1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
4JI6C 4DR3C 1N36C 1FJGC 4DV3C 1IBKC 4LF8C 3R9XA 2E8FA 1XNRC 4B3TC 1K0RA 1UKKA 1I94C 4X66C 2UXBC 5LMUC 4DV4C 1WF3A 2ONFA 2QL8A 2F4VC 1KKGA 2PN2A 2E7GA 4XX2A 3J81D 3AF5A 4DV6C 2E8CA 1ZB8A 2E8EA 4NOZA 1XMQC 3I07A 2HJGA 1HR0C 2JMPA 1N2FA 4B3MC 1L2FA 4JI1C 1N33C 1N32C 1N34C 4DV5C 4DR6C 1MKYA 1ZB9A 4YHHC 3J7AD 2UXDC 2PT7G 1LQLA 4JI4C 2ASBA 4DCVA 2VQFC 2ATWA 3GKUA 1EGAA 1NYEA 4LFCC 1JOSA 4JYAC 2YCBA 5A2QD 5BR8C 1HNWC 2ZM6C 4DR7C 2XR1A 3OTOC 2UUBC 3JAMD 4DV2C 4JI5C 4OX9C 5FLXD 4JI3C 4DV1C 3CJEA 2CXCA 2OPLB 4DUZC 3T1HC 1PA4A 5IT9D 4B3RC 3IEUA 4DR5C 4NXMC 4X62C 4JI0C 2HHHC 4X65C 4JI2C 2BJOA 2VQEC 1HH2P 4LF7C 4DR4C 4B3SC 4JI7C 4DCUA 4LFBC 2UUAC 1USPA 4DCSA 4KHPC 3T1YC 4LFAC 4DCTA 4LF4C 4DUYC 2UXCC 5LMNC 2UU9C 1HNZC 4GKJC 1IBMC 3LUSA 1USPB 3R9WA 4K0KC 1QWIA 1ML8A 2E5LC 4X64C 2CY1A 2DYJA 4DV0C 2KZFA 4GKKC 4MH4A 4DR1C 2D7VA 2EGTA 4DV7C 1WH9A 4JI8C 1XNQC 4JV5C 2OPLA 4LF9C 1VLAA 4MTNA 4BSZA 3IEVA 3J80D 4NXNC 1J5EC 4LF6C 2UUCC 4AQYC 3AF6A 1HNXC 1IBLC 5IWAC 4DR2C 1XMOC 4LF5C 3EERA 4YY3C
chains in the Genus database with same CATH superfamily
3A26A 3TDEA 2OO4A 5K85A 5AE1A 2YWCA 3AY0A 4PUGA 3LNOA 4X66C 5LMUC 5KYTA 1O9TA 2QL8A 4G36A 1PG3A 3CQ1A 4D4GA 2KZ0A 4DG9A 4EATA 4NOZA 4RLQA 1HR0C 2JMPA 3TQIA 3A9UA 3NYRA 1BA3A 3GKUA 1NYEA 2AYAA 3NPDA 5A2QD 1HNWC 3TUFA 2XR1A 3OTOC 1QM4A 3JAMD 4DV2C 3I08A 3L8CA 5FLXD 4KTVA 4JI3C 5CZVA 4PHTA 3CQ2A 2OBVA 1PA4A 5AE3A 5IT9D 4PZPA 4ZLPA 4B3RC 2CU6A 2PG1E 4X65C 3IPLA 2VQEC 1HH2P 5BSUA 4LF7C 4JI7C 4DCUA 4LFBC 2UUAC 1USPA 4RM2A 1MXAA 2UXCC 2UU9C 3B7WA 1IBMC 3LUSA 2P2QA 4GS5A 1LCIA 1FUGA 4KTTA 3IMLA 1ML8A 2E5LC 4X64C 2CY1A 4BCAA 2EGTA 3RG2A 4ISBA 4LF9C 4MTNA 3J80D 2Y4OA 3RV2A 2JNVA 3UEBA 2UUCC 5AE2A 4AQYC 1M6XA 3GR1A 4RVOA 2P2JA 4ZJZA 1M6XC 5KYVA 1N36C 5BSVA 1AMUA 5KEIA 2P2BA 1XNRC 3H2TA 3CW8X 3CW9A 4B3TC 1XRBA 1FLOA 4BC7A 1V26A 2F4VC 3S82A 4DG8A 2E7GA 4XX2A 3AF5A 4DV6C 4I9FA 2D27A 1ZB8A 2E8EA 1XMQC 4B3MC 1N32C 1N34C 4PROC 3LGXA 4DV5C 4YHHC 2UXDC 1IB8A 3FCEA 4PUHA 1LQLA 4HPVA 4JI4C 4D4IA 2ASBA 2BH1X 4DCVA 5E7QA 3KXWA 1EGAA 4G37A 1JOSA 3NI2A 4LFCC 2YCBA 5BR8C 4RLFA 2ZM6C 4BBYA 5A1GA 2Y27A 1VEHA 2CXCA 2OPLB 3O2EA 2D1SA 3T1HC 1O93A 3IEUA 3UX3A 4G1IA 4FTFA 1XRCA 2P2MA 5BUQA 3ETCA 5ADZA 4DCSA 4KHPC 3T1YC 4LFAC 4LF4C 1HNZC 3TR3A 2MM9A 3UX2A 3EQ6A 4RM3A 3FM7A 2D7VA 3A25A 5T8SA 1V25A 1WH9A 1XNQC 4R1MA 2D1QA 4OYCA 3E7WA 1RG9A 5BSWA 1WCJA 3LAXA 1XRAA 3C5EA 4NXNC 2QW0X 1P4EA 3N2QA 4DR2C 1XMOC 4LF5C 4YY3C 2ZZMA 4DR3C 1FJGC 4TPSB 5A1IA 2E8FA 1K0RA 1UKKA 4U5YD 1I94C 1XS3A 4GXRA 5CZXA 2UXBC 4L2ZA 1MDBA 1WF3A 1T5HX 2ZZNA 1YGTA 2PN2A 3J81D 4IR7A 2QVZX 2VSQA 5BSRA 3R9WA 2HJGA 1L2FA 4DR6C 1MKYA 4L7IA 1ZB9A 1PU1A 5LCIA 2YX1A 4ODJA 2YWBA 2WP0C 3DHVA 2DPLA 2VQFC 2Y4NA 4FUTA 2E0GA 3ETOA 1YJ7A 4K0BA 3VNSA 4DR7C 1RY2A 5BURA 4LE5A 4WV3A 2UUBC 1P7LA 4OX9C 5BSMA 4DV1C 3CJEA 4DUZC 5DV9A 4JM1A 3E7XA 2VZEA 4BC9A 4X62C 1MD9A 2P20A 4JI2C 4DR4C 4B3SC 3G7SA 1TH5A 3R44A 5IFIA 5GTDA 2D1TA 5LMNC 3CQ3A 1XHJA 1QWIA 2DYJA 4DV0C 3DAYA 4GKKC 2D28C 1MDFA 4MH4A 4DR1C 1T5DX 1ULTA 3DLPX 5A19A 4DV7C 2OPLA 3IEVA 4FUQA 4R1LA 1V60A 2P02A 1J5EC 1XDXA 3FCCA 2ZTBA 4WS9A 1O92A 1HNXC 5IWAC 4JI6C 4DV3C 1IBKC 4LF8C 3R9XA 4RMNA 2M5OA 3GPCA 2P2FA 3L95X 2QVYX 4DV4C 2ONFA 3VNQA 3LNVA 1KKGA 3PROC 2E8CA 3I07A 4JI1C 1N2FA 3GR0A 1N33C 1GPMA 2Z51A 3J7AD 1PG4A 2PT7G 5JRHA 5K8FA 3PESA 4JYAC 1UWDA 2DHMA 5H9UA 2V7BA 4JI5C 3PBKA 5T8TA 4NDNA 3K6RA 4OXIA 2WD9A 2NCLA 4IZ6A 3UOWA 1NY8A 2M5HA 4PUIA 3UZ0A 2QVXX 4DR5C 1MXCA 4NXMC 4JI0C 2HHHC 2BJOA 3A4IA 2D1RA 4D56A 4DCTA 3SO4A 4DUYC 3A9VA 4GKJC 1USPB 1MXBA 2MMAB 3NYQA 4D57A 4K0KC 3VNRA 4RVNA 2KZFA 4JI8C 4GXQA 4JV5C 5BUSA 3N54B 1VLAA 4BSZA 4R0MA 5BSTA 4LF6C 2KDNA 3AF6A 2PROA 4I9GA 2MCQA 1IBLC 1O90A 1P4EC 3EERA 2ATWA 4L4QA
chains in the Genus database with same CATH topology
3TDEA 2OO4A 5K85A 5AE1A 2YWCA 4X66C 5LMUC 5KYTA 1O9TA 2QL8A 4G36A 1PG3A 4D4GA 4DG9A 4EATA 4NOZA 4RLQA 1HR0C 2JMPA 3TQIA 3A9UA 3NYRA 1BA3A 3GKUA 1NYEA 2AYAA 3NPDA 5A2QD 1HNWC 3TUFA 2XR1A 3OTOC 1QM4A 3JAMD 4DV2C 3I08A 3L8CA 5FLXD 4KTVA 4JI3C 5CZVA 4PHTA 2OBVA 1PA4A 5AE3A 5IT9D 4PZPA 4ZLPA 4B3RC 4X65C 3IPLA 2VQEC 1HH2P 5BSUA 4LF7C 4JI7C 4DCUA 4LFBC 2UUAC 1USPA 4RM2A 1MXAA 2UXCC 2UU9C 3B7WA 1IBMC 3LUSA 2P2QA 4GS5A 1LCIA 1FUGA 4KTTA 3IMLA 1ML8A 2E5LC 4X64C 2CY1A 4BCAA 2EGTA 3RG2A 4ISBA 4LF9C 4MTNA 3J80D 2Y4OA 3RV2A 2UUCC 5AE2A 4AQYC 3GR1A 4RVOA 2P2JA 4ZJZA 5KYVA 1N36C 5BSVA 1AMUA 5KEIA 2P2BA 1XNRC 3H2TA 3CW8X 3CW9A 4B3TC 1XRBA 4BC7A 1V26A 2F4VC 3S82A 4DG8A 2E7GA 4XX2A 3AF5A 4DV6C 4I9FA 2D27A 1ZB8A 2E8EA 1XMQC 4B3MC 1N32C 1N34C 4PROC 3LGXA 4DV5C 4YHHC 2UXDC 3FCEA 1LQLA 4HPVA 4JI4C 4D4IA 2ASBA 2BH1X 4DCVA 5E7QA 3KXWA 1EGAA 4G37A 1JOSA 3NI2A 4LFCC 2YCBA 5BR8C 4RLFA 2ZM6C 4BBYA 5A1GA 2Y27A 2CXCA 2OPLB 2D1SA 3T1HC 1O93A 3IEUA 4G1IA 4FTFA 1XRCA 2P2MA 5BUQA 3ETCA 5ADZA 4DCSA 4KHPC 4LFAC 3T1YC 4LF4C 1HNZC 3EQ6A 4RM3A 2D7VA 5T8SA 1V25A 1WH9A 1XNQC 4R1MA 2D1QA 4OYCA 3E7WA 1RG9A 5BSWA 4NXNC 3LAXA 1XRAA 3C5EA 2QW0X 3N2QA 4DR2C 1XMOC 4LF5C 4YY3C 4DR3C 1FJGC 4TPSB 5A1IA 2E8FA 1K0RA 1UKKA 4U5YD 1I94C 4GXRA 5CZXA 2UXBC 4L2ZA 1MDBA 1WF3A 1T5HX 2PN2A 3J81D 4IR7A 2QVZX 2VSQA 5BSRA 3R9WA 2HJGA 1L2FA 4DR6C 1MKYA 4L7IA 1ZB9A 4ODJA 2YWBA 2WP0C 3DHVA 2DPLA 2VQFC 2Y4NA 4FUTA 2E0GA 3ETOA 1YJ7A 4K0BA 3VNSA 4DR7C 1RY2A 5BURA 4LE5A 4WV3A 2UUBC 1P7LA 4OX9C 5BSMA 4DV1C 3CJEA 4DUZC 5DV9A 4JM1A 3E7XA 2VZEA 4BC9A 4X62C 1MD9A 2P20A 4JI2C 4DR4C 4B3SC 3G7SA 5IFIA 3R44A 5GTDA 2D1TA 5LMNC 1QWIA 2DYJA 4DV0C 3DAYA 4GKKC 2D28C 1MDFA 4MH4A 4DR1C 1T5DX 1ULTA 3DLPX 5A19A 4DV7C 2OPLA 3IEVA 4FUQA 4R1LA 2P02A 1J5EC 3FCCA 4WS9A 1O92A 1HNXC 5IWAC 4JI6C 4DV3C 1IBKC 4LF8C 3R9XA 4RMNA 3GPCA 2P2FA 3L95X 2QVYX 4DV4C 2ONFA 3VNQA 3LNVA 1KKGA 3PROC 2E8CA 3I07A 4JI1C 1N2FA 3GR0A 1N33C 1GPMA 3J7AD 1PG4A 2PT7G 5JRHA 5K8FA 3PESA 4JYAC 5H9UA 2V7BA 4JI5C 3PBKA 5T8TA 4NDNA 4OXIA 2WD9A 4IZ6A 3UOWA 3UZ0A 2QVXX 4DR5C 1MXCA 4NXMC 4JI0C 2HHHC 2BJOA 3A4IA 2D1RA 4D56A 4DCTA 3SO4A 4DUYC 3A9VA 4GKJC 1USPB 1MXBA 3NYQA 4D57A 4K0KC 3VNRA 4RVNA 2KZFA 4JI8C 4GXQA 4JV5C 5BUSA 3N54B 1VLAA 4BSZA 4R0MA 5BSTA 4LF6C 3AF6A 2PROA 4I9GA 1IBLC 1O90A 3EERA 2ATWA 4L4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 C;  4DR3 C;  1N36 C;  1FJG C;  4DV3 C;  1IBK C;  4LF8 C;  3R9X A;  2E8F A;  1XNR C;  4B3T C;  1K0R A;  1UKK A;  1I94 C;  4X66 C;  2UXB C;  5LMU C;  4DV4 C;  1WF3 A;  2ONF A;  2QL8 A;  2F4V C;  1KKG A;  2PN2 A;  2E7G A;  4XX2 A;  3J81 D;  3AF5 A;  4DV6 C;  2E8C A;  1ZB8 A;  2E8E A;  4NOZ A;  1XMQ C;  3I07 A;  2HJG A;  1HR0 C;  2JMP A;  1N2F A;  4B3M C;  1L2F A;  4JI1 C;  1N33 C;  1N32 C;  1N34 C;  4DV5 C;  4DR6 C;  1MKY A;  1ZB9 A;  4YHH C;  3J7A D;  2UXD C;  2PT7 G;  1LQL A;  4JI4 C;  2ASB A;  4DCV A;  2VQF C;  2ATW A;  3GKU A;  1EGA A;  1NYE A;  4LFC C;  1JOS A;  4JYA C;  2YCB A;  5A2Q D;  5BR8 C;  1HNW C;  2ZM6 C;  4DR7 C;  2XR1 A;  3OTO C;  2UUB C;  3JAM D;  4DV2 C;  4JI5 C;  4OX9 C;  5FLX D;  4JI3 C;  4DV1 C;  3CJE A;  2CXC A;  2OPL B;  4DUZ C;  3T1H C;  1PA4 A;  5IT9 D;  4B3R C;  3IEU A;  4DR5 C;  4NXM C;  4X62 C;  4JI0 C;  2HHH C;  4X65 C;  4JI2 C;  2BJO A;  2VQE C;  1HH2 P;  4LF7 C;  4DR4 C;  4B3S C;  4JI7 C;  4DCU A;  4LFB C;  2UUA C;  1USP A;  4DCS A;  4KHP C;  3T1Y C;  4LFA C;  4DCT A;  4LF4 C;  4DUY C;  2UXC C;  5LMN C;  2UU9 C;  1HNZ C;  4GKJ C;  1IBM C;  3LUS A;  1USP B;  3R9W A;  4K0K C;  1QWI A;  1ML8 A;  2E5L C;  4X64 C;  2CY1 A;  2DYJ A;  4DV0 C;  2KZF A;  4GKK C;  4MH4 A;  4DR1 C;  2D7V A;  2EGT A;  4DV7 C;  1WH9 A;  4JI8 C;  1XNQ C;  4JV5 C;  2OPL A;  4LF9 C;  1VLA A;  4MTN A;  4BSZ A;  3IEV A;  3J80 D;  4NXN C;  1J5E C;  4LF6 C;  2UUC C;  4AQY C;  3AF6 A;  1HNX C;  1IBL C;  5IWA C;  4DR2 C;  1XMO C;  4LF5 C;  3EER A;  4YY3 C; 
#chains in the Genus database with same CATH topology
 3A26 A;  3TDE A;  2OO4 A;  5K85 A;  5AE1 A;  2YWC A;  3AY0 A;  4PUG A;  3LNO A;  4X66 C;  5LMU C;  5KYT A;  1O9T A;  2QL8 A;  4G36 A;  1PG3 A;  3CQ1 A;  4D4G A;  2KZ0 A;  4DG9 A;  4EAT A;  4NOZ A;  4RLQ A;  1HR0 C;  2JMP A;  3TQI A;  3A9U A;  3NYR A;  1BA3 A;  3GKU A;  1NYE A;  2AYA A;  3NPD A;  5A2Q D;  1HNW C;  3TUF A;  2XR1 A;  3OTO C;  1QM4 A;  3JAM D;  4DV2 C;  3I08 A;  3L8C A;  5FLX D;  4KTV A;  4JI3 C;  5CZV A;  4PHT A;  3CQ2 A;  2OBV A;  1PA4 A;  5AE3 A;  5IT9 D;  4PZP A;  4ZLP A;  4B3R C;  2CU6 A;  2PG1 E;  4X65 C;  3IPL A;  2VQE C;  1HH2 P;  5BSU A;  4LF7 C;  4JI7 C;  4DCU A;  4LFB C;  2UUA C;  1USP A;  4RM2 A;  1MXA A;  2UXC C;  2UU9 C;  3B7W A;  1IBM C;  3LUS A;  2P2Q A;  4GS5 A;  1LCI A;  1FUG A;  4KTT A;  3IML A;  1ML8 A;  2E5L C;  4X64 C;  2CY1 A;  4BCA A;  2EGT A;  3RG2 A;  4ISB A;  4LF9 C;  4MTN A;  3J80 D;  2Y4O A;  3RV2 A;  2JNV A;  3UEB A;  2UUC C;  5AE2 A;  4AQY C;  1M6X A;  3GR1 A;  4RVO A;  2P2J A;  4ZJZ A;  1M6X C;  5KYV A;  1N36 C;  5BSV A;  1AMU A;  5KEI A;  2P2B A;  1XNR C;  3H2T A;  3CW8 X;  3CW9 A;  4B3T C;  1XRB A;  1FLO A;  4BC7 A;  1V26 A;  2F4V C;  3S82 A;  4DG8 A;  2E7G A;  4XX2 A;  3AF5 A;  4DV6 C;  4I9F A;  2D27 A;  1ZB8 A;  2E8E A;  1XMQ C;  4B3M C;  1N32 C;  1N34 C;  4PRO C;  3LGX A;  4DV5 C;  4YHH C;  2UXD C;  1IB8 A;  3FCE A;  4PUH A;  1LQL A;  4HPV A;  4JI4 C;  4D4I A;  2ASB A;  2BH1 X;  4DCV A;  5E7Q A;  3KXW A;  1EGA A;  4G37 A;  1JOS A;  3NI2 A;  4LFC C;  2YCB A;  5BR8 C;  4RLF A;  2ZM6 C;  4BBY A;  5A1G A;  2Y27 A;  1VEH A;  2CXC A;  2OPL B;  3O2E A;  2D1S A;  3T1H C;  1O93 A;  3IEU A;  3UX3 A;  4G1I A;  4FTF A;  1XRC A;  2P2M A;  5BUQ A;  3ETC A;  5ADZ A;  4DCS A;  4KHP C;  3T1Y C;  4LFA C;  4LF4 C;  1HNZ C;  3TR3 A;  2MM9 A;  3UX2 A;  3EQ6 A;  4RM3 A;  3FM7 A;  2D7V A;  3A25 A;  5T8S A;  1V25 A;  1WH9 A;  1XNQ C;  4R1M A;  2D1Q A;  4OYC A;  3E7W A;  1RG9 A;  5BSW A;  1WCJ A;  3LAX A;  1XRA A;  3C5E A;  4NXN C;  2QW0 X;  1P4E A;  3N2Q A;  4DR2 C;  1XMO C;  4LF5 C;  4YY3 C;  2ZZM A;  4DR3 C;  1FJG C;  4TPS B;  5A1I A;  2E8F A;  1K0R A;  1UKK A;  4U5Y D;  1I94 C;  1XS3 A;  4GXR A;  5CZX A;  2UXB C;  4L2Z A;  1MDB A;  1WF3 A;  1T5H X;  2ZZN A;  1YGT A;  2PN2 A;  3J81 D;  4IR7 A;  2QVZ X;  2VSQ A;  5BSR A;  3R9W A;  2HJG A;  1L2F A;  4DR6 C;  1MKY A;  4L7I A;  1ZB9 A;  1PU1 A;  5LCI A;  2YX1 A;  4ODJ A;  2YWB A;  2WP0 C;  3DHV A;  2DPL A;  2VQF C;  2Y4N A;  4FUT A;  2E0G A;  3ETO A;  1YJ7 A;  4K0B A;  3VNS A;  4DR7 C;  1RY2 A;  5BUR A;  4LE5 A;  4WV3 A;  2UUB C;  1P7L A;  4OX9 C;  5BSM A;  4DV1 C;  3CJE A;  4DUZ C;  5DV9 A;  4JM1 A;  3E7X A;  2VZE A;  4BC9 A;  4X62 C;  1MD9 A;  2P20 A;  4JI2 C;  4DR4 C;  4B3S C;  3G7S A;  1TH5 A;  3R44 A;  5IFI A;  5GTD A;  2D1T A;  5LMN C;  3CQ3 A;  1XHJ A;  1QWI A;  2DYJ A;  4DV0 C;  3DAY A;  4GKK C;  2D28 C;  1MDF A;  4MH4 A;  4DR1 C;  1T5D X;  1ULT A;  3DLP X;  5A19 A;  4DV7 C;  2OPL A;  3IEV A;  4FUQ A;  4R1L A;  1V60 A;  2P02 A;  1J5E C;  1XDX A;  3FCC A;  2ZTB A;  4WS9 A;  1O92 A;  1HNX C;  5IWA C;  4JI6 C;  4DV3 C;  1IBK C;  4LF8 C;  3R9X A;  4RMN A;  2M5O A;  3GPC A;  2P2F A;  3L95 X;  2QVY X;  4DV4 C;  2ONF A;  3VNQ A;  3LNV A;  1KKG A;  3PRO C;  2E8C A;  3I07 A;  4JI1 C;  1N2F A;  3GR0 A;  1N33 C;  1GPM A;  2Z51 A;  3J7A D;  1PG4 A;  2PT7 G;  5JRH A;  5K8F A;  3PES A;  4JYA C;  1UWD A;  2DHM A;  5H9U A;  2V7B A;  4JI5 C;  3PBK A;  5T8T A;  4NDN A;  3K6R A;  4OXI A;  2WD9 A;  2NCL A;  4IZ6 A;  3UOW A;  1NY8 A;  2M5H A;  4PUI A;  3UZ0 A;  2QVX X;  4DR5 C;  1MXC A;  4NXM C;  4JI0 C;  2HHH C;  2BJO A;  3A4I A;  2D1R A;  4D56 A;  4DCT A;  3SO4 A;  4DUY C;  3A9V A;  4GKJ C;  1USP B;  1MXB A;  2MMA B;  3NYQ A;  4D57 A;  4K0K C;  3VNR A;  4RVN A;  2KZF A;  4JI8 C;  4GXQ A;  4JV5 C;  5BUS A;  3N54 B;  1VLA A;  4BSZ A;  4R0M A;  5BST A;  4LF6 C;  2KDN A;  3AF6 A;  2PRO A;  4I9G A;  2MCQ A;  1IBL C;  1O90 A;  1P4E C;  3EER A;  2ATW A;  4L4Q A; 
#chains in the Genus database with same CATH homology
 3TDE A;  2OO4 A;  5K85 A;  5AE1 A;  2YWC A;  4X66 C;  5LMU C;  5KYT A;  1O9T A;  2QL8 A;  4G36 A;  1PG3 A;  4D4G A;  4DG9 A;  4EAT A;  4NOZ A;  4RLQ A;  1HR0 C;  2JMP A;  3TQI A;  3A9U A;  3NYR A;  1BA3 A;  3GKU A;  1NYE A;  2AYA A;  3NPD A;  5A2Q D;  1HNW C;  3TUF A;  2XR1 A;  3OTO C;  1QM4 A;  3JAM D;  4DV2 C;  3I08 A;  3L8C A;  5FLX D;  4KTV A;  4JI3 C;  5CZV A;  4PHT A;  2OBV A;  1PA4 A;  5AE3 A;  5IT9 D;  4PZP A;  4ZLP A;  4B3R C;  4X65 C;  3IPL A;  2VQE C;  1HH2 P;  5BSU A;  4LF7 C;  4JI7 C;  4DCU A;  4LFB C;  2UUA C;  1USP A;  4RM2 A;  1MXA A;  2UXC C;  2UU9 C;  3B7W A;  1IBM C;  3LUS A;  2P2Q A;  4GS5 A;  1LCI A;  1FUG A;  4KTT A;  3IML A;  1ML8 A;  2E5L C;  4X64 C;  2CY1 A;  4BCA A;  2EGT A;  3RG2 A;  4ISB A;  4LF9 C;  4MTN A;  3J80 D;  2Y4O A;  3RV2 A;  2UUC C;  5AE2 A;  4AQY C;  3GR1 A;  4RVO A;  2P2J A;  4ZJZ A;  5KYV A;  1N36 C;  5BSV A;  1AMU A;  5KEI A;  2P2B A;  1XNR C;  3H2T A;  3CW8 X;  3CW9 A;  4B3T C;  1XRB A;  4BC7 A;  1V26 A;  2F4V C;  3S82 A;  4DG8 A;  2E7G A;  4XX2 A;  3AF5 A;  4DV6 C;  4I9F A;  2D27 A;  1ZB8 A;  2E8E A;  1XMQ C;  4B3M C;  1N32 C;  1N34 C;  4PRO C;  3LGX A;  4DV5 C;  4YHH C;  2UXD C;  3FCE A;  1LQL A;  4HPV A;  4JI4 C;  4D4I A;  2ASB A;  2BH1 X;  4DCV A;  5E7Q A;  3KXW A;  1EGA A;  4G37 A;  1JOS A;  3NI2 A;  4LFC C;  2YCB A;  5BR8 C;  4RLF A;  2ZM6 C;  4BBY A;  5A1G A;  2Y27 A;  2CXC A;  2OPL B;  2D1S A;  3T1H C;  1O93 A;  3IEU A;  4G1I A;  4FTF A;  1XRC A;  2P2M A;  5BUQ A;  3ETC A;  5ADZ A;  4DCS A;  4KHP C;  4LFA C;  3T1Y C;  4LF4 C;  1HNZ C;  3EQ6 A;  4RM3 A;  2D7V A;  5T8S A;  1V25 A;  1WH9 A;  1XNQ C;  4R1M A;  2D1Q A;  4OYC A;  3E7W A;  1RG9 A;  5BSW A;  4NXN C;  3LAX A;  1XRA A;  3C5E A;  2QW0 X;  3N2Q A;  4DR2 C;  1XMO C;  4LF5 C;  4YY3 C;  4DR3 C;  1FJG C;  4TPS B;  5A1I A;  2E8F A;  1K0R A;  1UKK A;  4U5Y D;  1I94 C;  4GXR A;  5CZX A;  2UXB C;  4L2Z A;  1MDB A;  1WF3 A;  1T5H X;  2PN2 A;  3J81 D;  4IR7 A;  2QVZ X;  2VSQ A;  5BSR A;  3R9W A;  2HJG A;  1L2F A;  4DR6 C;  1MKY A;  4L7I A;  1ZB9 A;  4ODJ A;  2YWB A;  2WP0 C;  3DHV A;  2DPL A;  2VQF C;  2Y4N A;  4FUT A;  2E0G A;  3ETO A;  1YJ7 A;  4K0B A;  3VNS A;  4DR7 C;  1RY2 A;  5BUR A;  4LE5 A;  4WV3 A;  2UUB C;  1P7L A;  4OX9 C;  5BSM A;  4DV1 C;  3CJE A;  4DUZ C;  5DV9 A;  4JM1 A;  3E7X A;  2VZE A;  4BC9 A;  4X62 C;  1MD9 A;  2P20 A;  4JI2 C;  4DR4 C;  4B3S C;  3G7S A;  5IFI A;  3R44 A;  5GTD A;  2D1T A;  5LMN C;  1QWI A;  2DYJ A;  4DV0 C;  3DAY A;  4GKK C;  2D28 C;  1MDF A;  4MH4 A;  4DR1 C;  1T5D X;  1ULT A;  3DLP X;  5A19 A;  4DV7 C;  2OPL A;  3IEV A;  4FUQ A;  4R1L A;  2P02 A;  1J5E C;  3FCC A;  4WS9 A;  1O92 A;  1HNX C;  5IWA C;  4JI6 C;  4DV3 C;  1IBK C;  4LF8 C;  3R9X A;  4RMN A;  3GPC A;  2P2F A;  3L95 X;  2QVY X;  4DV4 C;  2ONF A;  3VNQ A;  3LNV A;  1KKG A;  3PRO C;  2E8C A;  3I07 A;  4JI1 C;  1N2F A;  3GR0 A;  1N33 C;  1GPM A;  3J7A D;  1PG4 A;  2PT7 G;  5JRH A;  5K8F A;  3PES A;  4JYA C;  5H9U A;  2V7B A;  4JI5 C;  3PBK A;  5T8T A;  4NDN A;  4OXI A;  2WD9 A;  4IZ6 A;  3UOW A;  3UZ0 A;  2QVX X;  4DR5 C;  1MXC A;  4NXM C;  4JI0 C;  2HHH C;  2BJO A;  3A4I A;  2D1R A;  4D56 A;  4DCT A;  3SO4 A;  4DUY C;  3A9V A;  4GKJ C;  1USP B;  1MXB A;  3NYQ A;  4D57 A;  4K0K C;  3VNR A;  4RVN A;  2KZF A;  4JI8 C;  4GXQ A;  4JV5 C;  5BUS A;  3N54 B;  1VLA A;  4BSZ A;  4R0M A;  5BST A;  4LF6 C;  3AF6 A;  2PRO A;  4I9G A;  1IBL C;  1O90 A;  3EER A;  2ATW A;  4L4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...