4JI7C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 53
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji7C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji7C02
4JI4C 4DR6C 2UXBC 1L2FA 5IT9D 2PN2A 1K0RA 4LF8C 1USPB 2UUBC 2ONFA 1KKGA 1J5EC 3J80D 1PA4A 4DV3C 3T1YC 1XMQC 1IBKC 4JI8C 2E7GA 3JAMD 4DV1C 1HH2P 2QL8A 4KHPC 2HJGA 5LMNC 1HNXC 4LF4C 1HR0C 4JI7C 4DR3C 3OTOC 2E5LC 2E8EA 1N33C 4DUYC 4JI0C 1XNRC 4LFBC 4DR5C 1LQLA 4DR7C 1EGAA 4NXMC 4K0KC 4LF6C 4GKKC 3AF6A 4B3RC 3EERA 1JOSA 4JI6C 1IBLC 5A2QD 4JI1C 2CY1A 4NOZA 1N2FA 4DUZC 4B3MC 3IEUA 4MH4A 4DV6C 1N36C 4YHHC 2EGTA 4X66C 4DCVA 4DR1C 1I94C 4X64C 2E8CA 1ML8A 4DV2C 1QWIA 1VLAA 3J81D 5FLXD 1MKYA 2BJOA 4DV0C 4JI2C 2VQEC 1FJGC 5IWAC 1IBMC 4OX9C 1NYEA 2YCBA 1HNWC 4BSZA 3R9XA 4X62C 3GKUA 2UU9C 4X65C 4DV4C 4AQYC 2ATWA 4DCTA 4LF9C 2UUCC 1N34C 4JYAC 1ZB9A 2E8FA 5LMUC 4JI5C 4LF5C 1XMOC 2OPLA 1UKKA 4B3TC 4JI3C 2KZFA 2VQFC 4NXNC 3R9WA 1XNQC 3AF5A 4B3SC 4GKJC 2HHHC 4DR2C 4JV5C 4YY3C 2DYJA 2UXDC 2UXCC 3T1HC 3CJEA 1ZB8A 4DR4C 4XX2A 4DV5C 2ASBA 2OPLB 1HNZC 4DV7C 1WH9A 4DCSA 4DCUA 3IEVA 1WF3A 2CXCA 2PT7G 4LF7C 4LFAC 1USPA 4MTNA 2UUAC 3LUSA 2ZM6C 2JMPA 3I07A 2D7VA 2XR1A 1N32C 3J7AD 2F4VC 5BR8C 4LFCC
chains in the Genus database with same CATH superfamily
4OYCA 2UXBC 5DV9A 3ETOA 4FUQA 1XRCA 2UUBC 2D1RA 4FUTA 2VZEA 1J5EC 1PA4A 2JNVA 3T1YC 1XMQC 4JI8C 2E7GA 3JAMD 3B7WA 4DV1C 4GS5A 2HJGA 1XRBA 3A26A 4L4QA 4DR3C 5BUQA 5JRHA 5KEIA 2VSQA 5E7QA 4PROC 4LFBC 4BC9A 1MD9A 3L95X 4WS9A 4RVOA 4U5YD 3C5EA 1FUGA 3R44A 5A19A 4DV6C 3AY0A 4X66C 1T5DX 2P2QA 3NYQA 4X64C 1AMUA 1VLAA 4ZJZA 3J81D 5FLXD 1MKYA 2BJOA 2M5HA 2P2FA 1RY2A 2D27A 2QVZX 4OX9C 2YCBA 1LCIA 4X62C 5AE2A 4DV4C 5A1GA 4AQYC 1N34C 3RG2A 5LMUC 3LAXA 1XMOC 3CW9A 1V60A 3EQ6A 1UKKA 3O2EA 4B3TC 4NXNC 4R0MA 4GKJC 5LCIA 1O93A 4YY3C 2DYJA 3CQ1A 3GR0A 4XX2A 4D4GA 2ASBA 4PHTA 3IEVA 2MM9A 2YX1A 5H9UA 2PT7G 3K6RA 2D1SA 4LF7C 2Y27A 1MDBA 2UUAC 1P4EA 2JMPA 4LE5A 2D7VA 2F4VC 1XS3A 3VNQA 4DR6C 1YGTA 1L2FA 3G7SA 5IT9D 3I08A 2PN2A 4R1LA 4LF8C 2KZ0A 5BSVA 4KTVA 3LGXA 4HPVA 4DV3C 2ZTBA 1O90A 1HH2P 5LMNC 4BBYA 1HNXC 1O92A 5AE1A 1HR0C 4JI7C 1MXAA 2M5OA 2E8EA 2Z51A 2QW0X 3NYRA 5T8SA 4RM3A 2P2MA 1BA3A 3IMLA 3RV2A 4I9FA 2PROA 3IPLA 4JI6C 2CY1A 4NOZA 1N2FA 4OXIA 4B3MC 4L2ZA 5CZXA 1PG4A 2V7BA 1ML8A 1MXBA 3NPDA 3TQIA 4DV0C 2VQEC 1T5HX 2KDNA 5IWAC 4FTFA 1HNWC 2WD9A 4ZLPA 2UU9C 1PU1A 1UWDA 1ULTA 1P4EC 2ATWA 2UUCC 1ZB9A 4ODJA 2E8FA 4JI5C 4LF5C 2OPLA 2YWCA 1YJ7A 4JI3C 3R9WA 1XNQC 4B3SC 3UX2A 2HHHC 5BSRA 5ADZA 5CZVA 5BSUA 1M6XA 3T1HC 4DV5C 2OPLB 1HNZC 4RM2A 2CXCA 2OBVA 3LUSA 3S82A 3I07A 2AYAA 4LFCC 4G37A 4EATA 4G1IA 3SO4A 2ONFA 4PUGA 5T8TA 1KKGA 3FM7A 1NY8A 5BURA 3J80D 4RVNA 5K8FA 2YWBA 1IBKC 2QL8A 4KHPC 2Y4OA 2MCQA 3GPCA 3TUFA 3OTOC 2D1TA 1N33C 4JI0C 3CW8X 3DLPX 4PUIA 1QM4A 3UEBA 1LQLA 1EGAA 4K0KC 2MMAB 4B3RC 3EERA 1JOSA 1IBLC 2P02A 2DPLA 5A2QD 4GXRA 4JI1C 4DUZC 3IEUA 4RMNA 4MH4A 1N36C 4YHHC 4DCVA 1V25A 1I94C 2OO4A 2DHMA 2E8CA 2P2BA 4R1MA 1QWIA 3GR1A 1M6XC 3LNVA 5AE3A 3CQ3A 1WCJA 2Y4NA 2QVYX 1IBMC 5K85A 3R9XA 4X65C 3FCEA 1PG3A 4DCTA 3LNOA 2WP0C 4JYAC 3DHVA 1VEHA 3UX3A 3NI2A 4NDNA 3UZ0A 3PESA 4D56A 3A4IA 4K0BA 3AF5A 2ZZMA 2PG1E 2BH1X 5BSTA 5KYVA 4IR7A 2E0GA 5GTDA 1ZB8A 1IB8A 4D57A 3TR3A 4DV7C 1WH9A 4DCUA 2D28C 3PROC 4IZ6A 1V26A 4LFAC 1MDFA 1USPA 2NCLA 2ZM6C 4G36A 2XR1A 3J7AD 3TDEA 5BR8C 3VNSA 4JI4C 4BCAA 1K0RA 4JM1A 1RG9A 1USPB 4GXQA 3CQ2A 3DAYA 5KYTA 4LF4C 1XDXA 1P7LA 3A25A 1O9TA 3ETCA 5IFIA 2E5LC 3N2QA 4DUYC 5A1IA 1XNRC 4DR5C 4DR7C 4NXMC 3A9VA 1GPMA 4LF6C 3KXWA 2QVXX 4GKKC 3AF6A 4TPSB 4BC7A 4I9GA 5BSMA 5BSWA 2D1QA 2EGTA 4DR1C 3E7XA 4PZPA 1XHJA 3L8CA 4DV2C 4DG8A 3N54B 4PUHA 4JI2C 3VNRA 1FJGC 3H2TA 1NYEA 3A9UA 4BSZA 3GKUA 2ZZNA 4LF9C 4ISBA 4L7IA 4D4IA 2VQFC 2KZFA 4RLQA 4DR2C 4WV3A 1TH5A 4JV5C 2UXDC 2UXCC 2P2JA 3FCCA 3CJEA 4DR4C 5BUSA 3E7WA 4KTTA 1FLOA 4DCSA 1WF3A 2CU6A 2P20A 3UOWA 4MTNA 1MXCA 4RLFA 3PBKA 1XRAA 4DG9A 1N32C
chains in the Genus database with same CATH topology
4OYCA 2UXBC 5DV9A 3ETOA 4FUQA 1XRCA 2UUBC 2D1RA 4FUTA 2VZEA 1J5EC 1PA4A 3T1YC 1XMQC 4JI8C 2E7GA 3JAMD 3B7WA 4DV1C 4GS5A 2HJGA 1XRBA 4L4QA 4DR3C 5BUQA 5JRHA 5KEIA 2VSQA 5E7QA 4PROC 4LFBC 4BC9A 1MD9A 3L95X 4WS9A 4RVOA 4U5YD 3C5EA 1FUGA 3R44A 5A19A 4DV6C 4X66C 1T5DX 2P2QA 3NYQA 4X64C 1AMUA 1VLAA 4ZJZA 3J81D 5FLXD 1MKYA 2BJOA 2P2FA 1RY2A 2D27A 2QVZX 4OX9C 2YCBA 1LCIA 4X62C 5AE2A 4DV4C 5A1GA 4AQYC 1N34C 3RG2A 5LMUC 3LAXA 1XMOC 3CW9A 3EQ6A 1UKKA 4B3TC 4NXNC 4R0MA 4GKJC 1O93A 4YY3C 2DYJA 3GR0A 4XX2A 4D4GA 2ASBA 4PHTA 3IEVA 5H9UA 2PT7G 2D1SA 4LF7C 2Y27A 1MDBA 2UUAC 2JMPA 4LE5A 2D7VA 2F4VC 3VNQA 4DR6C 1L2FA 3G7SA 5IT9D 3I08A 2PN2A 4R1LA 4LF8C 5BSVA 4KTVA 3LGXA 4HPVA 4DV3C 1O90A 1HH2P 5LMNC 4BBYA 1HNXC 1O92A 5AE1A 1HR0C 4JI7C 1MXAA 2E8EA 2QW0X 3NYRA 5T8SA 4RM3A 2P2MA 1BA3A 3IMLA 3RV2A 4I9FA 2PROA 3IPLA 4JI6C 2CY1A 4NOZA 1N2FA 4OXIA 4B3MC 4L2ZA 5CZXA 1PG4A 2V7BA 1ML8A 1MXBA 3NPDA 3TQIA 4DV0C 2VQEC 1T5HX 5IWAC 4FTFA 1HNWC 2WD9A 4ZLPA 2UU9C 1ULTA 2ATWA 2UUCC 1ZB9A 4ODJA 2E8FA 4JI5C 4LF5C 2OPLA 2YWCA 1YJ7A 4JI3C 3R9WA 1XNQC 4B3SC 2HHHC 5BSRA 5ADZA 5CZVA 5BSUA 3T1HC 4DV5C 2OPLB 1HNZC 4RM2A 2CXCA 2OBVA 3LUSA 3S82A 3I07A 2AYAA 4LFCC 4G37A 4EATA 4G1IA 3SO4A 2ONFA 5T8TA 1KKGA 5BURA 3J80D 4RVNA 5K8FA 2YWBA 1IBKC 2QL8A 4KHPC 2Y4OA 3GPCA 3TUFA 3OTOC 2D1TA 1N33C 4JI0C 3CW8X 3DLPX 1QM4A 1LQLA 1EGAA 4K0KC 4B3RC 3EERA 1JOSA 1IBLC 2P02A 2DPLA 5A2QD 4GXRA 4JI1C 4DUZC 3IEUA 4RMNA 4MH4A 1N36C 4YHHC 4DCVA 1V25A 1I94C 2OO4A 2E8CA 2P2BA 4R1MA 1QWIA 3GR1A 3LNVA 5AE3A 2Y4NA 2QVYX 1IBMC 5K85A 3R9XA 4X65C 3FCEA 1PG3A 4DCTA 2WP0C 4JYAC 3DHVA 3NI2A 4NDNA 3UZ0A 3PESA 4D56A 3A4IA 4K0BA 3AF5A 2BH1X 5BSTA 5KYVA 4IR7A 2E0GA 5GTDA 1ZB8A 4D57A 4DV7C 1WH9A 4DCUA 2D28C 3PROC 4IZ6A 1V26A 4LFAC 1MDFA 1USPA 2ZM6C 4G36A 2XR1A 3J7AD 3TDEA 5BR8C 3VNSA 4JI4C 4BCAA 1K0RA 4JM1A 1RG9A 1USPB 4GXQA 3DAYA 5KYTA 4LF4C 1P7LA 1O9TA 3ETCA 5IFIA 2E5LC 3N2QA 4DUYC 5A1IA 1XNRC 4DR5C 4DR7C 4NXMC 3A9VA 1GPMA 4LF6C 3KXWA 2QVXX 4GKKC 3AF6A 4TPSB 4BC7A 4I9GA 5BSMA 5BSWA 2D1QA 2EGTA 4DR1C 3E7XA 4PZPA 3L8CA 4DV2C 4DG8A 3N54B 4JI2C 3VNRA 1FJGC 3H2TA 1NYEA 3A9UA 4BSZA 3GKUA 4LF9C 4ISBA 4L7IA 4D4IA 2VQFC 2KZFA 4RLQA 4DR2C 4WV3A 4JV5C 2UXDC 2UXCC 2P2JA 3FCCA 3CJEA 4DR4C 5BUSA 3E7WA 4KTTA 4DCSA 1WF3A 2P20A 3UOWA 4MTNA 1MXCA 4RLFA 3PBKA 1XRAA 4DG9A 1N32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 C;  4DR6 C;  2UXB C;  1L2F A;  5IT9 D;  2PN2 A;  1K0R A;  4LF8 C;  1USP B;  2UUB C;  2ONF A;  1KKG A;  1J5E C;  3J80 D;  1PA4 A;  4DV3 C;  3T1Y C;  1XMQ C;  1IBK C;  4JI8 C;  2E7G A;  3JAM D;  4DV1 C;  1HH2 P;  2QL8 A;  4KHP C;  2HJG A;  5LMN C;  1HNX C;  4LF4 C;  1HR0 C;  4JI7 C;  4DR3 C;  3OTO C;  2E5L C;  2E8E A;  1N33 C;  4DUY C;  4JI0 C;  1XNR C;  4LFB C;  4DR5 C;  1LQL A;  4DR7 C;  1EGA A;  4NXM C;  4K0K C;  4LF6 C;  4GKK C;  3AF6 A;  4B3R C;  3EER A;  1JOS A;  4JI6 C;  1IBL C;  5A2Q D;  4JI1 C;  2CY1 A;  4NOZ A;  1N2F A;  4DUZ C;  4B3M C;  3IEU A;  4MH4 A;  4DV6 C;  1N36 C;  4YHH C;  2EGT A;  4X66 C;  4DCV A;  4DR1 C;  1I94 C;  4X64 C;  2E8C A;  1ML8 A;  4DV2 C;  1QWI A;  1VLA A;  3J81 D;  5FLX D;  1MKY A;  2BJO A;  4DV0 C;  4JI2 C;  2VQE C;  1FJG C;  5IWA C;  1IBM C;  4OX9 C;  1NYE A;  2YCB A;  1HNW C;  4BSZ A;  3R9X A;  4X62 C;  3GKU A;  2UU9 C;  4X65 C;  4DV4 C;  4AQY C;  2ATW A;  4DCT A;  4LF9 C;  2UUC C;  1N34 C;  4JYA C;  1ZB9 A;  2E8F A;  5LMU C;  4JI5 C;  4LF5 C;  1XMO C;  2OPL A;  1UKK A;  4B3T C;  4JI3 C;  2KZF A;  2VQF C;  4NXN C;  3R9W A;  1XNQ C;  3AF5 A;  4B3S C;  4GKJ C;  2HHH C;  4DR2 C;  4JV5 C;  4YY3 C;  2DYJ A;  2UXD C;  2UXC C;  3T1H C;  3CJE A;  1ZB8 A;  4DR4 C;  4XX2 A;  4DV5 C;  2ASB A;  2OPL B;  1HNZ C;  4DV7 C;  1WH9 A;  4DCS A;  4DCU A;  3IEV A;  1WF3 A;  2CXC A;  2PT7 G;  4LF7 C;  4LFA C;  1USP A;  4MTN A;  2UUA C;  3LUS A;  2ZM6 C;  2JMP A;  3I07 A;  2D7V A;  2XR1 A;  1N32 C;  3J7A D;  2F4V C;  5BR8 C;  4LFC C; 
#chains in the Genus database with same CATH topology
 4OYC A;  2UXB C;  5DV9 A;  3ETO A;  4FUQ A;  1XRC A;  2UUB C;  2D1R A;  4FUT A;  2VZE A;  1J5E C;  1PA4 A;  2JNV A;  3T1Y C;  1XMQ C;  4JI8 C;  2E7G A;  3JAM D;  3B7W A;  4DV1 C;  4GS5 A;  2HJG A;  1XRB A;  3A26 A;  4L4Q A;  4DR3 C;  5BUQ A;  5JRH A;  5KEI A;  2VSQ A;  5E7Q A;  4PRO C;  4LFB C;  4BC9 A;  1MD9 A;  3L95 X;  4WS9 A;  4RVO A;  4U5Y D;  3C5E A;  1FUG A;  3R44 A;  5A19 A;  4DV6 C;  3AY0 A;  4X66 C;  1T5D X;  2P2Q A;  3NYQ A;  4X64 C;  1AMU A;  1VLA A;  4ZJZ A;  3J81 D;  5FLX D;  1MKY A;  2BJO A;  2M5H A;  2P2F A;  1RY2 A;  2D27 A;  2QVZ X;  4OX9 C;  2YCB A;  1LCI A;  4X62 C;  5AE2 A;  4DV4 C;  5A1G A;  4AQY C;  1N34 C;  3RG2 A;  5LMU C;  3LAX A;  1XMO C;  3CW9 A;  1V60 A;  3EQ6 A;  1UKK A;  3O2E A;  4B3T C;  4NXN C;  4R0M A;  4GKJ C;  5LCI A;  1O93 A;  4YY3 C;  2DYJ A;  3CQ1 A;  3GR0 A;  4XX2 A;  4D4G A;  2ASB A;  4PHT A;  3IEV A;  2MM9 A;  2YX1 A;  5H9U A;  2PT7 G;  3K6R A;  2D1S A;  4LF7 C;  2Y27 A;  1MDB A;  2UUA C;  1P4E A;  2JMP A;  4LE5 A;  2D7V A;  2F4V C;  1XS3 A;  3VNQ A;  4DR6 C;  1YGT A;  1L2F A;  3G7S A;  5IT9 D;  3I08 A;  2PN2 A;  4R1L A;  4LF8 C;  2KZ0 A;  5BSV A;  4KTV A;  3LGX A;  4HPV A;  4DV3 C;  2ZTB A;  1O90 A;  1HH2 P;  5LMN C;  4BBY A;  1HNX C;  1O92 A;  5AE1 A;  1HR0 C;  4JI7 C;  1MXA A;  2M5O A;  2E8E A;  2Z51 A;  2QW0 X;  3NYR A;  5T8S A;  4RM3 A;  2P2M A;  1BA3 A;  3IML A;  3RV2 A;  4I9F A;  2PRO A;  3IPL A;  4JI6 C;  2CY1 A;  4NOZ A;  1N2F A;  4OXI A;  4B3M C;  4L2Z A;  5CZX A;  1PG4 A;  2V7B A;  1ML8 A;  1MXB A;  3NPD A;  3TQI A;  4DV0 C;  2VQE C;  1T5H X;  2KDN A;  5IWA C;  4FTF A;  1HNW C;  2WD9 A;  4ZLP A;  2UU9 C;  1PU1 A;  1UWD A;  1ULT A;  1P4E C;  2ATW A;  2UUC C;  1ZB9 A;  4ODJ A;  2E8F A;  4JI5 C;  4LF5 C;  2OPL A;  2YWC A;  1YJ7 A;  4JI3 C;  3R9W A;  1XNQ C;  4B3S C;  3UX2 A;  2HHH C;  5BSR A;  5ADZ A;  5CZV A;  5BSU A;  1M6X A;  3T1H C;  4DV5 C;  2OPL B;  1HNZ C;  4RM2 A;  2CXC A;  2OBV A;  3LUS A;  3S82 A;  3I07 A;  2AYA A;  4LFC C;  4G37 A;  4EAT A;  4G1I A;  3SO4 A;  2ONF A;  4PUG A;  5T8T A;  1KKG A;  3FM7 A;  1NY8 A;  5BUR A;  3J80 D;  4RVN A;  5K8F A;  2YWB A;  1IBK C;  2QL8 A;  4KHP C;  2Y4O A;  2MCQ A;  3GPC A;  3TUF A;  3OTO C;  2D1T A;  1N33 C;  4JI0 C;  3CW8 X;  3DLP X;  4PUI A;  1QM4 A;  3UEB A;  1LQL A;  1EGA A;  4K0K C;  2MMA B;  4B3R C;  3EER A;  1JOS A;  1IBL C;  2P02 A;  2DPL A;  5A2Q D;  4GXR A;  4JI1 C;  4DUZ C;  3IEU A;  4RMN A;  4MH4 A;  1N36 C;  4YHH C;  4DCV A;  1V25 A;  1I94 C;  2OO4 A;  2DHM A;  2E8C A;  2P2B A;  4R1M A;  1QWI A;  3GR1 A;  1M6X C;  3LNV A;  5AE3 A;  3CQ3 A;  1WCJ A;  2Y4N A;  2QVY X;  1IBM C;  5K85 A;  3R9X A;  4X65 C;  3FCE A;  1PG3 A;  4DCT A;  3LNO A;  2WP0 C;  4JYA C;  3DHV A;  1VEH A;  3UX3 A;  3NI2 A;  4NDN A;  3UZ0 A;  3PES A;  4D56 A;  3A4I A;  4K0B A;  3AF5 A;  2ZZM A;  2PG1 E;  2BH1 X;  5BST A;  5KYV A;  4IR7 A;  2E0G A;  5GTD A;  1ZB8 A;  1IB8 A;  4D57 A;  3TR3 A;  4DV7 C;  1WH9 A;  4DCU A;  2D28 C;  3PRO C;  4IZ6 A;  1V26 A;  4LFA C;  1MDF A;  1USP A;  2NCL A;  2ZM6 C;  4G36 A;  2XR1 A;  3J7A D;  3TDE A;  5BR8 C;  3VNS A;  4JI4 C;  4BCA A;  1K0R A;  4JM1 A;  1RG9 A;  1USP B;  4GXQ A;  3CQ2 A;  3DAY A;  5KYT A;  4LF4 C;  1XDX A;  1P7L A;  3A25 A;  1O9T A;  3ETC A;  5IFI A;  2E5L C;  3N2Q A;  4DUY C;  5A1I A;  1XNR C;  4DR5 C;  4DR7 C;  4NXM C;  3A9V A;  1GPM A;  4LF6 C;  3KXW A;  2QVX X;  4GKK C;  3AF6 A;  4TPS B;  4BC7 A;  4I9G A;  5BSM A;  5BSW A;  2D1Q A;  2EGT A;  4DR1 C;  3E7X A;  4PZP A;  1XHJ A;  3L8C A;  4DV2 C;  4DG8 A;  3N54 B;  4PUH A;  4JI2 C;  3VNR A;  1FJG C;  3H2T A;  1NYE A;  3A9U A;  4BSZ A;  3GKU A;  2ZZN A;  4LF9 C;  4ISB A;  4L7I A;  4D4I A;  2VQF C;  2KZF A;  4RLQ A;  4DR2 C;  4WV3 A;  1TH5 A;  4JV5 C;  2UXD C;  2UXC C;  2P2J A;  3FCC A;  3CJE A;  4DR4 C;  5BUS A;  3E7W A;  4KTT A;  1FLO A;  4DCS A;  1WF3 A;  2CU6 A;  2P20 A;  3UOW A;  4MTN A;  1MXC A;  4RLF A;  3PBK A;  1XRA A;  4DG9 A;  1N32 C; 
#chains in the Genus database with same CATH homology
 4OYC A;  2UXB C;  5DV9 A;  3ETO A;  4FUQ A;  1XRC A;  2UUB C;  2D1R A;  4FUT A;  2VZE A;  1J5E C;  1PA4 A;  3T1Y C;  1XMQ C;  4JI8 C;  2E7G A;  3JAM D;  3B7W A;  4DV1 C;  4GS5 A;  2HJG A;  1XRB A;  4L4Q A;  4DR3 C;  5BUQ A;  5JRH A;  5KEI A;  2VSQ A;  5E7Q A;  4PRO C;  4LFB C;  4BC9 A;  1MD9 A;  3L95 X;  4WS9 A;  4RVO A;  4U5Y D;  3C5E A;  1FUG A;  3R44 A;  5A19 A;  4DV6 C;  4X66 C;  1T5D X;  2P2Q A;  3NYQ A;  4X64 C;  1AMU A;  1VLA A;  4ZJZ A;  3J81 D;  5FLX D;  1MKY A;  2BJO A;  2P2F A;  1RY2 A;  2D27 A;  2QVZ X;  4OX9 C;  2YCB A;  1LCI A;  4X62 C;  5AE2 A;  4DV4 C;  5A1G A;  4AQY C;  1N34 C;  3RG2 A;  5LMU C;  3LAX A;  1XMO C;  3CW9 A;  3EQ6 A;  1UKK A;  4B3T C;  4NXN C;  4R0M A;  4GKJ C;  1O93 A;  4YY3 C;  2DYJ A;  3GR0 A;  4XX2 A;  4D4G A;  2ASB A;  4PHT A;  3IEV A;  5H9U A;  2PT7 G;  2D1S A;  4LF7 C;  2Y27 A;  1MDB A;  2UUA C;  2JMP A;  4LE5 A;  2D7V A;  2F4V C;  3VNQ A;  4DR6 C;  1L2F A;  3G7S A;  5IT9 D;  3I08 A;  2PN2 A;  4R1L A;  4LF8 C;  5BSV A;  4KTV A;  3LGX A;  4HPV A;  4DV3 C;  1O90 A;  1HH2 P;  5LMN C;  4BBY A;  1HNX C;  1O92 A;  5AE1 A;  1HR0 C;  4JI7 C;  1MXA A;  2E8E A;  2QW0 X;  3NYR A;  5T8S A;  4RM3 A;  2P2M A;  1BA3 A;  3IML A;  3RV2 A;  4I9F A;  2PRO A;  3IPL A;  4JI6 C;  2CY1 A;  4NOZ A;  1N2F A;  4OXI A;  4B3M C;  4L2Z A;  5CZX A;  1PG4 A;  2V7B A;  1ML8 A;  1MXB A;  3NPD A;  3TQI A;  4DV0 C;  2VQE C;  1T5H X;  5IWA C;  4FTF A;  1HNW C;  2WD9 A;  4ZLP A;  2UU9 C;  1ULT A;  2ATW A;  2UUC C;  1ZB9 A;  4ODJ A;  2E8F A;  4JI5 C;  4LF5 C;  2OPL A;  2YWC A;  1YJ7 A;  4JI3 C;  3R9W A;  1XNQ C;  4B3S C;  2HHH C;  5BSR A;  5ADZ A;  5CZV A;  5BSU A;  3T1H C;  4DV5 C;  2OPL B;  1HNZ C;  4RM2 A;  2CXC A;  2OBV A;  3LUS A;  3S82 A;  3I07 A;  2AYA A;  4LFC C;  4G37 A;  4EAT A;  4G1I A;  3SO4 A;  2ONF A;  5T8T A;  1KKG A;  5BUR A;  3J80 D;  4RVN A;  5K8F A;  2YWB A;  1IBK C;  2QL8 A;  4KHP C;  2Y4O A;  3GPC A;  3TUF A;  3OTO C;  2D1T A;  1N33 C;  4JI0 C;  3CW8 X;  3DLP X;  1QM4 A;  1LQL A;  1EGA A;  4K0K C;  4B3R C;  3EER A;  1JOS A;  1IBL C;  2P02 A;  2DPL A;  5A2Q D;  4GXR A;  4JI1 C;  4DUZ C;  3IEU A;  4RMN A;  4MH4 A;  1N36 C;  4YHH C;  4DCV A;  1V25 A;  1I94 C;  2OO4 A;  2E8C A;  2P2B A;  4R1M A;  1QWI A;  3GR1 A;  3LNV A;  5AE3 A;  2Y4N A;  2QVY X;  1IBM C;  5K85 A;  3R9X A;  4X65 C;  3FCE A;  1PG3 A;  4DCT A;  2WP0 C;  4JYA C;  3DHV A;  3NI2 A;  4NDN A;  3UZ0 A;  3PES A;  4D56 A;  3A4I A;  4K0B A;  3AF5 A;  2BH1 X;  5BST A;  5KYV A;  4IR7 A;  2E0G A;  5GTD A;  1ZB8 A;  4D57 A;  4DV7 C;  1WH9 A;  4DCU A;  2D28 C;  3PRO C;  4IZ6 A;  1V26 A;  4LFA C;  1MDF A;  1USP A;  2ZM6 C;  4G36 A;  2XR1 A;  3J7A D;  3TDE A;  5BR8 C;  3VNS A;  4JI4 C;  4BCA A;  1K0R A;  4JM1 A;  1RG9 A;  1USP B;  4GXQ A;  3DAY A;  5KYT A;  4LF4 C;  1P7L A;  1O9T A;  3ETC A;  5IFI A;  2E5L C;  3N2Q A;  4DUY C;  5A1I A;  1XNR C;  4DR5 C;  4DR7 C;  4NXM C;  3A9V A;  1GPM A;  4LF6 C;  3KXW A;  2QVX X;  4GKK C;  3AF6 A;  4TPS B;  4BC7 A;  4I9G A;  5BSM A;  5BSW A;  2D1Q A;  2EGT A;  4DR1 C;  3E7X A;  4PZP A;  3L8C A;  4DV2 C;  4DG8 A;  3N54 B;  4JI2 C;  3VNR A;  1FJG C;  3H2T A;  1NYE A;  3A9U A;  4BSZ A;  3GKU A;  4LF9 C;  4ISB A;  4L7I A;  4D4I A;  2VQF C;  2KZF A;  4RLQ A;  4DR2 C;  4WV3 A;  4JV5 C;  2UXD C;  2UXC C;  2P2J A;  3FCC A;  3CJE A;  4DR4 C;  5BUS A;  3E7W A;  4KTT A;  4DCS A;  1WF3 A;  2P20 A;  3UOW A;  4MTN A;  1MXC A;  4RLF A;  3PBK A;  1XRA A;  4DG9 A;  1N32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...