  4PRO C;  3VNR A;  1N2F A;  3DAY A;  3JAM D;  1MKY A;  1KKG A;  2D1S A;  1K0R A;  2YWB A;  3K6R A;  3ETO A;  4BBY A;  4GKJ C;  4DCS A;  1AMU A;  2VZE A;  4LE5 A;  1XHJ A;  5LCI A;  2Y27 A;  1O9T A;  1VLA A;  2D7V A;  2Z51 A;  4K0K C;  1MDB A;  1NYE A;  3UEB A;  1XMQ C;  5BUR A;  2VQE C;  1V60 A;  2ZM6 C;  2F4V C;  2YCB A;  1VEH A;  4GXQ A;  3N54 B;  2ZZM A;  4D56 A;  5BR8 C; 
#chains in the Genus database with same CATH homology
 4LF7 C;  3R9X A;  4YY3 C;  3RV2 A;  4FUQ A;  2OPL A;  3LAX A;  2XR1 A;  1L2F A;  3C5E A;  4NXN C;  5LMN C;  4B3T C;  4DV0 C;  2E8C A;  2UXD C;  3G7S A;  3A4I A;  4IR7 A;  4D57 A;  1O90 A;  1V26 A;  2QVX X;  4FUT A;  4DR3 C;  3EQ6 A;  4KTT A;  1ULT A;  4JM1 A;  3J80 D;  4DR5 C;  1HNX C;  1XRB A;  4ZJZ A;  3DLP X;  2UU9 C;  3N2Q A;  4DR6 C;  4X65 C;  1LQL A;  2WP0 C;  4IZ6 A;  4R0M A;  3GR0 A;  4OXI A;  1XRA A;  4X64 C;  3AF6 A;  3FCE A;  4PZP A;  4JI4 C;  4JI7 C;  4L2Z A;  5IWA C;  3S82 A;  4BC9 A;  4NOZ A;  2VSQ A;  1MXC A;  4DV5 C;  3AF5 A;  4KHP C;  3VNS A;  4D4G A;  2WD9 A;  3LNV A;  4G36 A;  4ODJ A;  1BA3 A;  2UXC C;  2OBV A;  5BSM A;  2YWC A;  1ML8 A;  2V7B A;  4KTV A;  3RG2 A;  4JI3 C;  2Y4N A;  1LCI A;  3E7W A;  2CY1 A;  1N36 C;  5BSU A;  4LFB C;  1WF3 A;  3IEU A;  5A1G A;  1N34 C;  4BCA A;  4DCT A;  1J5E C;  4JYA C;  5BSR A;  2E7G A;  2P2Q A;  4NXM C;  4B3R C;  4LF5 C;  2D1Q A;  1XRC A;  4GS5 A;  4MTN A;  4FTF A;  3GPC A;  2D28 C;  2ATW A;  3TQI A;  4L7I A;  4B3S C;  3LUS A;  5BUQ A;  1N33 C;  3UZ0 A;  2QVY X;  2CXC A;  2E8F A;  2PN2 A;  3I08 A;  1O92 A;  5KEI A;  4OYC A;  1P7L A;  3SO4 A;  4BSZ A;  4AQY C;  4GKK C;  2D1T A;  3NPD A;  4JV5 C;  2UUC C;  4JI0 C;  4DUZ C;  5K85 A;  4ZLP A;  3OTO C;  2ASB A;  2QW0 X;  3VNQ A;  1QWI A;  1PG4 A;  3NI2 A;  4G37 A;  3IEV A;  4LFA C;  5JRH A;  4DV3 C;  5FLX D;  1I94 C;  4DR7 C;  2KZF A;  2E5L C;  1ZB8 A;  4ISB A;  3J7A D;  4B3M C;  1IBM C;  5BSV A;  2HJG A;  1N32 C;  3UOW A;  2UUB C;  3GKU A;  2BJO A;  2UXB C;  1T5H X;  3PRO C;  5KYV A;  3H2T A;  4RM2 A;  3NYR A;  4WS9 A;  4DR4 C;  5T8S A;  4EAT A;  5AE3 A;  3R9W A;  1JOS A;  3B7W A;  4JI1 C;  4LF6 C;  4DR1 C;  3IML A;  4R1L A;  1ZB9 A;  1USP A;  5LMU C;  3TUF A;  1IBK C;  4OX9 C;  1QM4 A;  4HPV A;  2PRO A;  2VQF C;  3T1H C;  3DHV A;  2P2F A;  3ETC A;  4LF4 C;  1T5D X;  1FJG C;  3R44 A;  3CW8 X;  4JI2 C;  4R1M A;  4DV6 C;  5BUS A;  4X62 C;  3I07 A;  2D1R A;  5GTD A;  5DV9 A;  2D27 A;  1USP B;  1UKK A;  5BSW A;  4TPS B;  1XMO C;  2Y4O A;  2HHH C;  4U5Y D;  5H9U A;  3J81 D;  4X66 C;  4LFC C;  5A2Q D;  2P2J A;  4I9G A;  5BST A;  3GR1 A;  3L95 X;  4K0B A;  4D4I A;  4DCU A;  4DG9 A;  1FUG A;  4DR2 C;  5CZX A;  3CJE A;  4JI8 C;  3PBK A;  4DV1 C;  4DV4 C;  4YHH C;  4G1I A;  4GXR A;  3IPL A;  4RLQ A;  2DYJ A;  1PA4 A;  2P2M A;  1V25 A;  2DPL A;  2QL8 A;  3E7X A;  2E8E A;  5IFI A;  2P2B A;  3EER A;  1RG9 A;  4LF9 C;  4MH4 A;  3LGX A;  5IT9 D;  3KXW A;  3A9U A;  5ADZ A;  2QVZ X;  4PHT A;  1YJ7 A;  2EGT A;  5AE2 A;  1MXA A;  5A1I A;  1MD9 A;  2AYA A;  2P20 A;  4DV7 C;  4I9F A;  3FCC A;  1MDF A;  5A19 A;  1XNQ C;  3TDE A;  1HNW C;  4NDN A;  4DV2 C;  1HNZ C;  1O93 A;  4DUY C;  5K8F A;  4XX2 A;  4RMN A;  3T1Y C;  4DCV A;  4WV3 A;  1IBL C;  4L4Q A;  1HH2 P;  3CW9 A;  1HR0 C;  2BH1 X;  3PES A;  2OPL B;  1MXB A;  4RVO A;  1GPM A;  1RY2 A;  4RM3 A;  5T8T A;  4DG8 A;  2PT7 G;  5CZV A;  3L8C A;  1WH9 A;  2ONF A;  4LF8 C;  1EGA A;  2E0G A;  4JI6 C;  5E7Q A;  4RVN A;  3NYQ A;  4BC7 A;  2P02 A;  4RLF A;  2JMP A;  1PG3 A;  5AE1 A;  1XNR C;  3A9V A;  5KYT A;  2UUA C;  4JI5 C;  2OO4 A;  4PRO C;  3VNR A;  1N2F A;  3DAY A;  3JAM D;  1MKY A;  1KKG A;  2D1S A;  1K0R A;  2YWB A;  4BBY A;  3ETO A;  4GKJ C;  4DCS A;  1AMU A;  2VZE A;  4LE5 A;  2Y27 A;  1O9T A;  1VLA A;  2D7V A;  4K0K C;  1MDB A;  1NYE A;  1XMQ C;  5BUR A;  2VQE C;  2ZM6 C;  2F4V C;  2YCB A;  4GXQ A;  3N54 B;  4D56 A;  5BR8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...