1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
1USPB 2E8FA 2VQEC 1FJGC 4JI8C 4DCSA 1N33C 4DR1C 4KHPC 1K0RA 2ONFA 2OPLA 2CXCA 4AQYC 4B3SC 4DV5C 3R9XA 1L2FA 4B3MC 4JI3C 3J81D 2UXCC 4JI0C 1HNWC 4YHHC 4LF6C 2CY1A 4BSZA 2HJGA 4X64C 2UUCC 2UXDC 4DR6C 2E5LC 4JI2C 1IBMC 4B3RC 1XNRC 5IT9D 4B3TC 2QL8A 5FLXD 3JAMD 2UU9C 4JI4C 1WH9A 4DR3C 1QWIA 4DV7C 4YY3C 3J80D 4NXNC 4DR4C 4MH4A 4DV6C 1XMQC 1I94C 4MTNA 1KKGA 3CJEA 4X66C 1IBLC 3AF5A 4JI1C 3T1HC 3OTOC 2UUBC 4LFAC 2OPLB 3J7AD 2VQFC 5LMNC 3T1YC 2D7VA 4LF7C 4DR2C 2YCBA 3R9WA 4OX9C 3GKUA 4K0KC 2F4VC 3AF6A 2PT7G 2EGTA 2KZFA 3IEUA 2E8CA 4LFCC 4DV1C 4NXMC 4JI5C 1J5EC 1XNQC 1N34C 4LF4C 1HNXC 1WF3A 4DUYC 1ZB8A 1JOSA 1MKYA 4DV3C 4DCTA 3I07A 1N32C 1N36C 4X62C 1ML8A 1USPA 4LF9C 1UKKA 1LQLA 4DUZC 4DV4C 1IBKC 5A2QD 1EGAA 5IWAC 4X65C 1HNZC 4JYAC 4GKKC 4DCUA 2XR1A 2JMPA 1N2FA 1HH2P 2UXBC 2DYJA 1VLAA 2BJOA 4XX2A 1XMOC 4JV5C 4LFBC 4LF5C 4JI7C 1PA4A 4DR7C 4LF8C 2ZM6C 2ASBA 3IEVA 5LMUC 4JI6C 3LUSA 4DV2C 1ZB9A 2ATWA 2UUAC 2E8EA 4NOZA 4GKJC 4DV0C 4DR5C 5BR8C 4DCVA 3EERA 2PN2A 1HR0C 2HHHC 2E7GA 1NYEA
chains in the Genus database with same CATH superfamily
1GPMA 4JI8C 2OPLA 4AQYC 1MDFA 4B3SC 5GTDA 3FCEA 4JI0C 4FUTA 3PROC 2HJGA 1IB8A 1PG3A 4DR6C 1XS3A 2YWBA 4BC7A 3G7SA 4B3RC 4BCAA 3B7WA 4PZPA 3RV2A 5CZVA 4JI4C 1PU1A 4PHTA 3DHVA 2P2BA 3I08A 1XMQC 2NCLA 2D27A 1KKGA 3TUFA 3PBKA 4JI1C 3AF5A 4G37A 3OTOC 5KYVA 4LFAC 4DG9A 5IFIA 3R44A 4I9FA 2QVYX 4DG8A 3O2EA 3R9WA 3NI2A 1FUGA 1XRAA 3VNQA 3CQ2A 3AF6A 2PT7G 2EGTA 4OYCA 2E8CA 4D56A 2Y4NA 4WS9A 3AY0A 2WP0C 1HNXC 1ULTA 4R1LA 1ML8A 1USPA 1IBKC 5A2QD 5IWAC 4X65C 4WV3A 4JYAC 2D28C 1N2FA 1MDBA 4ODJA 3CW8X 3VNSA 4ZJZA 4LFBC 4JI7C 4PUHA 2ZM6C 4IZ6A 4EATA 1RG9A 4NDNA 4DCVA 2HHHC 4LF4C 4PROC 2E8FA 2VQEC 1PG4A 4G36A 4KHPC 4BC9A 5AE1A 3GPCA 4DV5C 5A1IA 3CW9A 4RMNA 2M5HA 3CQ3A 4LF6C 2BH1X 3C5EA 3LNOA 4BSZA 2UXDC 5ADZA 4JI2C 1IBMC 4L2ZA 1XNRC 5IT9D 4B3TC 1O93A 1WH9A 4DV6C 3LAXA 4K0BA 4MTNA 4G1IA 4X66C 1IBLC 2ZTBA 1P4EC 4R1MA 2OPLB 3UX3A 3J7AD 1O92A 3PESA 2YCBA 3TQIA 2QW0X 3GR1A 2D1SA 2CU6A 3RG2A 3LGXA 3UZ0A 5LCIA 4NXMC 5BSUA 1XNQC 5DV9A 1WF3A 1JOSA 1MKYA 4DV3C 4JM1A 4DCTA 2DHMA 3UX2A 4LF9C 1UKKA 1LQLA 1BA3A 4HPVA 1EGAA 3K6RA 3A9UA 1YGTA 1MXBA 2XR1A 2UXBC 5AE2A 2PG1E 4XX2A 2E0GA 1M6XC 1P7LA 1PA4A 2D1QA 4DR7C 2ASBA 3IEVA 5LMUC 2UUAC 2AYAA 2Y4OA 3L8CA 4DR5C 1XDXA 3ETOA 1XRBA 5BR8C 5BSRA 2P20A 3UOWA 2PN2A 1MD9A 2YWCA 1HR0C 1USPB 3S82A 2WD9A 1LCIA 5E7QA 1N33C 4DR1C 4ZLPA 4I9GA 1K0RA 2ONFA 2OBVA 1XRCA 2P2QA 2QVZX 4B3MC 4JI3C 3J81D 2UXCC 5CZXA 1HNWC 3H2TA 4YHHC 2P2FA 4GXQA 3N2QA 5BUQA 4X64C 4RM2A 4D57A 5T8TA 5BUSA 2QL8A 4ISBA 5FLXD 3JAMD 2UU9C 1QWIA 5AE3A 4YY3C 4GXRA 3J80D 1TH5A 4FTFA 1I94C 3TDEA 4U5YD 3A9VA 1O9TA 4RLFA 2VZEA 5A1GA 1MXAA 2YX1A 4KTVA 3T1YC 2D7VA 2MM9A 4DR2C 5KEIA 4OX9C 2PROA 1FLOA 1UWDA 3A26A 2KZFA 3NPDA 3IEUA 1AMUA 5BSMA 2OO4A 4JI5C 1J5EC 3CQ1A 4D4IA 3A25A 2P2JA 2KDNA 5JRHA 1ZB8A 4L7IA 3I07A 4PUIA 2ZZNA 1N32C 4X62C 4DUZC 4DV4C 3L95X 1NY8A 1V26A 3FCCA 4RVOA 4GKKC 2JMPA 1YJ7A 1HH2P 3VNRA 2P2MA 2DYJA 1VLAA 2BJOA 4JV5C 4LF5C 3IPLA 2QVXX 2MMAB 4LF8C 4JI6C 3LUSA 3N54B 1ZB9A 3UEBA 2ATWA 5BSTA 1T5DX 2E8EA 1V25A 4D4GA 4DV0C 3LNVA 1T5HX 3EERA 4RVNA 2MCQA 5K85A 5BURA 2P02A 1FJGC 4DCSA 3DAYA 3E7WA 2CXCA 1WCJA 3A4IA 3R9XA 4RM3A 2M5OA 1L2FA 2ZZMA 1VEHA 4TPSB 1P4EA 2CY1A 2UUCC 4RLQA 2JNVA 2E5LC 5KYTA 4IR7A 1V60A 1XHJA 4DR3C 4DV7C 2KZ0A 4NXNC 4DR4C 4MH4A 5BSVA 1RY2A 4KTTA 3CJEA 3T1HC 3GR0A 2UUBC 4R0MA 2VQFC 5LMNC 4LF7C 3EQ6A 2D1RA 1O90A 1QM4A 3GKUA 5T8SA 5BSWA 4K0KC 2F4VC 4LFCC 4DV1C 2V7BA 4PUGA 1N34C 4BBYA 1M6XA 4DUYC 5H9UA 1MXCA 1N36C 4GS5A 1HNZC 3DLPX 5A19A 3TR3A 4DCUA 3ETCA 2Z51A 3KXWA 3E7XA 1XMOC 4LE5A 2DPLA 2VSQA 4OXIA 4DV2C 5K8FA 2D1TA 3NYRA 3IMLA 3NYQA 4NOZA 4L4QA 4GKJC 2Y27A 3SO4A 4FUQA 2E7GA 1NYEA 3FM7A
chains in the Genus database with same CATH topology
1GPMA 4JI8C 2OPLA 4AQYC 1MDFA 4B3SC 5GTDA 3FCEA 4JI0C 4FUTA 3PROC 2HJGA 1PG3A 4DR6C 2YWBA 4BC7A 3G7SA 4B3RC 4BCAA 3B7WA 4PZPA 3RV2A 5CZVA 4JI4C 4PHTA 3DHVA 2P2BA 3I08A 1XMQC 2D27A 1KKGA 3TUFA 3PBKA 4JI1C 3AF5A 4G37A 3OTOC 5KYVA 4LFAC 4DG9A 5IFIA 3R44A 4I9FA 2QVYX 4DG8A 3R9WA 3NI2A 1FUGA 1XRAA 3VNQA 3AF6A 2PT7G 2EGTA 4OYCA 2E8CA 4D56A 2Y4NA 4WS9A 2WP0C 1HNXC 1ULTA 4R1LA 1ML8A 1USPA 1IBKC 5A2QD 5IWAC 4X65C 4WV3A 4JYAC 2D28C 1N2FA 1MDBA 4ODJA 3CW8X 3VNSA 4ZJZA 4LFBC 4JI7C 2ZM6C 4IZ6A 4EATA 1RG9A 4NDNA 4DCVA 2HHHC 4LF4C 4PROC 2E8FA 2VQEC 1PG4A 4G36A 4KHPC 4BC9A 5AE1A 3GPCA 4DV5C 5A1IA 3CW9A 4RMNA 4LF6C 2BH1X 3C5EA 4BSZA 2UXDC 5ADZA 4JI2C 1IBMC 4L2ZA 1XNRC 5IT9D 4B3TC 1O93A 1WH9A 4DV6C 3LAXA 4K0BA 4MTNA 4G1IA 4X66C 1IBLC 4R1MA 2OPLB 3J7AD 1O92A 3PESA 2YCBA 3TQIA 2QW0X 3GR1A 2D1SA 3RG2A 3LGXA 3UZ0A 4NXMC 5BSUA 1XNQC 5DV9A 1WF3A 1JOSA 1MKYA 4DV3C 4JM1A 4DCTA 4LF9C 1UKKA 1LQLA 1BA3A 4HPVA 1EGAA 3A9UA 1MXBA 2XR1A 2UXBC 5AE2A 4XX2A 2E0GA 1P7LA 1PA4A 2D1QA 4DR7C 2ASBA 3IEVA 5LMUC 2UUAC 2AYAA 2Y4OA 3L8CA 4DR5C 3ETOA 1XRBA 5BR8C 5BSRA 2P20A 3UOWA 2PN2A 1MD9A 2YWCA 1HR0C 1USPB 3S82A 2WD9A 1LCIA 5E7QA 1N33C 4DR1C 4ZLPA 4I9GA 1K0RA 2ONFA 2OBVA 1XRCA 2P2QA 2QVZX 4B3MC 4JI3C 3J81D 2UXCC 5CZXA 1HNWC 3H2TA 4YHHC 2P2FA 4GXQA 3N2QA 5BUQA 4X64C 4RM2A 4D57A 5T8TA 5BUSA 2QL8A 4ISBA 5FLXD 3JAMD 2UU9C 1QWIA 5AE3A 4YY3C 4GXRA 3J80D 4FTFA 1I94C 3TDEA 4U5YD 3A9VA 1O9TA 4RLFA 2VZEA 5A1GA 1MXAA 4KTVA 3T1YC 2D7VA 4DR2C 5KEIA 4OX9C 2PROA 2KZFA 3NPDA 3IEUA 1AMUA 5BSMA 2OO4A 4JI5C 1J5EC 4D4IA 2P2JA 5JRHA 1ZB8A 4L7IA 3I07A 1N32C 4X62C 4DUZC 4DV4C 3L95X 1V26A 3FCCA 4RVOA 4GKKC 2JMPA 1YJ7A 1HH2P 3VNRA 2P2MA 2DYJA 1VLAA 2BJOA 4JV5C 4LF5C 3IPLA 2QVXX 4LF8C 4JI6C 3LUSA 3N54B 1ZB9A 2ATWA 5BSTA 1T5DX 2E8EA 1V25A 4D4GA 4DV0C 3LNVA 1T5HX 3EERA 4RVNA 5K85A 5BURA 2P02A 1FJGC 4DCSA 3DAYA 3E7WA 2CXCA 3A4IA 3R9XA 4RM3A 1L2FA 4TPSB 2CY1A 2UUCC 4RLQA 2E5LC 5KYTA 4IR7A 4DR3C 4DV7C 4NXNC 4DR4C 4MH4A 5BSVA 1RY2A 4KTTA 3CJEA 3T1HC 3GR0A 2UUBC 4R0MA 2VQFC 5LMNC 4LF7C 3EQ6A 2D1RA 1O90A 1QM4A 3GKUA 5T8SA 5BSWA 4K0KC 2F4VC 4LFCC 4DV1C 2V7BA 1N34C 4BBYA 4DUYC 5H9UA 1MXCA 1N36C 4GS5A 1HNZC 3DLPX 5A19A 4DCUA 3ETCA 3KXWA 3E7XA 1XMOC 4LE5A 2DPLA 2VSQA 4OXIA 4DV2C 5K8FA 2D1TA 3NYRA 3IMLA 3NYQA 4NOZA 4L4QA 4GKJC 2Y27A 3SO4A 4FUQA 2E7GA 1NYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP B;  2E8F A;  2VQE C;  1FJG C;  4JI8 C;  4DCS A;  1N33 C;  4DR1 C;  4KHP C;  1K0R A;  2ONF A;  2OPL A;  2CXC A;  4AQY C;  4B3S C;  4DV5 C;  3R9X A;  1L2F A;  4B3M C;  4JI3 C;  3J81 D;  2UXC C;  4JI0 C;  1HNW C;  4YHH C;  4LF6 C;  2CY1 A;  4BSZ A;  2HJG A;  4X64 C;  2UUC C;  2UXD C;  4DR6 C;  2E5L C;  4JI2 C;  1IBM C;  4B3R C;  1XNR C;  5IT9 D;  4B3T C;  2QL8 A;  5FLX D;  3JAM D;  2UU9 C;  4JI4 C;  1WH9 A;  4DR3 C;  1QWI A;  4DV7 C;  4YY3 C;  3J80 D;  4NXN C;  4DR4 C;  4MH4 A;  4DV6 C;  1XMQ C;  1I94 C;  4MTN A;  1KKG A;  3CJE A;  4X66 C;  1IBL C;  3AF5 A;  4JI1 C;  3T1H C;  3OTO C;  2UUB C;  4LFA C;  2OPL B;  3J7A D;  2VQF C;  5LMN C;  3T1Y C;  2D7V A;  4LF7 C;  4DR2 C;  2YCB A;  3R9W A;  4OX9 C;  3GKU A;  4K0K C;  2F4V C;  3AF6 A;  2PT7 G;  2EGT A;  2KZF A;  3IEU A;  2E8C A;  4LFC C;  4DV1 C;  4NXM C;  4JI5 C;  1J5E C;  1XNQ C;  1N34 C;  4LF4 C;  1HNX C;  1WF3 A;  4DUY C;  1ZB8 A;  1JOS A;  1MKY A;  4DV3 C;  4DCT A;  3I07 A;  1N32 C;  1N36 C;  4X62 C;  1ML8 A;  1USP A;  4LF9 C;  1UKK A;  1LQL A;  4DUZ C;  4DV4 C;  1IBK C;  5A2Q D;  1EGA A;  5IWA C;  4X65 C;  1HNZ C;  4JYA C;  4GKK C;  4DCU A;  2XR1 A;  2JMP A;  1N2F A;  1HH2 P;  2UXB C;  2DYJ A;  1VLA A;  2BJO A;  4XX2 A;  1XMO C;  4JV5 C;  4LFB C;  4LF5 C;  4JI7 C;  1PA4 A;  4DR7 C;  4LF8 C;  2ZM6 C;  2ASB A;  3IEV A;  5LMU C;  4JI6 C;  3LUS A;  4DV2 C;  1ZB9 A;  2ATW A;  2UUA C;  2E8E A;  4NOZ A;  4GKJ C;  4DV0 C;  4DR5 C;  5BR8 C;  4DCV A;  3EER A;  2PN2 A;  1HR0 C;  2HHH C;  2E7G A;  1NYE A; 
#chains in the Genus database with same CATH topology
 1GPM A;  4JI8 C;  2OPL A;  4AQY C;  1MDF A;  4B3S C;  5GTD A;  3FCE A;  4JI0 C;  4FUT A;  3PRO C;  2HJG A;  1IB8 A;  1PG3 A;  4DR6 C;  1XS3 A;  2YWB A;  4BC7 A;  3G7S A;  4B3R C;  4BCA A;  3B7W A;  4PZP A;  3RV2 A;  5CZV A;  4JI4 C;  1PU1 A;  4PHT A;  3DHV A;  2P2B A;  3I08 A;  1XMQ C;  2NCL A;  2D27 A;  1KKG A;  3TUF A;  3PBK A;  4JI1 C;  3AF5 A;  4G37 A;  3OTO C;  5KYV A;  4LFA C;  4DG9 A;  5IFI A;  3R44 A;  4I9F A;  2QVY X;  4DG8 A;  3O2E A;  3R9W A;  3NI2 A;  1FUG A;  1XRA A;  3VNQ A;  3CQ2 A;  3AF6 A;  2PT7 G;  2EGT A;  4OYC A;  2E8C A;  4D56 A;  2Y4N A;  4WS9 A;  3AY0 A;  2WP0 C;  1HNX C;  1ULT A;  4R1L A;  1ML8 A;  1USP A;  1IBK C;  5A2Q D;  5IWA C;  4X65 C;  4WV3 A;  4JYA C;  2D28 C;  1N2F A;  1MDB A;  4ODJ A;  3CW8 X;  3VNS A;  4ZJZ A;  4LFB C;  4JI7 C;  4PUH A;  2ZM6 C;  4IZ6 A;  4EAT A;  1RG9 A;  4NDN A;  4DCV A;  2HHH C;  4LF4 C;  4PRO C;  2E8F A;  2VQE C;  1PG4 A;  4G36 A;  4KHP C;  4BC9 A;  5AE1 A;  3GPC A;  4DV5 C;  5A1I A;  3CW9 A;  4RMN A;  2M5H A;  3CQ3 A;  4LF6 C;  2BH1 X;  3C5E A;  3LNO A;  4BSZ A;  2UXD C;  5ADZ A;  4JI2 C;  1IBM C;  4L2Z A;  1XNR C;  5IT9 D;  4B3T C;  1O93 A;  1WH9 A;  4DV6 C;  3LAX A;  4K0B A;  4MTN A;  4G1I A;  4X66 C;  1IBL C;  2ZTB A;  1P4E C;  4R1M A;  2OPL B;  3UX3 A;  3J7A D;  1O92 A;  3PES A;  2YCB A;  3TQI A;  2QW0 X;  3GR1 A;  2D1S A;  2CU6 A;  3RG2 A;  3LGX A;  3UZ0 A;  5LCI A;  4NXM C;  5BSU A;  1XNQ C;  5DV9 A;  1WF3 A;  1JOS A;  1MKY A;  4DV3 C;  4JM1 A;  4DCT A;  2DHM A;  3UX2 A;  4LF9 C;  1UKK A;  1LQL A;  1BA3 A;  4HPV A;  1EGA A;  3K6R A;  3A9U A;  1YGT A;  1MXB A;  2XR1 A;  2UXB C;  5AE2 A;  2PG1 E;  4XX2 A;  2E0G A;  1M6X C;  1P7L A;  1PA4 A;  2D1Q A;  4DR7 C;  2ASB A;  3IEV A;  5LMU C;  2UUA C;  2AYA A;  2Y4O A;  3L8C A;  4DR5 C;  1XDX A;  3ETO A;  1XRB A;  5BR8 C;  5BSR A;  2P20 A;  3UOW A;  2PN2 A;  1MD9 A;  2YWC A;  1HR0 C;  1USP B;  3S82 A;  2WD9 A;  1LCI A;  5E7Q A;  1N33 C;  4DR1 C;  4ZLP A;  4I9G A;  1K0R A;  2ONF A;  2OBV A;  1XRC A;  2P2Q A;  2QVZ X;  4B3M C;  4JI3 C;  3J81 D;  2UXC C;  5CZX A;  1HNW C;  3H2T A;  4YHH C;  2P2F A;  4GXQ A;  3N2Q A;  5BUQ A;  4X64 C;  4RM2 A;  4D57 A;  5T8T A;  5BUS A;  2QL8 A;  4ISB A;  5FLX D;  3JAM D;  2UU9 C;  1QWI A;  5AE3 A;  4YY3 C;  4GXR A;  3J80 D;  1TH5 A;  4FTF A;  1I94 C;  3TDE A;  4U5Y D;  3A9V A;  1O9T A;  4RLF A;  2VZE A;  5A1G A;  1MXA A;  2YX1 A;  4KTV A;  3T1Y C;  2D7V A;  2MM9 A;  4DR2 C;  5KEI A;  4OX9 C;  2PRO A;  1FLO A;  1UWD A;  3A26 A;  2KZF A;  3NPD A;  3IEU A;  1AMU A;  5BSM A;  2OO4 A;  4JI5 C;  1J5E C;  3CQ1 A;  4D4I A;  3A25 A;  2P2J A;  2KDN A;  5JRH A;  1ZB8 A;  4L7I A;  3I07 A;  4PUI A;  2ZZN A;  1N32 C;  4X62 C;  4DUZ C;  4DV4 C;  3L95 X;  1NY8 A;  1V26 A;  3FCC A;  4RVO A;  4GKK C;  2JMP A;  1YJ7 A;  1HH2 P;  3VNR A;  2P2M A;  2DYJ A;  1VLA A;  2BJO A;  4JV5 C;  4LF5 C;  3IPL A;  2QVX X;  2MMA B;  4LF8 C;  4JI6 C;  3LUS A;  3N54 B;  1ZB9 A;  3UEB A;  2ATW A;  5BST A;  1T5D X;  2E8E A;  1V25 A;  4D4G A;  4DV0 C;  3LNV A;  1T5H X;  3EER A;  4RVN A;  2MCQ A;  5K85 A;  5BUR A;  2P02 A;  1FJG C;  4DCS A;  3DAY A;  3E7W A;  2CXC A;  1WCJ A;  3A4I A;  3R9X A;  4RM3 A;  2M5O A;  1L2F A;  2ZZM A;  1VEH A;  4TPS B;  1P4E A;  2CY1 A;  2UUC C;  4RLQ A;  2JNV A;  2E5L C;  5KYT A;  4IR7 A;  1V60 A;  1XHJ A;  4DR3 C;  4DV7 C;  2KZ0 A;  4NXN C;  4DR4 C;  4MH4 A;  5BSV A;  1RY2 A;  4KTT A;  3CJE A;  3T1H C;  3GR0 A;  2UUB C;  4R0M A;  2VQF C;  5LMN C;  4LF7 C;  3EQ6 A;  2D1R A;  1O90 A;  1QM4 A;  3GKU A;  5T8S A;  5BSW A;  4K0K C;  2F4V C;  4LFC C;  4DV1 C;  2V7B A;  4PUG A;  1N34 C;  4BBY A;  1M6X A;  4DUY C;  5H9U A;  1MXC A;  1N36 C;  4GS5 A;  1HNZ C;  3DLP X;  5A19 A;  3TR3 A;  4DCU A;  3ETC A;  2Z51 A;  3KXW A;  3E7X A;  1XMO C;  4LE5 A;  2DPL A;  2VSQ A;  4OXI A;  4DV2 C;  5K8F A;  2D1T A;  3NYR A;  3IML A;  3NYQ A;  4NOZ A;  4L4Q A;  4GKJ C;  2Y27 A;  3SO4 A;  4FUQ A;  2E7G A;  1NYE A;  3FM7 A; 
#chains in the Genus database with same CATH homology
 1GPM A;  4JI8 C;  2OPL A;  4AQY C;  1MDF A;  4B3S C;  5GTD A;  3FCE A;  4JI0 C;  4FUT A;  3PRO C;  2HJG A;  1PG3 A;  4DR6 C;  2YWB A;  4BC7 A;  3G7S A;  4B3R C;  4BCA A;  3B7W A;  4PZP A;  3RV2 A;  5CZV A;  4JI4 C;  4PHT A;  3DHV A;  2P2B A;  3I08 A;  1XMQ C;  2D27 A;  1KKG A;  3TUF A;  3PBK A;  4JI1 C;  3AF5 A;  4G37 A;  3OTO C;  5KYV A;  4LFA C;  4DG9 A;  5IFI A;  3R44 A;  4I9F A;  2QVY X;  4DG8 A;  3R9W A;  3NI2 A;  1FUG A;  1XRA A;  3VNQ A;  3AF6 A;  2PT7 G;  2EGT A;  4OYC A;  2E8C A;  4D56 A;  2Y4N A;  4WS9 A;  2WP0 C;  1HNX C;  1ULT A;  4R1L A;  1ML8 A;  1USP A;  1IBK C;  5A2Q D;  5IWA C;  4X65 C;  4WV3 A;  4JYA C;  2D28 C;  1N2F A;  1MDB A;  4ODJ A;  3CW8 X;  3VNS A;  4ZJZ A;  4LFB C;  4JI7 C;  2ZM6 C;  4IZ6 A;  4EAT A;  1RG9 A;  4NDN A;  4DCV A;  2HHH C;  4LF4 C;  4PRO C;  2E8F A;  2VQE C;  1PG4 A;  4G36 A;  4KHP C;  4BC9 A;  5AE1 A;  3GPC A;  4DV5 C;  5A1I A;  3CW9 A;  4RMN A;  4LF6 C;  2BH1 X;  3C5E A;  4BSZ A;  2UXD C;  5ADZ A;  4JI2 C;  1IBM C;  4L2Z A;  1XNR C;  5IT9 D;  4B3T C;  1O93 A;  1WH9 A;  4DV6 C;  3LAX A;  4K0B A;  4MTN A;  4G1I A;  4X66 C;  1IBL C;  4R1M A;  2OPL B;  3J7A D;  1O92 A;  3PES A;  2YCB A;  3TQI A;  2QW0 X;  3GR1 A;  2D1S A;  3RG2 A;  3LGX A;  3UZ0 A;  4NXM C;  5BSU A;  1XNQ C;  5DV9 A;  1WF3 A;  1JOS A;  1MKY A;  4DV3 C;  4JM1 A;  4DCT A;  4LF9 C;  1UKK A;  1LQL A;  1BA3 A;  4HPV A;  1EGA A;  3A9U A;  1MXB A;  2XR1 A;  2UXB C;  5AE2 A;  4XX2 A;  2E0G A;  1P7L A;  1PA4 A;  2D1Q A;  4DR7 C;  2ASB A;  3IEV A;  5LMU C;  2UUA C;  2AYA A;  2Y4O A;  3L8C A;  4DR5 C;  3ETO A;  1XRB A;  5BR8 C;  5BSR A;  2P20 A;  3UOW A;  2PN2 A;  1MD9 A;  2YWC A;  1HR0 C;  1USP B;  3S82 A;  2WD9 A;  1LCI A;  5E7Q A;  1N33 C;  4DR1 C;  4ZLP A;  4I9G A;  1K0R A;  2ONF A;  2OBV A;  1XRC A;  2P2Q A;  2QVZ X;  4B3M C;  4JI3 C;  3J81 D;  2UXC C;  5CZX A;  1HNW C;  3H2T A;  4YHH C;  2P2F A;  4GXQ A;  3N2Q A;  5BUQ A;  4X64 C;  4RM2 A;  4D57 A;  5T8T A;  5BUS A;  2QL8 A;  4ISB A;  5FLX D;  3JAM D;  2UU9 C;  1QWI A;  5AE3 A;  4YY3 C;  4GXR A;  3J80 D;  4FTF A;  1I94 C;  3TDE A;  4U5Y D;  3A9V A;  1O9T A;  4RLF A;  2VZE A;  5A1G A;  1MXA A;  4KTV A;  3T1Y C;  2D7V A;  4DR2 C;  5KEI A;  4OX9 C;  2PRO A;  2KZF A;  3NPD A;  3IEU A;  1AMU A;  5BSM A;  2OO4 A;  4JI5 C;  1J5E C;  4D4I A;  2P2J A;  5JRH A;  1ZB8 A;  4L7I A;  3I07 A;  1N32 C;  4X62 C;  4DUZ C;  4DV4 C;  3L95 X;  1V26 A;  3FCC A;  4RVO A;  4GKK C;  2JMP A;  1YJ7 A;  1HH2 P;  3VNR A;  2P2M A;  2DYJ A;  1VLA A;  2BJO A;  4JV5 C;  4LF5 C;  3IPL A;  2QVX X;  4LF8 C;  4JI6 C;  3LUS A;  3N54 B;  1ZB9 A;  2ATW A;  5BST A;  1T5D X;  2E8E A;  1V25 A;  4D4G A;  4DV0 C;  3LNV A;  1T5H X;  3EER A;  4RVN A;  5K85 A;  5BUR A;  2P02 A;  1FJG C;  4DCS A;  3DAY A;  3E7W A;  2CXC A;  3A4I A;  3R9X A;  4RM3 A;  1L2F A;  4TPS B;  2CY1 A;  2UUC C;  4RLQ A;  2E5L C;  5KYT A;  4IR7 A;  4DR3 C;  4DV7 C;  4NXN C;  4DR4 C;  4MH4 A;  5BSV A;  1RY2 A;  4KTT A;  3CJE A;  3T1H C;  3GR0 A;  2UUB C;  4R0M A;  2VQF C;  5LMN C;  4LF7 C;  3EQ6 A;  2D1R A;  1O90 A;  1QM4 A;  3GKU A;  5T8S A;  5BSW A;  4K0K C;  2F4V C;  4LFC C;  4DV1 C;  2V7B A;  1N34 C;  4BBY A;  4DUY C;  5H9U A;  1MXC A;  1N36 C;  4GS5 A;  1HNZ C;  3DLP X;  5A19 A;  4DCU A;  3ETC A;  3KXW A;  3E7X A;  1XMO C;  4LE5 A;  2DPL A;  2VSQ A;  4OXI A;  4DV2 C;  5K8F A;  2D1T A;  3NYR A;  3IML A;  3NYQ A;  4NOZ A;  4L4Q A;  4GKJ C;  2Y27 A;  3SO4 A;  4FUQ A;  2E7G A;  1NYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...