1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
1MKYA 2BJOA 2E8EA 4JI0C 4JI1C 4DV0C 2UXBC 3IEUA 4B3MC 4DV6C 1XNRC 4OX9C 3I07A 2HJGA 3CJEA 1I94C 4GKKC 1QWIA 4X64C 4JV5C 4DV1C 2CXCA 2OPLB 5LMUC 2ZM6C 4K0KC 1HNWC 1HNXC 1N2FA 4MTNA 1USPB 4X66C 2EGTA 4JI8C 3JAMD 2PN2A 2E5LC 1HH2P 4JI7C 5LMNC 4DV4C 4XX2A 4DR3C 2ASBA 1IBLC 2CY1A 4KHPC 3R9XA 1FJGC 4YHHC 2ATWA 1ZB9A 4LFBC 3AF6A 4LF6C 3LUSA 5BR8C 3T1HC 2OPLA 4DV5C 2JMPA 3AF5A 1HNZC 4X65C 5IT9D 3R9WA 1ZB8A 2D7VA 5IWAC 4DV3C 2UUAC 4B3TC 4DCSA 2UUBC 4LF9C 2UU9C 4JI3C 2F4VC 4DR7C 4DCUA 1KKGA 1LQLA 3IEVA 2DYJA 2XR1A 1N32C 1L2FA 2E7GA 4MH4A 1IBKC 1N34C 1XMQC 4DR2C 1N36C 4LFAC 3J80D 4LFCC 2UUCC 4JYAC 4DUYC 4LF5C 4JI2C 1XMOC 5A2QD 4JI6C 3OTOC 3T1YC 2VQEC 2HHHC 4DUZC 2UXDC 3J81D 1N33C 1EGAA 2KZFA 2YCBA 4NXMC 4YY3C 5FLXD 2UXCC 2E8CA 1NYEA 1ML8A 2PT7G 4DR4C 4AQYC 2QL8A 4DV2C 2E8FA 1IBMC 4DCVA 1XNQC 3J7AD 4DCTA 1JOSA 1HR0C 4X62C 1WF3A 4DV7C 4NOZA 1PA4A 1K0RA 4DR5C 4DR1C 4B3SC 2ONFA 3EERA 4LF7C 4DR6C 1USPA 4JI4C 4JI5C 1WH9A 1UKKA 2VQFC 3GKUA 4GKJC 1VLAA 1J5EC 4LF8C 4LF4C 4B3RC 4BSZA 4NXNC
chains in the Genus database with same CATH superfamily
3A4IA 4ISBA 4DV0C 1WCJA 2PG1E 4RM2A 3LGXA 1XNRC 1P7LA 3E7WA 5E7QA 4GKKC 2P20A 2VSQA 2OBVA 4L7IA 2M5HA 5GTDA 4PROC 4JI8C 2P2BA 2ZZMA 2QVZX 3DLPX 2E5LC 5BUSA 3VNSA 3DHVA 4DR3C 5AE3A 4YHHC 1MD9A 3NYQA 2QVYX 2Y4NA 4D57A 1RG9A 5CZXA 4DV5C 1O90A 2JMPA 4LE5A 3KXWA 3R9WA 1P4EC 3FCCA 2UUAC 2UUBC 2UU9C 4JI3C 4DR7C 2NCLA 5LCIA 1LCIA 1BA3A 2DYJA 3CQ1A 1IBKC 1N34C 1XMQC 1N36C 4LFAC 3J80D 4LFCC 2P2QA 3VNRA 2YX1A 3B7WA 4LF5C 4JI2C 4BC7A 3T1YC 2MMAB 1XS3A 1FLOA 1MXCA 2YCBA 5FLXD 3NYRA 3UX3A 4G36A 3DAYA 1NYEA 2PT7G 4DV2C 1IBMC 4PUGA 3C5EA 3J7AD 2PROA 1HR0C 2D1TA 4X62C 4DV7C 4NOZA 4B3SC 1O93A 3GKUA 2OO4A 4LF4C 4BSZA 4RLQA 4JI0C 5IFIA 3FCEA 4OX9C 4WV3A 1I94C 4X64C 4JV5C 3G7SA 1TH5A 2OPLB 1YGTA 2ZM6C 4DG9A 4K0KC 3IMLA 4MTNA 2KDNA 5BUQA 1YJ7A 2D27A 1HH2P 5KYTA 1NY8A 3N54B 4XX2A 3PBKA 2ASBA 1XDXA 4KHPC 3R9XA 2V7BA 4PHTA 2OPLA 4G37A 3GPCA 5KEIA 3AF5A 1HNZC 2JNVA 2D7VA 4DV3C 4B3TC 2DHMA 3TQIA 2F4VC 1KKGA 2YWBA 2QW0X 4DG8A 1N32C 1MDBA 1L2FA 4TPSB 5DV9A 1MXAA 1XMOC 3PESA 2HHHC 1AMUA 1N33C 3ETOA 4R1LA 2KZFA 4YY3C 1V26A 3CW8X 4L2ZA 3GR1A 1XRAA 3UX2A 4D4IA 2Z51A 4DCVA 4FUQA 1UWDA 4ODJA 1O9TA 4WS9A 1XNQC 4G1IA 4DCTA 1JOSA 2BH1X 3K6RA 1WF3A 3H2TA 4R1MA 4GXQA 5H9UA 2D28C 1UKKA 4BC9A 4GKJC 2AYAA 4KTVA 2BJOA 2E8EA 3AY0A 4JI1C 2UXBC 3IEUA 4B3MC 1P4EA 2HJGA 1MDFA 3CJEA 3CQ2A 3N2QA 5T8SA 5JRHA 3VNQA 3SO4A 5BSUA 4DV1C 3NI2A 2CXCA 3S82A 2MM9A 4RLFA 1HNXC 3PROC 2ZTBA 1IB8A 3L8CA 2ZZNA 3EQ6A 4EATA 2WD9A 1PG3A 4JI7C 3NPDA 1IBLC 2CY1A 4U5YD 2P2MA 5K85A 4LF6C 5BR8C 4PUHA 2D1SA 3A26A 4D4GA 4IR7A 5BSRA 4K0BA 4X65C 1V25A 5IWAC 4DCSA 2Y27A 4HPVA 5T8TA 3A25A 3IPLA 5A1GA 4RVNA 3IEVA 4FTFA 2E7GA 4DR2C 4JYAC 3A9UA 2VZEA 3LNVA 1RY2A 5A2QD 4JI6C 5BSWA 3OTOC 2YWCA 3TUFA 1ULTA 4I9FA 2UXDC 3J81D 4NXMC 3GR0A 2E8CA 4ZLPA 5BSVA 1T5DX 4BCAA 3CW9A 4AQYC 2QL8A 4FUTA 4RMNA 1V60A 3UOWA 2D1QA 3R44A 3RV2A 4DR5C 4DR1C 4PZPA 3EERA 3O2EA 2DPLA 5KYVA 4JI4C 1J5EC 4LF8C 1USPA 4NXNC 1MKYA 2KZ0A 3E7XA 5A19A 4D56A 4DV6C 4OXIA 3A9VA 3I07A 3FM7A 2CU6A 2WP0C 1QWIA 1XRCA 3LNOA 5LMUC 5BURA 1MXBA 1HNWC 4JM1A 1N2FA 5CZVA 1USPB 1GPMA 2EGTA 2P2FA 4X66C 3JAMD 2PN2A 4R0MA 1FUGA 5LMNC 4DV4C 4GXRA 2E0GA 3UZ0A 5A1IA 3TDEA 1M6XC 1FJGC 1T5HX 1ZB9A 2ATWA 3UEBA 4LFBC 4BBYA 5ADZA 3AF6A 4IZ6A 3LUSA 3T1HC 1M6XA 1PU1A 4RVOA 4I9GA 4ZJZA 5IT9D 1ZB8A 2P02A 4LF9C 4PUIA 4L4QA 4DCUA 3I08A 3L95X 3CQ3A 1LQLA 2XR1A 4GS5A 4KTTA 4MH4A 5BSTA 2UUCC 2Y4OA 3TR3A 5AE1A 4DUYC 5BSMA 4NDNA 3RG2A 1PG4A 3ETCA 2VQEC 2D1RA 4DUZC 1O92A 2P2JA 1EGAA 2QVXX 2UXCC 1VEHA 1ML8A 4DR4C 4RM3A 3LAXA 1XRBA 2E8FA 2MCQA 2M5OA 4OYCA 5K8FA 1PA4A 1K0RA 4LF7C 2ONFA 4DR6C 4JI5C 1WH9A 2VQFC 1VLAA 1XHJA 5AE2A 4B3RC 1QM4A
chains in the Genus database with same CATH topology
3A4IA 4ISBA 4DV0C 4RM2A 3LGXA 1XNRC 1P7LA 3E7WA 5E7QA 4GKKC 2P20A 2VSQA 2OBVA 4L7IA 5GTDA 4PROC 4JI8C 2P2BA 2QVZX 3DLPX 2E5LC 5BUSA 3VNSA 3DHVA 4DR3C 5AE3A 4YHHC 1MD9A 3NYQA 2QVYX 2Y4NA 4D57A 1RG9A 5CZXA 4DV5C 1O90A 2JMPA 4LE5A 3KXWA 3R9WA 3FCCA 2UUAC 2UUBC 2UU9C 4JI3C 4DR7C 1LCIA 1BA3A 2DYJA 1IBKC 1N34C 1XMQC 1N36C 4LFAC 3J80D 4LFCC 2P2QA 3VNRA 3B7WA 4LF5C 4JI2C 4BC7A 3T1YC 1MXCA 2YCBA 5FLXD 3NYRA 4G36A 3DAYA 1NYEA 2PT7G 4DV2C 1IBMC 3C5EA 3J7AD 2PROA 1HR0C 2D1TA 4X62C 4DV7C 4NOZA 4B3SC 1O93A 3GKUA 2OO4A 4LF4C 4BSZA 4RLQA 4JI0C 5IFIA 3FCEA 4OX9C 4WV3A 1I94C 4X64C 4JV5C 3G7SA 2OPLB 2ZM6C 4DG9A 4K0KC 3IMLA 4MTNA 5BUQA 1YJ7A 2D27A 1HH2P 5KYTA 3N54B 4XX2A 3PBKA 2ASBA 4KHPC 3R9XA 2V7BA 4PHTA 2OPLA 4G37A 3GPCA 5KEIA 3AF5A 1HNZC 2D7VA 4DV3C 4B3TC 3TQIA 2F4VC 1KKGA 2YWBA 2QW0X 4DG8A 1N32C 1MDBA 1L2FA 4TPSB 5DV9A 1MXAA 1XMOC 3PESA 2HHHC 1AMUA 1N33C 3ETOA 4R1LA 2KZFA 4YY3C 1V26A 3CW8X 4L2ZA 3GR1A 1XRAA 4D4IA 4FUQA 4WS9A 4DCVA 4ODJA 1O9TA 1XNQC 4G1IA 4DCTA 1JOSA 2BH1X 1WF3A 3H2TA 4R1MA 4GXQA 5H9UA 2D28C 1UKKA 4BC9A 4GKJC 2AYAA 4KTVA 2BJOA 2E8EA 4JI1C 2UXBC 3IEUA 4B3MC 2HJGA 1MDFA 3CJEA 3N2QA 5T8SA 3VNQA 5JRHA 3SO4A 5BSUA 4DV1C 3NI2A 2CXCA 3S82A 4RLFA 1HNXC 3PROC 3L8CA 3EQ6A 4EATA 2WD9A 1PG3A 4JI7C 3NPDA 1IBLC 2CY1A 4U5YD 2P2MA 5K85A 4LF6C 5BR8C 2D1SA 4D4GA 4IR7A 5BSRA 4K0BA 4X65C 1V25A 5IWAC 4DCSA 2Y27A 4HPVA 5T8TA 3IPLA 5A1GA 4RVNA 3IEVA 4FTFA 2E7GA 4DR2C 4JYAC 3A9UA 2VZEA 3LNVA 1RY2A 5A2QD 4JI6C 5BSWA 3OTOC 2YWCA 3TUFA 1ULTA 4I9FA 2UXDC 3J81D 4NXMC 3GR0A 2E8CA 4ZLPA 5BSVA 1T5DX 4BCAA 3CW9A 4AQYC 2QL8A 4FUTA 4RMNA 3UOWA 2D1QA 3R44A 3RV2A 4DR5C 4DR1C 4PZPA 3EERA 5KYVA 2DPLA 4JI4C 1J5EC 4LF8C 1USPA 4NXNC 1MKYA 3E7XA 5A19A 4D56A 4DV6C 4OXIA 3A9VA 3I07A 2WP0C 1QWIA 1XRCA 5LMUC 5BURA 1MXBA 1HNWC 4JM1A 1N2FA 5CZVA 1USPB 1GPMA 2EGTA 2P2FA 4X66C 3JAMD 2PN2A 4R0MA 1FUGA 5LMNC 4DV4C 4GXRA 2E0GA 3UZ0A 5A1IA 3TDEA 1FJGC 1T5HX 1ZB9A 2ATWA 4LFBC 4BBYA 5ADZA 3AF6A 4IZ6A 3LUSA 3T1HC 4RVOA 4I9GA 4ZJZA 5IT9D 1ZB8A 2P02A 4LF9C 4L4QA 4DCUA 3I08A 3L95X 1LQLA 2XR1A 4GS5A 4KTTA 4MH4A 5BSTA 2UUCC 2Y4OA 5AE1A 4DUYC 5BSMA 4NDNA 3RG2A 1PG4A 3ETCA 2VQEC 2D1RA 4DUZC 1O92A 2P2JA 1EGAA 2QVXX 2UXCC 1ML8A 4DR4C 4RM3A 3LAXA 1XRBA 2E8FA 4OYCA 5K8FA 1PA4A 1K0RA 4LF7C 2ONFA 4DR6C 4JI5C 1WH9A 2VQFC 1VLAA 5AE2A 4B3RC 1QM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKY A;  2BJO A;  2E8E A;  4JI0 C;  4JI1 C;  4DV0 C;  2UXB C;  3IEU A;  4B3M C;  4DV6 C;  1XNR C;  4OX9 C;  3I07 A;  2HJG A;  3CJE A;  1I94 C;  4GKK C;  1QWI A;  4X64 C;  4JV5 C;  4DV1 C;  2CXC A;  2OPL B;  5LMU C;  2ZM6 C;  4K0K C;  1HNW C;  1HNX C;  1N2F A;  4MTN A;  1USP B;  4X66 C;  2EGT A;  4JI8 C;  3JAM D;  2PN2 A;  2E5L C;  1HH2 P;  4JI7 C;  5LMN C;  4DV4 C;  4XX2 A;  4DR3 C;  2ASB A;  1IBL C;  2CY1 A;  4KHP C;  3R9X A;  1FJG C;  4YHH C;  2ATW A;  1ZB9 A;  4LFB C;  3AF6 A;  4LF6 C;  3LUS A;  5BR8 C;  3T1H C;  2OPL A;  4DV5 C;  2JMP A;  3AF5 A;  1HNZ C;  4X65 C;  5IT9 D;  3R9W A;  1ZB8 A;  2D7V A;  5IWA C;  4DV3 C;  2UUA C;  4B3T C;  4DCS A;  2UUB C;  4LF9 C;  2UU9 C;  4JI3 C;  2F4V C;  4DR7 C;  4DCU A;  1KKG A;  1LQL A;  3IEV A;  2DYJ A;  2XR1 A;  1N32 C;  1L2F A;  2E7G A;  4MH4 A;  1IBK C;  1N34 C;  1XMQ C;  4DR2 C;  1N36 C;  4LFA C;  3J80 D;  4LFC C;  2UUC C;  4JYA C;  4DUY C;  4LF5 C;  4JI2 C;  1XMO C;  5A2Q D;  4JI6 C;  3OTO C;  3T1Y C;  2VQE C;  2HHH C;  4DUZ C;  2UXD C;  3J81 D;  1N33 C;  1EGA A;  2KZF A;  2YCB A;  4NXM C;  4YY3 C;  5FLX D;  2UXC C;  2E8C A;  1NYE A;  1ML8 A;  2PT7 G;  4DR4 C;  4AQY C;  2QL8 A;  4DV2 C;  2E8F A;  1IBM C;  4DCV A;  1XNQ C;  3J7A D;  4DCT A;  1JOS A;  1HR0 C;  4X62 C;  1WF3 A;  4DV7 C;  4NOZ A;  1PA4 A;  1K0R A;  4DR5 C;  4DR1 C;  4B3S C;  2ONF A;  3EER A;  4LF7 C;  4DR6 C;  1USP A;  4JI4 C;  4JI5 C;  1WH9 A;  1UKK A;  2VQF C;  3GKU A;  4GKJ C;  1VLA A;  1J5E C;  4LF8 C;  4LF4 C;  4B3R C;  4BSZ A;  4NXN C; 
#chains in the Genus database with same CATH topology
 3A4I A;  4ISB A;  4DV0 C;  1WCJ A;  2PG1 E;  4RM2 A;  3LGX A;  1XNR C;  1P7L A;  3E7W A;  5E7Q A;  4GKK C;  2P20 A;  2VSQ A;  2OBV A;  4L7I A;  2M5H A;  5GTD A;  4PRO C;  4JI8 C;  2P2B A;  2ZZM A;  2QVZ X;  3DLP X;  2E5L C;  5BUS A;  3VNS A;  3DHV A;  4DR3 C;  5AE3 A;  4YHH C;  1MD9 A;  3NYQ A;  2QVY X;  2Y4N A;  4D57 A;  1RG9 A;  5CZX A;  4DV5 C;  1O90 A;  2JMP A;  4LE5 A;  3KXW A;  3R9W A;  1P4E C;  3FCC A;  2UUA C;  2UUB C;  2UU9 C;  4JI3 C;  4DR7 C;  2NCL A;  5LCI A;  1LCI A;  1BA3 A;  2DYJ A;  3CQ1 A;  1IBK C;  1N34 C;  1XMQ C;  1N36 C;  4LFA C;  3J80 D;  4LFC C;  2P2Q A;  3VNR A;  2YX1 A;  3B7W A;  4LF5 C;  4JI2 C;  4BC7 A;  3T1Y C;  2MMA B;  1XS3 A;  1FLO A;  1MXC A;  2YCB A;  5FLX D;  3NYR A;  3UX3 A;  4G36 A;  3DAY A;  1NYE A;  2PT7 G;  4DV2 C;  1IBM C;  4PUG A;  3C5E A;  3J7A D;  2PRO A;  1HR0 C;  2D1T A;  4X62 C;  4DV7 C;  4NOZ A;  4B3S C;  1O93 A;  3GKU A;  2OO4 A;  4LF4 C;  4BSZ A;  4RLQ A;  4JI0 C;  5IFI A;  3FCE A;  4OX9 C;  4WV3 A;  1I94 C;  4X64 C;  4JV5 C;  3G7S A;  1TH5 A;  2OPL B;  1YGT A;  2ZM6 C;  4DG9 A;  4K0K C;  3IML A;  4MTN A;  2KDN A;  5BUQ A;  1YJ7 A;  2D27 A;  1HH2 P;  5KYT A;  1NY8 A;  3N54 B;  4XX2 A;  3PBK A;  2ASB A;  1XDX A;  4KHP C;  3R9X A;  2V7B A;  4PHT A;  2OPL A;  4G37 A;  3GPC A;  5KEI A;  3AF5 A;  1HNZ C;  2JNV A;  2D7V A;  4DV3 C;  4B3T C;  2DHM A;  3TQI A;  2F4V C;  1KKG A;  2YWB A;  2QW0 X;  4DG8 A;  1N32 C;  1MDB A;  1L2F A;  4TPS B;  5DV9 A;  1MXA A;  1XMO C;  3PES A;  2HHH C;  1AMU A;  1N33 C;  3ETO A;  4R1L A;  2KZF A;  4YY3 C;  1V26 A;  3CW8 X;  4L2Z A;  3GR1 A;  1XRA A;  3UX2 A;  4D4I A;  2Z51 A;  4DCV A;  4FUQ A;  1UWD A;  4ODJ A;  1O9T A;  4WS9 A;  1XNQ C;  4G1I A;  4DCT A;  1JOS A;  2BH1 X;  3K6R A;  1WF3 A;  3H2T A;  4R1M A;  4GXQ A;  5H9U A;  2D28 C;  1UKK A;  4BC9 A;  4GKJ C;  2AYA A;  4KTV A;  2BJO A;  2E8E A;  3AY0 A;  4JI1 C;  2UXB C;  3IEU A;  4B3M C;  1P4E A;  2HJG A;  1MDF A;  3CJE A;  3CQ2 A;  3N2Q A;  5T8S A;  5JRH A;  3VNQ A;  3SO4 A;  5BSU A;  4DV1 C;  3NI2 A;  2CXC A;  3S82 A;  2MM9 A;  4RLF A;  1HNX C;  3PRO C;  2ZTB A;  1IB8 A;  3L8C A;  2ZZN A;  3EQ6 A;  4EAT A;  2WD9 A;  1PG3 A;  4JI7 C;  3NPD A;  1IBL C;  2CY1 A;  4U5Y D;  2P2M A;  5K85 A;  4LF6 C;  5BR8 C;  4PUH A;  2D1S A;  3A26 A;  4D4G A;  4IR7 A;  5BSR A;  4K0B A;  4X65 C;  1V25 A;  5IWA C;  4DCS A;  2Y27 A;  4HPV A;  5T8T A;  3A25 A;  3IPL A;  5A1G A;  4RVN A;  3IEV A;  4FTF A;  2E7G A;  4DR2 C;  4JYA C;  3A9U A;  2VZE A;  3LNV A;  1RY2 A;  5A2Q D;  4JI6 C;  5BSW A;  3OTO C;  2YWC A;  3TUF A;  1ULT A;  4I9F A;  2UXD C;  3J81 D;  4NXM C;  3GR0 A;  2E8C A;  4ZLP A;  5BSV A;  1T5D X;  4BCA A;  3CW9 A;  4AQY C;  2QL8 A;  4FUT A;  4RMN A;  1V60 A;  3UOW A;  2D1Q A;  3R44 A;  3RV2 A;  4DR5 C;  4DR1 C;  4PZP A;  3EER A;  3O2E A;  2DPL A;  5KYV A;  4JI4 C;  1J5E C;  4LF8 C;  1USP A;  4NXN C;  1MKY A;  2KZ0 A;  3E7X A;  5A19 A;  4D56 A;  4DV6 C;  4OXI A;  3A9V A;  3I07 A;  3FM7 A;  2CU6 A;  2WP0 C;  1QWI A;  1XRC A;  3LNO A;  5LMU C;  5BUR A;  1MXB A;  1HNW C;  4JM1 A;  1N2F A;  5CZV A;  1USP B;  1GPM A;  2EGT A;  2P2F A;  4X66 C;  3JAM D;  2PN2 A;  4R0M A;  1FUG A;  5LMN C;  4DV4 C;  4GXR A;  2E0G A;  3UZ0 A;  5A1I A;  3TDE A;  1M6X C;  1FJG C;  1T5H X;  1ZB9 A;  2ATW A;  3UEB A;  4LFB C;  4BBY A;  5ADZ A;  3AF6 A;  4IZ6 A;  3LUS A;  3T1H C;  1M6X A;  1PU1 A;  4RVO A;  4I9G A;  4ZJZ A;  5IT9 D;  1ZB8 A;  2P02 A;  4LF9 C;  4PUI A;  4L4Q A;  4DCU A;  3I08 A;  3L95 X;  3CQ3 A;  1LQL A;  2XR1 A;  4GS5 A;  4KTT A;  4MH4 A;  5BST A;  2UUC C;  2Y4O A;  3TR3 A;  5AE1 A;  4DUY C;  5BSM A;  4NDN A;  3RG2 A;  1PG4 A;  3ETC A;  2VQE C;  2D1R A;  4DUZ C;  1O92 A;  2P2J A;  1EGA A;  2QVX X;  2UXC C;  1VEH A;  1ML8 A;  4DR4 C;  4RM3 A;  3LAX A;  1XRB A;  2E8F A;  2MCQ A;  2M5O A;  4OYC A;  5K8F A;  1PA4 A;  1K0R A;  4LF7 C;  2ONF A;  4DR6 C;  4JI5 C;  1WH9 A;  2VQF C;  1VLA A;  1XHJ A;  5AE2 A;  4B3R C;  1QM4 A; 
#chains in the Genus database with same CATH homology
 3A4I A;  4ISB A;  4DV0 C;  4RM2 A;  3LGX A;  1XNR C;  1P7L A;  3E7W A;  5E7Q A;  4GKK C;  2P20 A;  2VSQ A;  2OBV A;  4L7I A;  5GTD A;  4PRO C;  4JI8 C;  2P2B A;  2QVZ X;  3DLP X;  2E5L C;  5BUS A;  3VNS A;  3DHV A;  4DR3 C;  5AE3 A;  4YHH C;  1MD9 A;  3NYQ A;  2QVY X;  2Y4N A;  4D57 A;  1RG9 A;  5CZX A;  4DV5 C;  1O90 A;  2JMP A;  4LE5 A;  3KXW A;  3R9W A;  3FCC A;  2UUA C;  2UUB C;  2UU9 C;  4JI3 C;  4DR7 C;  1LCI A;  1BA3 A;  2DYJ A;  1IBK C;  1N34 C;  1XMQ C;  1N36 C;  4LFA C;  3J80 D;  4LFC C;  2P2Q A;  3VNR A;  3B7W A;  4LF5 C;  4JI2 C;  4BC7 A;  3T1Y C;  1MXC A;  2YCB A;  5FLX D;  3NYR A;  4G36 A;  3DAY A;  1NYE A;  2PT7 G;  4DV2 C;  1IBM C;  3C5E A;  3J7A D;  2PRO A;  1HR0 C;  2D1T A;  4X62 C;  4DV7 C;  4NOZ A;  4B3S C;  1O93 A;  3GKU A;  2OO4 A;  4LF4 C;  4BSZ A;  4RLQ A;  4JI0 C;  5IFI A;  3FCE A;  4OX9 C;  4WV3 A;  1I94 C;  4X64 C;  4JV5 C;  3G7S A;  2OPL B;  2ZM6 C;  4DG9 A;  4K0K C;  3IML A;  4MTN A;  5BUQ A;  1YJ7 A;  2D27 A;  1HH2 P;  5KYT A;  3N54 B;  4XX2 A;  3PBK A;  2ASB A;  4KHP C;  3R9X A;  2V7B A;  4PHT A;  2OPL A;  4G37 A;  3GPC A;  5KEI A;  3AF5 A;  1HNZ C;  2D7V A;  4DV3 C;  4B3T C;  3TQI A;  2F4V C;  1KKG A;  2YWB A;  2QW0 X;  4DG8 A;  1N32 C;  1MDB A;  1L2F A;  4TPS B;  5DV9 A;  1MXA A;  1XMO C;  3PES A;  2HHH C;  1AMU A;  1N33 C;  3ETO A;  4R1L A;  2KZF A;  4YY3 C;  1V26 A;  3CW8 X;  4L2Z A;  3GR1 A;  1XRA A;  4D4I A;  4FUQ A;  4WS9 A;  4DCV A;  4ODJ A;  1O9T A;  1XNQ C;  4G1I A;  4DCT A;  1JOS A;  2BH1 X;  1WF3 A;  3H2T A;  4R1M A;  4GXQ A;  5H9U A;  2D28 C;  1UKK A;  4BC9 A;  4GKJ C;  2AYA A;  4KTV A;  2BJO A;  2E8E A;  4JI1 C;  2UXB C;  3IEU A;  4B3M C;  2HJG A;  1MDF A;  3CJE A;  3N2Q A;  5T8S A;  3VNQ A;  5JRH A;  3SO4 A;  5BSU A;  4DV1 C;  3NI2 A;  2CXC A;  3S82 A;  4RLF A;  1HNX C;  3PRO C;  3L8C A;  3EQ6 A;  4EAT A;  2WD9 A;  1PG3 A;  4JI7 C;  3NPD A;  1IBL C;  2CY1 A;  4U5Y D;  2P2M A;  5K85 A;  4LF6 C;  5BR8 C;  2D1S A;  4D4G A;  4IR7 A;  5BSR A;  4K0B A;  4X65 C;  1V25 A;  5IWA C;  4DCS A;  2Y27 A;  4HPV A;  5T8T A;  3IPL A;  5A1G A;  4RVN A;  3IEV A;  4FTF A;  2E7G A;  4DR2 C;  4JYA C;  3A9U A;  2VZE A;  3LNV A;  1RY2 A;  5A2Q D;  4JI6 C;  5BSW A;  3OTO C;  2YWC A;  3TUF A;  1ULT A;  4I9F A;  2UXD C;  3J81 D;  4NXM C;  3GR0 A;  2E8C A;  4ZLP A;  5BSV A;  1T5D X;  4BCA A;  3CW9 A;  4AQY C;  2QL8 A;  4FUT A;  4RMN A;  3UOW A;  2D1Q A;  3R44 A;  3RV2 A;  4DR5 C;  4DR1 C;  4PZP A;  3EER A;  5KYV A;  2DPL A;  4JI4 C;  1J5E C;  4LF8 C;  1USP A;  4NXN C;  1MKY A;  3E7X A;  5A19 A;  4D56 A;  4DV6 C;  4OXI A;  3A9V A;  3I07 A;  2WP0 C;  1QWI A;  1XRC A;  5LMU C;  5BUR A;  1MXB A;  1HNW C;  4JM1 A;  1N2F A;  5CZV A;  1USP B;  1GPM A;  2EGT A;  2P2F A;  4X66 C;  3JAM D;  2PN2 A;  4R0M A;  1FUG A;  5LMN C;  4DV4 C;  4GXR A;  2E0G A;  3UZ0 A;  5A1I A;  3TDE A;  1FJG C;  1T5H X;  1ZB9 A;  2ATW A;  4LFB C;  4BBY A;  5ADZ A;  3AF6 A;  4IZ6 A;  3LUS A;  3T1H C;  4RVO A;  4I9G A;  4ZJZ A;  5IT9 D;  1ZB8 A;  2P02 A;  4LF9 C;  4L4Q A;  4DCU A;  3I08 A;  3L95 X;  1LQL A;  2XR1 A;  4GS5 A;  4KTT A;  4MH4 A;  5BST A;  2UUC C;  2Y4O A;  5AE1 A;  4DUY C;  5BSM A;  4NDN A;  3RG2 A;  1PG4 A;  3ETC A;  2VQE C;  2D1R A;  4DUZ C;  1O92 A;  2P2J A;  1EGA A;  2QVX X;  2UXC C;  1ML8 A;  4DR4 C;  4RM3 A;  3LAX A;  1XRB A;  2E8F A;  4OYC A;  5K8F A;  1PA4 A;  1K0R A;  4LF7 C;  2ONF A;  4DR6 C;  4JI5 C;  1WH9 A;  2VQF C;  1VLA A;  5AE2 A;  4B3R C;  1QM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...