1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
1JOSA 1J5EC 4JI4C 4JI2C 4LF6C 3LUSA 1USPA 4NOZA 4LF7C 4AQYC 1HR0C 2F4VC 5LMNC 4JI0C 4DV1C 4DV3C 3T1YC 2OPLB 4LF8C 4LFBC 4JYAC 4B3MC 4K0KC 2HHHC 2HJGA 4JI6C 4JI3C 1XMOC 1WH9A 2E8FA 3T1HC 1XNRC 2KZFA 4YHHC 1XMQC 4B3RC 2VQEC 4JV5C 4B3TC 3R9XA 4DR1C 2VQFC 2DYJA 1LQLA 1VLAA 5A2QD 4DR2C 2UUCC 3JAMD 2JMPA 4DV6C 2YCBA 2CY1A 5FLXD 2PN2A 1ZB9A 4DR4C 4DV2C 3J80D 1PA4A 4X62C 3AF5A 4LF4C 3R9WA 1HNXC 4OX9C 4X66C 1KKGA 1MKYA 4BSZA 1L2FA 3IEUA 4LF5C 1QWIA 1N33C 4DV5C 4DV7C 4DV0C 2XR1A 1N2FA 4JI8C 1FJGC 4DUYC 5BR8C 1EGAA 3GKUA 2ASBA 1USPB 4XX2A 4DR6C 4MH4A 4JI5C 3OTOC 4DCUA 2UXBC 4JI7C 2OPLA 4DCTA 1HH2P 2E8EA 3CJEA 4LFAC 4JI1C 3EERA 1IBKC 1UKKA 3IEVA 2EGTA 3J7AD 1K0RA 3AF6A 2CXCA 4YY3C 2ONFA 3J81D 5IWAC 2E7GA 4NXMC 2PT7G 4X65C 2ZM6C 2D7VA 4DCSA 2UU9C 1NYEA 1HNZC 1HNWC 1N34C 1IBMC 4DR7C 4DCVA 4GKJC 3I07A 1ML8A 2UUAC 4LF9C 2E5LC 5IT9D 4NXNC 1XNQC 2E8CA 4LFCC 4GKKC 2ATWA 4DUZC 4DR3C 4KHPC 2UUBC 2BJOA 4B3SC 1N32C 2UXCC 1WF3A 1ZB8A 1N36C 1I94C 4MTNA 4X64C 5LMUC 2UXDC 4DR5C 2QL8A 4DV4C 1IBLC
chains in the Genus database with same CATH superfamily
1JOSA 4DG8A 1J5EC 1XRAA 2QW0X 2Z51A 4FUTA 1USPA 5BSWA 4NOZA 4AQYC 1HR0C 2F4VC 2Y4OA 5AE2A 3T1YC 4BC9A 1FUGA 1VEHA 2HHHC 2HJGA 1XNRC 1XMQC 5AE3A 4B3RC 3VNRA 3CQ3A 4NDNA 1P4EC 3E7WA 3R9XA 4DR1C 2DYJA 1NY8A 1LQLA 4FTFA 4G36A 2CY1A 5KYVA 4RM2A 5KYTA 1PA4A 5CZVA 5BSRA 4RLQA 5BUSA 4WS9A 4D4GA 4BSZA 4ISBA 4LF5C 3A4IA 1QWIA 1MD9A 4DV7C 5A1GA 2XR1A 1N2FA 3I08A 2M5HA 1MDFA 3B7WA 1FJGC 4XX2A 3OTOC 4U5YD 4LE5A 1HH2P 3LNVA 1IBKC 1UKKA 1AMUA 4RM3A 2ZTBA 4I9FA 2P2MA 3UEBA 3IMLA 3EQ6A 2D7VA 1LCIA 2OO4A 2WD9A 3KXWA 3I07A 1ML8A 2YWCA 4PUGA 4OXIA 2Y27A 2UUAC 4NXNC 3PBKA 3A26A 1XNQC 4D56A 4KTTA 4KHPC 4RVOA 1GPMA 4D57A 1N32C 2UXCC 1I94C 3IPLA 1N36C 5IFIA 3TR3A 3UX3A 1RG9A 5KEIA 2DHMA 4LF7C 3UX2A 4TPSB 5BSMA 4DV1C 4LF8C 3PROC 2VSQA 1XMOC 2MMAB 3ETCA 4YHHC 1XS3A 2BH1X 3CQ1A 1V60A 1T5DX 3VNQA 4B3TC 3A9UA 5A2QD 1O92A 2DPLA 2ZZMA 1M6XA 1XRCA 5T8SA 3A9VA 2PN2A 1ZB9A 4DR4C 4GXQA 1MDBA 1UWDA 2JNVA 1XDXA 3PESA 4X62C 2QVZX 3AF5A 4LF4C 1HNXC 1FLOA 1L2FA 4L2ZA 3H2TA 5A1IA 3C5EA 1YJ7A 3ETOA 4JM1A 3GKUA 4DR6C 4MH4A 4JI7C 2E8EA 3CJEA 1MXBA 4PROC 5K85A 5BSTA 3AF6A 4YY3C 3J81D 2D28C 5BSVA 2ZM6C 2UU9C 4G37A 1HNWC 1N34C 4DCVA 2PROA 4GKJC 3TUFA 2D27A 3TDEA 2V7BA 2KDNA 2E8CA 4R0MA 4KTVA 4EATA 2OBVA 4I9GA 4X64C 1WCJA 2UXDC 4WV3A 2QL8A 4DV4C 4ODJA 1XRBA 4HPVA 2YX1A 3NPDA 5JRHA 4DV3C 2AYAA 2OPLB 4G1IA 4JYAC 4B3MC 4K0KC 1P7LA 4JI6C 1YGTA 1WH9A 2E8FA 4GS5A 2KZFA 2P20A 4ZLPA 3VNSA 4JV5C 2MM9A 4BBYA 2VQFC 2ZZNA 2M5OA 1VLAA 2UUCC 4DR2C 1O93A 3JAMD 3DLPX 5FLXD 2WP0C 3R9WA 2P2QA 2PG1E 3NI2A 4IR7A 4X66C 5AE1A 1KKGA 1RY2A 1MKYA 2YWBA 2MCQA 4GXRA 3IEUA 2NCLA 1N33C 3FM7A 4PZPA 3FCCA 4DV0C 4JI8C 5BUQA 4DUYC 5BR8C 2Y4NA 3GPCA 4IZ6A 1USPB 2ASBA 4K0BA 4JI5C 4DCUA 5ADZA 3N54B 3FCEA 3S82A 4LFAC 3GR0A 3J7AD 4FUQA 1QM4A 2CXCA 3K6RA 1T5HX 4RMNA 2QVYX 5IWAC 1BA3A 3E7XA 4NXMC 2PT7G 2P2BA 3DAYA 4PUHA 3O2EA 1NYEA 2P02A 1MXAA 3CW9A 4DR7C 1MXCA 1O90A 4LF9C 3NYRA 3LGXA 4LFCC 2P2JA 2ATWA 4DUZC 3TQIA 4RLFA 4L4QA 2UUBC 2BJOA 3UZ0A 1WF3A 1P4EA 1ZB8A 4R1MA 4MTNA 5LMUC 1PU1A 1IBLC 4R1LA 5LCIA 3G7SA 4JI4C 4JI2C 4OYCA 4LF6C 3LUSA 5T8TA 1V25A 4JI0C 5LMNC 4PHTA 5BSUA 4LFBC 2QVXX 2VZEA 5K8FA 4JI3C 2P2FA 3T1HC 1ULTA 5E7QA 2E0GA 2VQEC 4ZJZA 4DG9A 3A25A 5CZXA 4RVNA 3AY0A 3L95X 2JMPA 4DV6C 3N2QA 2YCBA 1IB8A 4DV2C 3J80D 3L8CA 4D4IA 5H9UA 4OX9C 4BC7A 3LNOA 5GTDA 3CW8X 1V26A 4DV5C 2D1RA 1EGAA 2D1TA 2UXBC 2OPLA 4DCTA 4JI1C 3EERA 3IEVA 2EGTA 1K0RA 2CU6A 2ONFA 1TH5A 2E7GA 3GR1A 4X65C 3SO4A 3LAXA 2D1SA 4L7IA 4DCSA 3RV2A 1HNZC 5BURA 1IBMC 2D1QA 3NYQA 1O9TA 2E5LC 5IT9D 4PUIA 5A19A 3CQ2A 3RG2A 4GKKC 1PG3A 1M6XC 5DV9A 3UOWA 1XHJA 4DR3C 3R44A 1PG4A 4B3SC 3DHVA 4DR5C 4BCAA 2KZ0A
chains in the Genus database with same CATH topology
1JOSA 4DG8A 1J5EC 1XRAA 2QW0X 4FUTA 1USPA 5BSWA 4NOZA 4AQYC 1HR0C 2F4VC 2Y4OA 5AE2A 3T1YC 4BC9A 1FUGA 2HHHC 2HJGA 1XNRC 1XMQC 5AE3A 4B3RC 3VNRA 4NDNA 3E7WA 3R9XA 4DR1C 2DYJA 1LQLA 4FTFA 4G36A 2CY1A 5KYVA 4RM2A 5KYTA 1PA4A 5CZVA 5BSRA 4RLQA 5BUSA 4WS9A 4D4GA 4BSZA 4ISBA 4LF5C 3A4IA 1QWIA 1MD9A 4DV7C 5A1GA 2XR1A 1N2FA 3I08A 3B7WA 1MDFA 1FJGC 4XX2A 3OTOC 4U5YD 4LE5A 1HH2P 3LNVA 1IBKC 1UKKA 1AMUA 4RM3A 4I9FA 2P2MA 3IMLA 3EQ6A 2D7VA 1LCIA 2OO4A 2WD9A 3KXWA 3I07A 1ML8A 2YWCA 4OXIA 2Y27A 2UUAC 4NXNC 3PBKA 1XNQC 4D56A 4KTTA 4KHPC 4RVOA 1GPMA 4D57A 1N32C 2UXCC 1I94C 3IPLA 1N36C 5IFIA 1RG9A 5KEIA 4LF7C 4TPSB 5BSMA 4DV1C 4LF8C 3PROC 2VSQA 1XMOC 3ETCA 4YHHC 2BH1X 1T5DX 3VNQA 4B3TC 3A9UA 5A2QD 1O92A 2DPLA 1XRCA 5T8SA 3A9VA 2PN2A 1ZB9A 4DR4C 4GXQA 1MDBA 3PESA 4X62C 2QVZX 3AF5A 4LF4C 1HNXC 1L2FA 4L2ZA 3H2TA 5A1IA 3C5EA 1YJ7A 3ETOA 4JM1A 3GKUA 4DR6C 4MH4A 4JI7C 2E8EA 3CJEA 1MXBA 4PROC 5K85A 5BSTA 3AF6A 4YY3C 3J81D 2D28C 5BSVA 2ZM6C 2UU9C 4G37A 1HNWC 1N34C 4DCVA 2PROA 4GKJC 3TUFA 2D27A 3TDEA 2V7BA 2E8CA 4R0MA 4KTVA 4EATA 2OBVA 4I9GA 4X64C 2UXDC 4WV3A 2QL8A 4DV4C 4ODJA 1XRBA 4HPVA 3NPDA 5JRHA 4DV3C 2AYAA 2OPLB 4G1IA 4JYAC 4B3MC 4K0KC 1P7LA 4JI6C 1WH9A 2E8FA 4GS5A 2KZFA 2P20A 4ZLPA 3VNSA 4JV5C 4BBYA 2VQFC 1VLAA 2UUCC 4DR2C 1O93A 3JAMD 3DLPX 5FLXD 2WP0C 3R9WA 2P2QA 3NI2A 4IR7A 4X66C 5AE1A 1KKGA 1RY2A 1MKYA 2YWBA 4GXRA 3IEUA 1N33C 4PZPA 3FCCA 4DV0C 4JI8C 5BUQA 4DUYC 5BR8C 2Y4NA 3GPCA 4IZ6A 1USPB 2ASBA 4K0BA 4JI5C 4DCUA 5ADZA 3N54B 3FCEA 3S82A 4LFAC 3GR0A 3J7AD 4FUQA 1QM4A 2CXCA 1T5HX 4RMNA 2QVYX 5IWAC 1BA3A 3E7XA 4NXMC 2PT7G 2P2BA 3DAYA 1NYEA 2P02A 1MXAA 3CW9A 4DR7C 1MXCA 1O90A 4LF9C 3NYRA 3LGXA 4LFCC 2P2JA 2ATWA 4DUZC 3TQIA 4RLFA 4L4QA 2UUBC 2BJOA 3UZ0A 1WF3A 1ZB8A 4R1MA 4MTNA 5LMUC 1IBLC 4R1LA 3G7SA 4JI4C 4JI2C 4OYCA 4LF6C 3LUSA 5T8TA 1V25A 4JI0C 5LMNC 4PHTA 5BSUA 4LFBC 2QVXX 2VZEA 5K8FA 4JI3C 2P2FA 3T1HC 1ULTA 5E7QA 2E0GA 2VQEC 4ZJZA 4DG9A 5CZXA 4RVNA 3L95X 2JMPA 4DV6C 3N2QA 2YCBA 4DV2C 3J80D 3L8CA 4D4IA 5H9UA 4OX9C 4BC7A 5GTDA 3CW8X 1V26A 4DV5C 2D1RA 1EGAA 2D1TA 2UXBC 2OPLA 4DCTA 4JI1C 3EERA 3IEVA 2EGTA 1K0RA 2ONFA 2E7GA 3GR1A 4X65C 3SO4A 3LAXA 2D1SA 4L7IA 4DCSA 3RV2A 1HNZC 5BURA 1IBMC 2D1QA 3NYQA 1O9TA 2E5LC 5IT9D 5A19A 3RG2A 4GKKC 1PG3A 5DV9A 3UOWA 4DR3C 3R44A 1PG4A 4B3SC 3DHVA 4DR5C 4BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOS A;  1J5E C;  4JI4 C;  4JI2 C;  4LF6 C;  3LUS A;  1USP A;  4NOZ A;  4LF7 C;  4AQY C;  1HR0 C;  2F4V C;  5LMN C;  4JI0 C;  4DV1 C;  4DV3 C;  3T1Y C;  2OPL B;  4LF8 C;  4LFB C;  4JYA C;  4B3M C;  4K0K C;  2HHH C;  2HJG A;  4JI6 C;  4JI3 C;  1XMO C;  1WH9 A;  2E8F A;  3T1H C;  1XNR C;  2KZF A;  4YHH C;  1XMQ C;  4B3R C;  2VQE C;  4JV5 C;  4B3T C;  3R9X A;  4DR1 C;  2VQF C;  2DYJ A;  1LQL A;  1VLA A;  5A2Q D;  4DR2 C;  2UUC C;  3JAM D;  2JMP A;  4DV6 C;  2YCB A;  2CY1 A;  5FLX D;  2PN2 A;  1ZB9 A;  4DR4 C;  4DV2 C;  3J80 D;  1PA4 A;  4X62 C;  3AF5 A;  4LF4 C;  3R9W A;  1HNX C;  4OX9 C;  4X66 C;  1KKG A;  1MKY A;  4BSZ A;  1L2F A;  3IEU A;  4LF5 C;  1QWI A;  1N33 C;  4DV5 C;  4DV7 C;  4DV0 C;  2XR1 A;  1N2F A;  4JI8 C;  1FJG C;  4DUY C;  5BR8 C;  1EGA A;  3GKU A;  2ASB A;  1USP B;  4XX2 A;  4DR6 C;  4MH4 A;  4JI5 C;  3OTO C;  4DCU A;  2UXB C;  4JI7 C;  2OPL A;  4DCT A;  1HH2 P;  2E8E A;  3CJE A;  4LFA C;  4JI1 C;  3EER A;  1IBK C;  1UKK A;  3IEV A;  2EGT A;  3J7A D;  1K0R A;  3AF6 A;  2CXC A;  4YY3 C;  2ONF A;  3J81 D;  5IWA C;  2E7G A;  4NXM C;  2PT7 G;  4X65 C;  2ZM6 C;  2D7V A;  4DCS A;  2UU9 C;  1NYE A;  1HNZ C;  1HNW C;  1N34 C;  1IBM C;  4DR7 C;  4DCV A;  4GKJ C;  3I07 A;  1ML8 A;  2UUA C;  4LF9 C;  2E5L C;  5IT9 D;  4NXN C;  1XNQ C;  2E8C A;  4LFC C;  4GKK C;  2ATW A;  4DUZ C;  4DR3 C;  4KHP C;  2UUB C;  2BJO A;  4B3S C;  1N32 C;  2UXC C;  1WF3 A;  1ZB8 A;  1N36 C;  1I94 C;  4MTN A;  4X64 C;  5LMU C;  2UXD C;  4DR5 C;  2QL8 A;  4DV4 C;  1IBL C; 
#chains in the Genus database with same CATH topology
 1JOS A;  4DG8 A;  1J5E C;  1XRA A;  2QW0 X;  2Z51 A;  4FUT A;  1USP A;  5BSW A;  4NOZ A;  4AQY C;  1HR0 C;  2F4V C;  2Y4O A;  5AE2 A;  3T1Y C;  4BC9 A;  1FUG A;  1VEH A;  2HHH C;  2HJG A;  1XNR C;  1XMQ C;  5AE3 A;  4B3R C;  3VNR A;  3CQ3 A;  4NDN A;  1P4E C;  3E7W A;  3R9X A;  4DR1 C;  2DYJ A;  1NY8 A;  1LQL A;  4FTF A;  4G36 A;  2CY1 A;  5KYV A;  4RM2 A;  5KYT A;  1PA4 A;  5CZV A;  5BSR A;  4RLQ A;  5BUS A;  4WS9 A;  4D4G A;  4BSZ A;  4ISB A;  4LF5 C;  3A4I A;  1QWI A;  1MD9 A;  4DV7 C;  5A1G A;  2XR1 A;  1N2F A;  3I08 A;  2M5H A;  1MDF A;  3B7W A;  1FJG C;  4XX2 A;  3OTO C;  4U5Y D;  4LE5 A;  1HH2 P;  3LNV A;  1IBK C;  1UKK A;  1AMU A;  4RM3 A;  2ZTB A;  4I9F A;  2P2M A;  3UEB A;  3IML A;  3EQ6 A;  2D7V A;  1LCI A;  2OO4 A;  2WD9 A;  3KXW A;  3I07 A;  1ML8 A;  2YWC A;  4PUG A;  4OXI A;  2Y27 A;  2UUA C;  4NXN C;  3PBK A;  3A26 A;  1XNQ C;  4D56 A;  4KTT A;  4KHP C;  4RVO A;  1GPM A;  4D57 A;  1N32 C;  2UXC C;  1I94 C;  3IPL A;  1N36 C;  5IFI A;  3TR3 A;  3UX3 A;  1RG9 A;  5KEI A;  2DHM A;  4LF7 C;  3UX2 A;  4TPS B;  5BSM A;  4DV1 C;  4LF8 C;  3PRO C;  2VSQ A;  1XMO C;  2MMA B;  3ETC A;  4YHH C;  1XS3 A;  2BH1 X;  3CQ1 A;  1V60 A;  1T5D X;  3VNQ A;  4B3T C;  3A9U A;  5A2Q D;  1O92 A;  2DPL A;  2ZZM A;  1M6X A;  1XRC A;  5T8S A;  3A9V A;  2PN2 A;  1ZB9 A;  4DR4 C;  4GXQ A;  1MDB A;  1UWD A;  2JNV A;  1XDX A;  3PES A;  4X62 C;  2QVZ X;  3AF5 A;  4LF4 C;  1HNX C;  1FLO A;  1L2F A;  4L2Z A;  3H2T A;  5A1I A;  3C5E A;  1YJ7 A;  3ETO A;  4JM1 A;  3GKU A;  4DR6 C;  4MH4 A;  4JI7 C;  2E8E A;  3CJE A;  1MXB A;  4PRO C;  5K85 A;  5BST A;  3AF6 A;  4YY3 C;  3J81 D;  2D28 C;  5BSV A;  2ZM6 C;  2UU9 C;  4G37 A;  1HNW C;  1N34 C;  4DCV A;  2PRO A;  4GKJ C;  3TUF A;  2D27 A;  3TDE A;  2V7B A;  2KDN A;  2E8C A;  4R0M A;  4KTV A;  4EAT A;  2OBV A;  4I9G A;  4X64 C;  1WCJ A;  2UXD C;  4WV3 A;  2QL8 A;  4DV4 C;  4ODJ A;  1XRB A;  4HPV A;  2YX1 A;  3NPD A;  5JRH A;  4DV3 C;  2AYA A;  2OPL B;  4G1I A;  4JYA C;  4B3M C;  4K0K C;  1P7L A;  4JI6 C;  1YGT A;  1WH9 A;  2E8F A;  4GS5 A;  2KZF A;  2P20 A;  4ZLP A;  3VNS A;  4JV5 C;  2MM9 A;  4BBY A;  2VQF C;  2ZZN A;  2M5O A;  1VLA A;  2UUC C;  4DR2 C;  1O93 A;  3JAM D;  3DLP X;  5FLX D;  2WP0 C;  3R9W A;  2P2Q A;  2PG1 E;  3NI2 A;  4IR7 A;  4X66 C;  5AE1 A;  1KKG A;  1RY2 A;  1MKY A;  2YWB A;  2MCQ A;  4GXR A;  3IEU A;  2NCL A;  1N33 C;  3FM7 A;  4PZP A;  3FCC A;  4DV0 C;  4JI8 C;  5BUQ A;  4DUY C;  5BR8 C;  2Y4N A;  3GPC A;  4IZ6 A;  1USP B;  2ASB A;  4K0B A;  4JI5 C;  4DCU A;  5ADZ A;  3N54 B;  3FCE A;  3S82 A;  4LFA C;  3GR0 A;  3J7A D;  4FUQ A;  1QM4 A;  2CXC A;  3K6R A;  1T5H X;  4RMN A;  2QVY X;  5IWA C;  1BA3 A;  3E7X A;  4NXM C;  2PT7 G;  2P2B A;  3DAY A;  4PUH A;  3O2E A;  1NYE A;  2P02 A;  1MXA A;  3CW9 A;  4DR7 C;  1MXC A;  1O90 A;  4LF9 C;  3NYR A;  3LGX A;  4LFC C;  2P2J A;  2ATW A;  4DUZ C;  3TQI A;  4RLF A;  4L4Q A;  2UUB C;  2BJO A;  3UZ0 A;  1WF3 A;  1P4E A;  1ZB8 A;  4R1M A;  4MTN A;  5LMU C;  1PU1 A;  1IBL C;  4R1L A;  5LCI A;  3G7S A;  4JI4 C;  4JI2 C;  4OYC A;  4LF6 C;  3LUS A;  5T8T A;  1V25 A;  4JI0 C;  5LMN C;  4PHT A;  5BSU A;  4LFB C;  2QVX X;  2VZE A;  5K8F A;  4JI3 C;  2P2F A;  3T1H C;  1ULT A;  5E7Q A;  2E0G A;  2VQE C;  4ZJZ A;  4DG9 A;  3A25 A;  5CZX A;  4RVN A;  3AY0 A;  3L95 X;  2JMP A;  4DV6 C;  3N2Q A;  2YCB A;  1IB8 A;  4DV2 C;  3J80 D;  3L8C A;  4D4I A;  5H9U A;  4OX9 C;  4BC7 A;  3LNO A;  5GTD A;  3CW8 X;  1V26 A;  4DV5 C;  2D1R A;  1EGA A;  2D1T A;  2UXB C;  2OPL A;  4DCT A;  4JI1 C;  3EER A;  3IEV A;  2EGT A;  1K0R A;  2CU6 A;  2ONF A;  1TH5 A;  2E7G A;  3GR1 A;  4X65 C;  3SO4 A;  3LAX A;  2D1S A;  4L7I A;  4DCS A;  3RV2 A;  1HNZ C;  5BUR A;  1IBM C;  2D1Q A;  3NYQ A;  1O9T A;  2E5L C;  5IT9 D;  4PUI A;  5A19 A;  3CQ2 A;  3RG2 A;  4GKK C;  1PG3 A;  1M6X C;  5DV9 A;  3UOW A;  1XHJ A;  4DR3 C;  3R44 A;  1PG4 A;  4B3S C;  3DHV A;  4DR5 C;  4BCA A;  2KZ0 A; 
#chains in the Genus database with same CATH homology
 1JOS A;  4DG8 A;  1J5E C;  1XRA A;  2QW0 X;  4FUT A;  1USP A;  5BSW A;  4NOZ A;  4AQY C;  1HR0 C;  2F4V C;  2Y4O A;  5AE2 A;  3T1Y C;  4BC9 A;  1FUG A;  2HHH C;  2HJG A;  1XNR C;  1XMQ C;  5AE3 A;  4B3R C;  3VNR A;  4NDN A;  3E7W A;  3R9X A;  4DR1 C;  2DYJ A;  1LQL A;  4FTF A;  4G36 A;  2CY1 A;  5KYV A;  4RM2 A;  5KYT A;  1PA4 A;  5CZV A;  5BSR A;  4RLQ A;  5BUS A;  4WS9 A;  4D4G A;  4BSZ A;  4ISB A;  4LF5 C;  3A4I A;  1QWI A;  1MD9 A;  4DV7 C;  5A1G A;  2XR1 A;  1N2F A;  3I08 A;  3B7W A;  1MDF A;  1FJG C;  4XX2 A;  3OTO C;  4U5Y D;  4LE5 A;  1HH2 P;  3LNV A;  1IBK C;  1UKK A;  1AMU A;  4RM3 A;  4I9F A;  2P2M A;  3IML A;  3EQ6 A;  2D7V A;  1LCI A;  2OO4 A;  2WD9 A;  3KXW A;  3I07 A;  1ML8 A;  2YWC A;  4OXI A;  2Y27 A;  2UUA C;  4NXN C;  3PBK A;  1XNQ C;  4D56 A;  4KTT A;  4KHP C;  4RVO A;  1GPM A;  4D57 A;  1N32 C;  2UXC C;  1I94 C;  3IPL A;  1N36 C;  5IFI A;  1RG9 A;  5KEI A;  4LF7 C;  4TPS B;  5BSM A;  4DV1 C;  4LF8 C;  3PRO C;  2VSQ A;  1XMO C;  3ETC A;  4YHH C;  2BH1 X;  1T5D X;  3VNQ A;  4B3T C;  3A9U A;  5A2Q D;  1O92 A;  2DPL A;  1XRC A;  5T8S A;  3A9V A;  2PN2 A;  1ZB9 A;  4DR4 C;  4GXQ A;  1MDB A;  3PES A;  4X62 C;  2QVZ X;  3AF5 A;  4LF4 C;  1HNX C;  1L2F A;  4L2Z A;  3H2T A;  5A1I A;  3C5E A;  1YJ7 A;  3ETO A;  4JM1 A;  3GKU A;  4DR6 C;  4MH4 A;  4JI7 C;  2E8E A;  3CJE A;  1MXB A;  4PRO C;  5K85 A;  5BST A;  3AF6 A;  4YY3 C;  3J81 D;  2D28 C;  5BSV A;  2ZM6 C;  2UU9 C;  4G37 A;  1HNW C;  1N34 C;  4DCV A;  2PRO A;  4GKJ C;  3TUF A;  2D27 A;  3TDE A;  2V7B A;  2E8C A;  4R0M A;  4KTV A;  4EAT A;  2OBV A;  4I9G A;  4X64 C;  2UXD C;  4WV3 A;  2QL8 A;  4DV4 C;  4ODJ A;  1XRB A;  4HPV A;  3NPD A;  5JRH A;  4DV3 C;  2AYA A;  2OPL B;  4G1I A;  4JYA C;  4B3M C;  4K0K C;  1P7L A;  4JI6 C;  1WH9 A;  2E8F A;  4GS5 A;  2KZF A;  2P20 A;  4ZLP A;  3VNS A;  4JV5 C;  4BBY A;  2VQF C;  1VLA A;  2UUC C;  4DR2 C;  1O93 A;  3JAM D;  3DLP X;  5FLX D;  2WP0 C;  3R9W A;  2P2Q A;  3NI2 A;  4IR7 A;  4X66 C;  5AE1 A;  1KKG A;  1RY2 A;  1MKY A;  2YWB A;  4GXR A;  3IEU A;  1N33 C;  4PZP A;  3FCC A;  4DV0 C;  4JI8 C;  5BUQ A;  4DUY C;  5BR8 C;  2Y4N A;  3GPC A;  4IZ6 A;  1USP B;  2ASB A;  4K0B A;  4JI5 C;  4DCU A;  5ADZ A;  3N54 B;  3FCE A;  3S82 A;  4LFA C;  3GR0 A;  3J7A D;  4FUQ A;  1QM4 A;  2CXC A;  1T5H X;  4RMN A;  2QVY X;  5IWA C;  1BA3 A;  3E7X A;  4NXM C;  2PT7 G;  2P2B A;  3DAY A;  1NYE A;  2P02 A;  1MXA A;  3CW9 A;  4DR7 C;  1MXC A;  1O90 A;  4LF9 C;  3NYR A;  3LGX A;  4LFC C;  2P2J A;  2ATW A;  4DUZ C;  3TQI A;  4RLF A;  4L4Q A;  2UUB C;  2BJO A;  3UZ0 A;  1WF3 A;  1ZB8 A;  4R1M A;  4MTN A;  5LMU C;  1IBL C;  4R1L A;  3G7S A;  4JI4 C;  4JI2 C;  4OYC A;  4LF6 C;  3LUS A;  5T8T A;  1V25 A;  4JI0 C;  5LMN C;  4PHT A;  5BSU A;  4LFB C;  2QVX X;  2VZE A;  5K8F A;  4JI3 C;  2P2F A;  3T1H C;  1ULT A;  5E7Q A;  2E0G A;  2VQE C;  4ZJZ A;  4DG9 A;  5CZX A;  4RVN A;  3L95 X;  2JMP A;  4DV6 C;  3N2Q A;  2YCB A;  4DV2 C;  3J80 D;  3L8C A;  4D4I A;  5H9U A;  4OX9 C;  4BC7 A;  5GTD A;  3CW8 X;  1V26 A;  4DV5 C;  2D1R A;  1EGA A;  2D1T A;  2UXB C;  2OPL A;  4DCT A;  4JI1 C;  3EER A;  3IEV A;  2EGT A;  1K0R A;  2ONF A;  2E7G A;  3GR1 A;  4X65 C;  3SO4 A;  3LAX A;  2D1S A;  4L7I A;  4DCS A;  3RV2 A;  1HNZ C;  5BUR A;  1IBM C;  2D1Q A;  3NYQ A;  1O9T A;  2E5L C;  5IT9 D;  5A19 A;  3RG2 A;  4GKK C;  1PG3 A;  5DV9 A;  3UOW A;  4DR3 C;  3R44 A;  1PG4 A;  4B3S C;  3DHV A;  4DR5 C;  4BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...