1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
1N2FA 2DYJA 2E5LC 2E8FA 1N34C 5LMUC 3J7AD 4X62C 4NOZA 4X64C 2E8CA 4JI5C 1MKYA 1ML8A 5FLXD 3JAMD 4LF7C 4DUZC 2UUAC 1K0RA 2ATWA 3T1HC 3R9WA 2CXCA 1JOSA 1USPA 2UXCC 4LF4C 1ZB8A 2EGTA 4LFCC 1N32C 4AQYC 3J80D 4X65C 4DV6C 4DV1C 1N33C 5LMNC 4K0KC 3OTOC 3IEVA 2OPLA 5A2QD 4LF9C 2QL8A 4DUYC 4JI1C 4DV0C 1PA4A 2UU9C 4GKJC 2ASBA 1WF3A 4DV2C 4LFBC 2ONFA 1USPB 2CY1A 2VQFC 4YHHC 2E7GA 1HNWC 4JI0C 2JMPA 4DV3C 4JI6C 1HR0C 2D7VA 1N36C 1HH2P 3LUSA 5IWAC 2UXDC 4B3RC 2F4VC 1QWIA 4B3SC 4B3MC 4GKKC 4JV5C 4DCUA 1ZB9A 1XMOC 4JI7C 4JI8C 4LF8C 3AF6A 4MTNA 4BSZA 4KHPC 2YCBA 4X66C 1IBKC 4LFAC 4DCTA 1UKKA 4JI4C 2UUBC 4OX9C 3CJEA 5IT9D 2HJGA 4DV4C 4DR1C 2XR1A 4B3TC 1IBMC 3GKUA 4LF5C 2KZFA 3I07A 1NYEA 1L2FA 2UUCC 1HNZC 4JI2C 1EGAA 4JYAC 2E8EA 4DCVA 4DCSA 4DV5C 4NXMC 3T1YC 4JI3C 1KKGA 1FJGC 4DR4C 5BR8C 4XX2A 1I94C 2UXBC 4DR7C 1WH9A 4MH4A 1VLAA 4DR3C 1IBLC 4NXNC 1HNXC 4DR5C 1XNQC 1J5EC 4DR2C 2VQEC 1XNRC 1LQLA 3AF5A 3IEUA 3R9XA 3EERA 2BJOA 2HHHC 2PT7G 4YY3C 2ZM6C 4LF6C 1XMQC 4DR6C 3J81D 4DV7C 2OPLB 2PN2A
chains in the Genus database with same CATH superfamily
2E8FA 1N34C 5BUQA 3J7AD 4NOZA 2OBVA 3B7WA 3I08A 5K8FA 2BH1X 4PUGA 5BSUA 5BURA 4R1MA 5IFIA 2UXCC 2ZTBA 4LF4C 4L7IA 2PG1E 4JM1A 4AQYC 3CW9A 4I9FA 3UOWA 3FM7A 3PESA 5KYVA 4DV1C 2MMAB 1MXAA 4BCAA 3NI2A 3UZ0A 5A2QD 4RMNA 1P4EA 4RVOA 2MCQA 1WF3A 4DG9A 2ONFA 4FUTA 2E7GA 3FCEA 2JMPA 2DPLA 3CW8X 2YWCA 5A1IA 4PUHA 1N36C 2P2QA 1V26A 1PU1A 2UXDC 2KDNA 1IB8A 3TR3A 4G36A 1XMOC 4D4IA 4WS9A 3G7SA 1WCJA 3VNQA 2OO4A 4OYCA 4G37A 4OX9C 4GXQA 4R0MA 3TUFA 4DR1C 3S82A 2XR1A 1LCIA 2D1RA 5BSRA 1L2FA 2UUCC 3UEBA 2P02A 3NYQA 5BUSA 2DHMA 2PROA 4D4GA 3TDEA 4D56A 1FJGC 2CU6A 4DR4C 1V60A 3LNOA 2UXBC 4DR7C 4ZLPA 4DR5C 1J5EC 2M5HA 3NYRA 1XMQC 1P4EC 4DG8A 4NDNA 2ZZNA 5BSWA 1M6XA 3SO4A 2DYJA 5A19A 2E5LC 5BSMA 2Y27A 3K6RA 1MKYA 3N54B 4GXRA 2UUAC 1K0RA 1JOSA 2P2JA 1NY8A 4X65C 4DV6C 2QVZX 5LMNC 3OTOC 4IR7A 4BC9A 2OPLA 4LF9C 2QL8A 2YWBA 4JI1C 2JNVA 5AE1A 4LFBC 2NCLA 3GPCA 4YHHC 1HNWC 4KTTA 4ZJZA 2Y4OA 1HH2P 2KZ0A 5DV9A 5LCIA 3LUSA 3FCCA 1ZB9A 4JI8C 4MTNA 1IBKC 4X66C 4LFAC 4DCTA 5GTDA 4GS5A 1UKKA 1XHJA 5E7QA 4I9GA 2D1QA 2P2MA 4B3TC 4RVNA 3GKUA 1XRCA 4WV3A 3IPLA 3H2TA 2VZEA 1HNZC 1MXBA 1M6XC 4RM2A 4U5YD 4EATA 2QW0X 1XNQC 4DR2C 3IEUA 2P20A 2BJOA 2YX1A 2WP0C 2HHHC 2ZM6C 2QVYX 5CZVA 1XRAA 4PZPA 1MDBA 1N2FA 3NPDA 5LMUC 4X62C 1RY2A 3A26A 4JI5C 4FUQA 1XDXA 5FLXD 3JAMD 3R44A 4DUZC 2ATWA 3T1HC 1ZB8A 3LAXA 1QM4A 1PG3A 3A4IA 3IEVA 4DUYC 2UU9C 4K0BA 1XS3A 2VQFC 2Z51A 3AY0A 5K85A 4JI6C 4R1LA 2ZZMA 3LGXA 2D7VA 4G1IA 3PBKA 1QWIA 4GKKC 4DCUA 4JI7C 4LF8C 4LE5A 1GPMA 2YCBA 2D1SA 5A1GA 3CJEA 2VSQA 2HJGA 2D1TA 5CZXA 4DV4C 2QVXX 2KZFA 3O2EA 3ETCA 5ADZA 1O9TA 4JI2C 4L4QA 1YGTA 4JYAC 3CQ3A 4FTFA 2E8EA 4DCSA 4NXMC 4L2ZA 4JI3C 2D28C 5BSVA 3A25A 2P2FA 2MM9A 4IZ6A 5BR8C 3C5EA 1T5DX 1TH5A 4MH4A 1ULTA 4NXNC 1HNXC 4RM3A 5JRHA 3UX2A 3GR0A 3L8CA 2AYAA 2VQEC 1LQLA 3AF5A 3KXWA 3EERA 3L95X 2PT7G 4YY3C 1YJ7A 5BSTA 4DV7C 4RLQA 1AMUA 4ISBA 1MD9A 1BA3A 1XRBA 4D57A 4X64C 2E8CA 1ML8A 3A9VA 4LF7C 3VNSA 3R9WA 2CXCA 1USPA 1V25A 2EGTA 4LFCC 1N32C 2V7BA 3J80D 5T8SA 1N33C 4K0KC 5H9UA 3EQ6A 3LNVA 4DV0C 1PA4A 4GKJC 4ODJA 2ASBA 4OXIA 3E7XA 5AE3A 4DV2C 1USPB 2CY1A 1FLOA 4PHTA 4JI0C 4DV3C 3A9UA 1HR0C 3CQ2A 3GR1A 1UWDA 1VEHA 5IWAC 3ETOA 4B3RC 5T8TA 2F4VC 4B3SC 1RG9A 4B3MC 4JV5C 3AF6A 4BSZA 4KHPC 2E0GA 4HPVA 1O92A 4JI4C 2UUBC 1P7LA 1MDFA 1T5HX 5IT9D 2D27A 5KEIA 4PROC 1IBMC 1O93A 4LF5C 3I07A 3TQIA 1NYEA 4BC7A 4RLFA 5KYTA 2WD9A 3RV2A 1EGAA 3DAYA 3VNRA 4DV5C 4DCVA 3T1YC 4KTVA 1PG4A 1FUGA 4BBYA 1KKGA 4XX2A 3IMLA 1I94C 1WH9A 2M5OA 4PUIA 1VLAA 4DR3C 3DLPX 1IBLC 3DHVA 4TPSB 3UX3A 2P2BA 3RG2A 3E7WA 1XNRC 3R9XA 4LF6C 1O90A 3CQ1A 2Y4NA 1MXCA 4DR6C 3PROC 3J81D 5AE2A 3N2QA 2OPLB 2PN2A
chains in the Genus database with same CATH topology
2E8FA 1N34C 5BUQA 3J7AD 4NOZA 2OBVA 3B7WA 3I08A 5K8FA 2BH1X 5BSUA 5BURA 4R1MA 5IFIA 2UXCC 4LF4C 4L7IA 4JM1A 4AQYC 3CW9A 4I9FA 3UOWA 3PESA 5KYVA 4DV1C 1MXAA 4BCAA 3NI2A 3UZ0A 5A2QD 4RMNA 4RVOA 1WF3A 4DG9A 2ONFA 4FUTA 2E7GA 3FCEA 2JMPA 2DPLA 3CW8X 2YWCA 5A1IA 1N36C 2P2QA 1V26A 2UXDC 4G36A 1XMOC 4D4IA 4WS9A 3G7SA 3VNQA 2OO4A 4OYCA 4G37A 4OX9C 4GXQA 4R0MA 3TUFA 4DR1C 3S82A 2XR1A 1LCIA 2D1RA 5BSRA 1L2FA 2UUCC 2P02A 3NYQA 5BUSA 2PROA 4D4GA 3TDEA 4D56A 1FJGC 4DR4C 2UXBC 4DR7C 4ZLPA 4DR5C 1J5EC 3NYRA 1XMQC 4DG8A 4NDNA 5BSWA 3SO4A 2DYJA 5A19A 2E5LC 5BSMA 2Y27A 1MKYA 3N54B 4GXRA 2UUAC 1K0RA 1JOSA 2P2JA 4X65C 4DV6C 2QVZX 5LMNC 3OTOC 4IR7A 4BC9A 2OPLA 4LF9C 2QL8A 2YWBA 4JI1C 5AE1A 4LFBC 3GPCA 4YHHC 1HNWC 4KTTA 4ZJZA 2Y4OA 1HH2P 5DV9A 3LUSA 3FCCA 1ZB9A 4JI8C 4MTNA 1IBKC 4X66C 4LFAC 4DCTA 5GTDA 4GS5A 1UKKA 5E7QA 4I9GA 2D1QA 2P2MA 4B3TC 4RVNA 3GKUA 1XRCA 4WV3A 3IPLA 3H2TA 2VZEA 1HNZC 1MXBA 4RM2A 4U5YD 4EATA 2QW0X 1XNQC 4DR2C 3IEUA 2P20A 2BJOA 2WP0C 2HHHC 2ZM6C 2QVYX 5CZVA 1XRAA 4PZPA 1MDBA 1N2FA 3NPDA 5LMUC 4X62C 1RY2A 4JI5C 4FUQA 5FLXD 3JAMD 3R44A 4DUZC 2ATWA 3T1HC 1ZB8A 3LAXA 1QM4A 1PG3A 3A4IA 3IEVA 4DUYC 2UU9C 4K0BA 2VQFC 5K85A 4JI6C 4R1LA 3LGXA 2D7VA 4G1IA 3PBKA 1QWIA 4GKKC 4DCUA 4JI7C 4LF8C 4LE5A 1GPMA 2YCBA 2D1SA 5A1GA 3CJEA 2VSQA 2HJGA 2D1TA 5CZXA 4DV4C 2QVXX 2KZFA 3ETCA 5ADZA 1O9TA 4JI2C 4L4QA 4JYAC 4FTFA 2E8EA 4DCSA 4NXMC 4L2ZA 4JI3C 2D28C 5BSVA 2P2FA 4IZ6A 5BR8C 3C5EA 1T5DX 4MH4A 4NXNC 1ULTA 1HNXC 4RM3A 5JRHA 3GR0A 3L8CA 2AYAA 2VQEC 1LQLA 3AF5A 3KXWA 3EERA 3L95X 2PT7G 4YY3C 1YJ7A 5BSTA 4DV7C 4RLQA 1AMUA 4ISBA 1MD9A 1BA3A 1XRBA 4D57A 4X64C 2E8CA 1ML8A 3A9VA 4LF7C 3VNSA 3R9WA 2CXCA 1USPA 1V25A 2EGTA 4LFCC 1N32C 2V7BA 3J80D 5T8SA 1N33C 4K0KC 5H9UA 3EQ6A 3LNVA 4DV0C 1PA4A 4GKJC 4ODJA 2ASBA 4OXIA 3E7XA 5AE3A 4DV2C 1USPB 2CY1A 4PHTA 4JI0C 4DV3C 3A9UA 1HR0C 3GR1A 5IWAC 3ETOA 4B3RC 5T8TA 2F4VC 4B3SC 1RG9A 4B3MC 4JV5C 3AF6A 4BSZA 4KHPC 2E0GA 4HPVA 1O92A 4JI4C 2UUBC 1P7LA 1MDFA 1T5HX 5IT9D 2D27A 5KEIA 4PROC 1IBMC 1O93A 4LF5C 3I07A 3TQIA 1NYEA 4BC7A 4RLFA 5KYTA 2WD9A 3RV2A 1EGAA 3DAYA 3VNRA 4DV5C 4DCVA 3T1YC 4KTVA 1PG4A 1FUGA 4BBYA 1KKGA 4XX2A 3IMLA 1I94C 1WH9A 1VLAA 4DR3C 3DLPX 1IBLC 3DHVA 4TPSB 2P2BA 3RG2A 3E7WA 1XNRC 3R9XA 4LF6C 1O90A 2Y4NA 1MXCA 4DR6C 3PROC 3J81D 5AE2A 3N2QA 2OPLB 2PN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  2DYJ A;  2E5L C;  2E8F A;  1N34 C;  5LMU C;  3J7A D;  4X62 C;  4NOZ A;  4X64 C;  2E8C A;  4JI5 C;  1MKY A;  1ML8 A;  5FLX D;  3JAM D;  4LF7 C;  4DUZ C;  2UUA C;  1K0R A;  2ATW A;  3T1H C;  3R9W A;  2CXC A;  1JOS A;  1USP A;  2UXC C;  4LF4 C;  1ZB8 A;  2EGT A;  4LFC C;  1N32 C;  4AQY C;  3J80 D;  4X65 C;  4DV6 C;  4DV1 C;  1N33 C;  5LMN C;  4K0K C;  3OTO C;  3IEV A;  2OPL A;  5A2Q D;  4LF9 C;  2QL8 A;  4DUY C;  4JI1 C;  4DV0 C;  1PA4 A;  2UU9 C;  4GKJ C;  2ASB A;  1WF3 A;  4DV2 C;  4LFB C;  2ONF A;  1USP B;  2CY1 A;  2VQF C;  4YHH C;  2E7G A;  1HNW C;  4JI0 C;  2JMP A;  4DV3 C;  4JI6 C;  1HR0 C;  2D7V A;  1N36 C;  1HH2 P;  3LUS A;  5IWA C;  2UXD C;  4B3R C;  2F4V C;  1QWI A;  4B3S C;  4B3M C;  4GKK C;  4JV5 C;  4DCU A;  1ZB9 A;  1XMO C;  4JI7 C;  4JI8 C;  4LF8 C;  3AF6 A;  4MTN A;  4BSZ A;  4KHP C;  2YCB A;  4X66 C;  1IBK C;  4LFA C;  4DCT A;  1UKK A;  4JI4 C;  2UUB C;  4OX9 C;  3CJE A;  5IT9 D;  2HJG A;  4DV4 C;  4DR1 C;  2XR1 A;  4B3T C;  1IBM C;  3GKU A;  4LF5 C;  2KZF A;  3I07 A;  1NYE A;  1L2F A;  2UUC C;  1HNZ C;  4JI2 C;  1EGA A;  4JYA C;  2E8E A;  4DCV A;  4DCS A;  4DV5 C;  4NXM C;  3T1Y C;  4JI3 C;  1KKG A;  1FJG C;  4DR4 C;  5BR8 C;  4XX2 A;  1I94 C;  2UXB C;  4DR7 C;  1WH9 A;  4MH4 A;  1VLA A;  4DR3 C;  1IBL C;  4NXN C;  1HNX C;  4DR5 C;  1XNQ C;  1J5E C;  4DR2 C;  2VQE C;  1XNR C;  1LQL A;  3AF5 A;  3IEU A;  3R9X A;  3EER A;  2BJO A;  2HHH C;  2PT7 G;  4YY3 C;  2ZM6 C;  4LF6 C;  1XMQ C;  4DR6 C;  3J81 D;  4DV7 C;  2OPL B;  2PN2 A; 
#chains in the Genus database with same CATH topology
 2E8F A;  1N34 C;  5BUQ A;  3J7A D;  4NOZ A;  2OBV A;  3B7W A;  3I08 A;  5K8F A;  2BH1 X;  4PUG A;  5BSU A;  5BUR A;  4R1M A;  5IFI A;  2UXC C;  2ZTB A;  4LF4 C;  4L7I A;  2PG1 E;  4JM1 A;  4AQY C;  3CW9 A;  4I9F A;  3UOW A;  3FM7 A;  3PES A;  5KYV A;  4DV1 C;  2MMA B;  1MXA A;  4BCA A;  3NI2 A;  3UZ0 A;  5A2Q D;  4RMN A;  1P4E A;  4RVO A;  2MCQ A;  1WF3 A;  4DG9 A;  2ONF A;  4FUT A;  2E7G A;  3FCE A;  2JMP A;  2DPL A;  3CW8 X;  2YWC A;  5A1I A;  4PUH A;  1N36 C;  2P2Q A;  1V26 A;  1PU1 A;  2UXD C;  2KDN A;  1IB8 A;  3TR3 A;  4G36 A;  1XMO C;  4D4I A;  4WS9 A;  3G7S A;  1WCJ A;  3VNQ A;  2OO4 A;  4OYC A;  4G37 A;  4OX9 C;  4GXQ A;  4R0M A;  3TUF A;  4DR1 C;  3S82 A;  2XR1 A;  1LCI A;  2D1R A;  5BSR A;  1L2F A;  2UUC C;  3UEB A;  2P02 A;  3NYQ A;  5BUS A;  2DHM A;  2PRO A;  4D4G A;  3TDE A;  4D56 A;  1FJG C;  2CU6 A;  4DR4 C;  1V60 A;  3LNO A;  2UXB C;  4DR7 C;  4ZLP A;  4DR5 C;  1J5E C;  2M5H A;  3NYR A;  1XMQ C;  1P4E C;  4DG8 A;  4NDN A;  2ZZN A;  5BSW A;  1M6X A;  3SO4 A;  2DYJ A;  5A19 A;  2E5L C;  5BSM A;  2Y27 A;  3K6R A;  1MKY A;  3N54 B;  4GXR A;  2UUA C;  1K0R A;  1JOS A;  2P2J A;  1NY8 A;  4X65 C;  4DV6 C;  2QVZ X;  5LMN C;  3OTO C;  4IR7 A;  4BC9 A;  2OPL A;  4LF9 C;  2QL8 A;  2YWB A;  4JI1 C;  2JNV A;  5AE1 A;  4LFB C;  2NCL A;  3GPC A;  4YHH C;  1HNW C;  4KTT A;  4ZJZ A;  2Y4O A;  1HH2 P;  2KZ0 A;  5DV9 A;  5LCI A;  3LUS A;  3FCC A;  1ZB9 A;  4JI8 C;  4MTN A;  1IBK C;  4X66 C;  4LFA C;  4DCT A;  5GTD A;  4GS5 A;  1UKK A;  1XHJ A;  5E7Q A;  4I9G A;  2D1Q A;  2P2M A;  4B3T C;  4RVN A;  3GKU A;  1XRC A;  4WV3 A;  3IPL A;  3H2T A;  2VZE A;  1HNZ C;  1MXB A;  1M6X C;  4RM2 A;  4U5Y D;  4EAT A;  2QW0 X;  1XNQ C;  4DR2 C;  3IEU A;  2P20 A;  2BJO A;  2YX1 A;  2WP0 C;  2HHH C;  2ZM6 C;  2QVY X;  5CZV A;  1XRA A;  4PZP A;  1MDB A;  1N2F A;  3NPD A;  5LMU C;  4X62 C;  1RY2 A;  3A26 A;  4JI5 C;  4FUQ A;  1XDX A;  5FLX D;  3JAM D;  3R44 A;  4DUZ C;  2ATW A;  3T1H C;  1ZB8 A;  3LAX A;  1QM4 A;  1PG3 A;  3A4I A;  3IEV A;  4DUY C;  2UU9 C;  4K0B A;  1XS3 A;  2VQF C;  2Z51 A;  3AY0 A;  5K85 A;  4JI6 C;  4R1L A;  2ZZM A;  3LGX A;  2D7V A;  4G1I A;  3PBK A;  1QWI A;  4GKK C;  4DCU A;  4JI7 C;  4LF8 C;  4LE5 A;  1GPM A;  2YCB A;  2D1S A;  5A1G A;  3CJE A;  2VSQ A;  2HJG A;  2D1T A;  5CZX A;  4DV4 C;  2QVX X;  2KZF A;  3O2E A;  3ETC A;  5ADZ A;  1O9T A;  4JI2 C;  4L4Q A;  1YGT A;  4JYA C;  3CQ3 A;  4FTF A;  2E8E A;  4DCS A;  4NXM C;  4L2Z A;  4JI3 C;  2D28 C;  5BSV A;  3A25 A;  2P2F A;  2MM9 A;  4IZ6 A;  5BR8 C;  3C5E A;  1T5D X;  1TH5 A;  4MH4 A;  1ULT A;  4NXN C;  1HNX C;  4RM3 A;  5JRH A;  3UX2 A;  3GR0 A;  3L8C A;  2AYA A;  2VQE C;  1LQL A;  3AF5 A;  3KXW A;  3EER A;  3L95 X;  2PT7 G;  4YY3 C;  1YJ7 A;  5BST A;  4DV7 C;  4RLQ A;  1AMU A;  4ISB A;  1MD9 A;  1BA3 A;  1XRB A;  4D57 A;  4X64 C;  2E8C A;  1ML8 A;  3A9V A;  4LF7 C;  3VNS A;  3R9W A;  2CXC A;  1USP A;  1V25 A;  2EGT A;  4LFC C;  1N32 C;  2V7B A;  3J80 D;  5T8S A;  1N33 C;  4K0K C;  5H9U A;  3EQ6 A;  3LNV A;  4DV0 C;  1PA4 A;  4GKJ C;  4ODJ A;  2ASB A;  4OXI A;  3E7X A;  5AE3 A;  4DV2 C;  1USP B;  2CY1 A;  1FLO A;  4PHT A;  4JI0 C;  4DV3 C;  3A9U A;  1HR0 C;  3CQ2 A;  3GR1 A;  1UWD A;  1VEH A;  5IWA C;  3ETO A;  4B3R C;  5T8T A;  2F4V C;  4B3S C;  1RG9 A;  4B3M C;  4JV5 C;  3AF6 A;  4BSZ A;  4KHP C;  2E0G A;  4HPV A;  1O92 A;  4JI4 C;  2UUB C;  1P7L A;  1MDF A;  1T5H X;  5IT9 D;  2D27 A;  5KEI A;  4PRO C;  1IBM C;  1O93 A;  4LF5 C;  3I07 A;  3TQI A;  1NYE A;  4BC7 A;  4RLF A;  5KYT A;  2WD9 A;  3RV2 A;  1EGA A;  3DAY A;  3VNR A;  4DV5 C;  4DCV A;  3T1Y C;  4KTV A;  1PG4 A;  1FUG A;  4BBY A;  1KKG A;  4XX2 A;  3IML A;  1I94 C;  1WH9 A;  2M5O A;  4PUI A;  1VLA A;  4DR3 C;  3DLP X;  1IBL C;  3DHV A;  4TPS B;  3UX3 A;  2P2B A;  3RG2 A;  3E7W A;  1XNR C;  3R9X A;  4LF6 C;  1O90 A;  3CQ1 A;  2Y4N A;  1MXC A;  4DR6 C;  3PRO C;  3J81 D;  5AE2 A;  3N2Q A;  2OPL B;  2PN2 A; 
#chains in the Genus database with same CATH homology
 2E8F A;  1N34 C;  5BUQ A;  3J7A D;  4NOZ A;  2OBV A;  3B7W A;  3I08 A;  5K8F A;  2BH1 X;  5BSU A;  5BUR A;  4R1M A;  5IFI A;  2UXC C;  4LF4 C;  4L7I A;  4JM1 A;  4AQY C;  3CW9 A;  4I9F A;  3UOW A;  3PES A;  5KYV A;  4DV1 C;  1MXA A;  4BCA A;  3NI2 A;  3UZ0 A;  5A2Q D;  4RMN A;  4RVO A;  1WF3 A;  4DG9 A;  2ONF A;  4FUT A;  2E7G A;  3FCE A;  2JMP A;  2DPL A;  3CW8 X;  2YWC A;  5A1I A;  1N36 C;  2P2Q A;  1V26 A;  2UXD C;  4G36 A;  1XMO C;  4D4I A;  4WS9 A;  3G7S A;  3VNQ A;  2OO4 A;  4OYC A;  4G37 A;  4OX9 C;  4GXQ A;  4R0M A;  3TUF A;  4DR1 C;  3S82 A;  2XR1 A;  1LCI A;  2D1R A;  5BSR A;  1L2F A;  2UUC C;  2P02 A;  3NYQ A;  5BUS A;  2PRO A;  4D4G A;  3TDE A;  4D56 A;  1FJG C;  4DR4 C;  2UXB C;  4DR7 C;  4ZLP A;  4DR5 C;  1J5E C;  3NYR A;  1XMQ C;  4DG8 A;  4NDN A;  5BSW A;  3SO4 A;  2DYJ A;  5A19 A;  2E5L C;  5BSM A;  2Y27 A;  1MKY A;  3N54 B;  4GXR A;  2UUA C;  1K0R A;  1JOS A;  2P2J A;  4X65 C;  4DV6 C;  2QVZ X;  5LMN C;  3OTO C;  4IR7 A;  4BC9 A;  2OPL A;  4LF9 C;  2QL8 A;  2YWB A;  4JI1 C;  5AE1 A;  4LFB C;  3GPC A;  4YHH C;  1HNW C;  4KTT A;  4ZJZ A;  2Y4O A;  1HH2 P;  5DV9 A;  3LUS A;  3FCC A;  1ZB9 A;  4JI8 C;  4MTN A;  1IBK C;  4X66 C;  4LFA C;  4DCT A;  5GTD A;  4GS5 A;  1UKK A;  5E7Q A;  4I9G A;  2D1Q A;  2P2M A;  4B3T C;  4RVN A;  3GKU A;  1XRC A;  4WV3 A;  3IPL A;  3H2T A;  2VZE A;  1HNZ C;  1MXB A;  4RM2 A;  4U5Y D;  4EAT A;  2QW0 X;  1XNQ C;  4DR2 C;  3IEU A;  2P20 A;  2BJO A;  2WP0 C;  2HHH C;  2ZM6 C;  2QVY X;  5CZV A;  1XRA A;  4PZP A;  1MDB A;  1N2F A;  3NPD A;  5LMU C;  4X62 C;  1RY2 A;  4JI5 C;  4FUQ A;  5FLX D;  3JAM D;  3R44 A;  4DUZ C;  2ATW A;  3T1H C;  1ZB8 A;  3LAX A;  1QM4 A;  1PG3 A;  3A4I A;  3IEV A;  4DUY C;  2UU9 C;  4K0B A;  2VQF C;  5K85 A;  4JI6 C;  4R1L A;  3LGX A;  2D7V A;  4G1I A;  3PBK A;  1QWI A;  4GKK C;  4DCU A;  4JI7 C;  4LF8 C;  4LE5 A;  1GPM A;  2YCB A;  2D1S A;  5A1G A;  3CJE A;  2VSQ A;  2HJG A;  2D1T A;  5CZX A;  4DV4 C;  2QVX X;  2KZF A;  3ETC A;  5ADZ A;  1O9T A;  4JI2 C;  4L4Q A;  4JYA C;  4FTF A;  2E8E A;  4DCS A;  4NXM C;  4L2Z A;  4JI3 C;  2D28 C;  5BSV A;  2P2F A;  4IZ6 A;  5BR8 C;  3C5E A;  1T5D X;  4MH4 A;  4NXN C;  1ULT A;  1HNX C;  4RM3 A;  5JRH A;  3GR0 A;  3L8C A;  2AYA A;  2VQE C;  1LQL A;  3AF5 A;  3KXW A;  3EER A;  3L95 X;  2PT7 G;  4YY3 C;  1YJ7 A;  5BST A;  4DV7 C;  4RLQ A;  1AMU A;  4ISB A;  1MD9 A;  1BA3 A;  1XRB A;  4D57 A;  4X64 C;  2E8C A;  1ML8 A;  3A9V A;  4LF7 C;  3VNS A;  3R9W A;  2CXC A;  1USP A;  1V25 A;  2EGT A;  4LFC C;  1N32 C;  2V7B A;  3J80 D;  5T8S A;  1N33 C;  4K0K C;  5H9U A;  3EQ6 A;  3LNV A;  4DV0 C;  1PA4 A;  4GKJ C;  4ODJ A;  2ASB A;  4OXI A;  3E7X A;  5AE3 A;  4DV2 C;  1USP B;  2CY1 A;  4PHT A;  4JI0 C;  4DV3 C;  3A9U A;  1HR0 C;  3GR1 A;  5IWA C;  3ETO A;  4B3R C;  5T8T A;  2F4V C;  4B3S C;  1RG9 A;  4B3M C;  4JV5 C;  3AF6 A;  4BSZ A;  4KHP C;  2E0G A;  4HPV A;  1O92 A;  4JI4 C;  2UUB C;  1P7L A;  1MDF A;  1T5H X;  5IT9 D;  2D27 A;  5KEI A;  4PRO C;  1IBM C;  1O93 A;  4LF5 C;  3I07 A;  3TQI A;  1NYE A;  4BC7 A;  4RLF A;  5KYT A;  2WD9 A;  3RV2 A;  1EGA A;  3DAY A;  3VNR A;  4DV5 C;  4DCV A;  3T1Y C;  4KTV A;  1PG4 A;  1FUG A;  4BBY A;  1KKG A;  4XX2 A;  3IML A;  1I94 C;  1WH9 A;  1VLA A;  4DR3 C;  3DLP X;  1IBL C;  3DHV A;  4TPS B;  2P2B A;  3RG2 A;  3E7W A;  1XNR C;  3R9X A;  4LF6 C;  1O90 A;  2Y4N A;  1MXC A;  4DR6 C;  3PRO C;  3J81 D;  5AE2 A;  3N2Q A;  2OPL B;  2PN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...