1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
4DR5C 3CJEA 1XNRC 1USPA 4LFCC 4GKKC 4YHHC 1JOSA 1LQLA 1VLAA 4JI8C 1WH9A 4DCTA 4LF4C 1XMOC 4LFBC 2UXCC 3T1HC 4K0KC 4NOZA 2E8CA 3AF6A 1USPB 3J7AD 1I94C 2VQEC 4DCVA 1HNWC 2CXCA 2XR1A 4LF8C 4MH4A 4DCSA 2YCBA 4MTNA 4DV0C 3R9WA 2E8EA 4BSZA 2ONFA 1N34C 1PA4A 3JAMD 1IBMC 1L2FA 1HR0C 2UUCC 2PN2A 2UU9C 2VQFC 4DCUA 5IWAC 3IEUA 3IEVA 4DV4C 4B3TC 4DV2C 4NXNC 1IBLC 2UXBC 5LMUC 1ZB9A 1HH2P 3J81D 4JI7C 4JI1C 4GKJC 1ML8A 2UXDC 1EGAA 4B3MC 1N36C 4JYAC 3I07A 4LF7C 5FLXD 2ZM6C 4X66C 2HJGA 4DV6C 2UUBC 4JI0C 1N33C 2PT7G 2CY1A 3R9XA 1WF3A 1KKGA 4X62C 4DV5C 2F4VC 4NXMC 4DR2C 2E7GA 2D7VA 1XNQC 4DV3C 4KHPC 4JV5C 2UUAC 4X65C 3LUSA 4LF5C 4JI6C 2EGTA 2JMPA 3GKUA 4JI3C 4DUZC 4DR1C 4YY3C 3EERA 2QL8A 4JI2C 1HNZC 2BJOA 1UKKA 4LF6C 4DV7C 3T1YC 4JI4C 4DV1C 4JI5C 1XMQC 2OPLA 1QWIA 3J80D 1ZB8A 2KZFA 5BR8C 1N32C 1MKYA 3OTOC 4DUYC 4DR3C 5IT9D 2ATWA 5A2QD 4AQYC 2E5LC 4B3RC 2ASBA 2DYJA 1NYEA 2E8FA 4DR4C 4DR6C 1HNXC 5LMNC 1N2FA 1K0RA 4LF9C 3AF5A 2OPLB 4B3SC 4LFAC 1J5EC 4XX2A 4OX9C 1FJGC 4DR7C 4X64C 2HHHC 1IBKC
chains in the Genus database with same CATH superfamily
3N2QA 5KEIA 4GKKC 4YHHC 2P02A 2P2FA 1MDBA 1XMOC 4K0KC 3PESA 1T5DX 3RG2A 3J7AD 1HNWC 3RV2A 4OXIA 2XR1A 3DHVA 1V26A 2MM9A 2YCBA 3FM7A 3E7WA 3TQIA 4BC9A 4DV0C 2E8EA 4IR7A 2DPLA 2ONFA 5BUQA 4BCAA 4DCUA 3IEVA 4D4IA 4B3TC 5K85A 4NXNC 1FLOA 2PG1E 2UXDC 5GTDA 3UEBA 1EGAA 3FCEA 4JYAC 1XDXA 5FLXD 2ZM6C 2M5OA 4D56A 1MXCA 3A26A 1LCIA 1WF3A 2F4VC 4I9FA 5DV9A 4RM3A 4L7IA 3PBKA 4KHPC 3VNQA 2ZZMA 3A9VA 3IPLA 4JV5C 3AY0A 4LE5A 3A25A 3GR0A 3L95X 3A9UA 4ZJZA 4YY3C 3EERA 2QL8A 4JI2C 2P2BA 4BC7A 3S82A 3H2TA 5KYTA 1QWIA 1N32C 1MKYA 3TUFA 1XRBA 4B3RC 2DYJA 1NYEA 3LNVA 1K0RA 3N54B 3AF5A 4LF9C 2CU6A 4LFAC 3VNRA 4XX2A 2KDNA 5H9UA 2D28C 1LQLA 1VLAA 4JI8C 1WH9A 3SO4A 4LFBC 3T1HC 2P2MA 3CQ1A 4NOZA 2WD9A 3AF6A 3KXWA 2VQEC 1RY2A 4G37A 2P20A 4NDNA 4LF8C 4MH4A 4DCSA 4ODJA 4MTNA 3R9WA 4PROC 1L2FA 2YX1A 2UUCC 1ULTA 3NYQA 5AE2A 4GS5A 3GR1A 4RLQA 5LMUC 4L2ZA 4JI1C 4OYCA 2QW0X 4B3MC 5BSVA 4DV6C 4JI0C 4RVNA 2PT7G 3R9XA 1KKGA 4X62C 5AE3A 4HPVA 3TR3A 1UWDA 2E7GA 1XNQC 3UZ0A 4U5YD 5BSMA 3FCCA 4L4QA 1P4EC 2YWCA 3LUSA 2D1TA 4JI6C 3DLPX 3UX2A 3IMLA 4JI3C 3O2EA 1UKKA 5BSRA 3T1YC 4I9GA 4FUQA 4ISBA 4JI5C 4IZ6A 1XMQC 3J80D 2D1SA 1ZB8A 1P7LA 4R0MA 4DUYC 2ZZNA 4AQYC 4EATA 2E8FA 1HNXC 2QVYX 5LMNC 2MCQA 1FJGC 2MMAB 4DR7C 5BSWA 4X64C 2VSQA 5BURA 1USPA 3CW8X 3UOWA 1P4EA 1JOSA 1M6XC 4LF4C 2UXCC 2D27A 2E8CA 3LAXA 4RM2A 4WV3A 1I94C 3C5EA 1MXBA 2KZ0A 2CXCA 1RG9A 1M6XA 3B7WA 1PU1A 3NPDA 1N34C 1PA4A 1IBMC 2UU9C 2QVXX 3VNSA 5A19A 5IWAC 1VEHA 2OBVA 4DV4C 1ZB9A 3J81D 4JI7C 2VZEA 1TH5A 4GKJC 1ML8A 2ZTBA 1O9TA 4G1IA 2D1RA 3NYRA 3I07A 4DG8A 2Y4OA 4PUIA 4JM1A 4KTVA 3CW9A 2UUBC 1O93A 1N33C 2CY1A 5JRHA 4DV5C 2V7BA 1XRAA 2Y27A 1MDFA 4DR2C 2D7VA 1YJ7A 5CZVA 1MXAA 3E7XA 2UUAC 4RLFA 4LF5C 2EGTA 3GKUA 5BSTA 5KYVA 4DUZC 1HNZC 1BA3A 5LCIA 4LF6C 4DV7C 4JI4C 1T5HX 5IFIA 5A1GA 2KZFA 5BR8C 4FUTA 5IT9D 5A2QD 3NI2A 2Y4NA 1AMUA 4DR4C 4DR6C 2OO4A 3L8CA 5T8TA 1N2FA 2OPLB 5BSUA 1J5EC 4DG9A 4OX9C 4KTTA 1NY8A 4DR5C 3CJEA 1XNRC 3LNOA 4LFCC 2D1QA 3ETOA 1GPMA 4DCTA 3K6RA 1PG3A 1O90A 1USPB 3LGXA 4RMNA 4DCVA 3R44A 2DHMA 2YWBA 2NCLA 1PG4A 4WS9A 3ETCA 2QVZX 3EQ6A 1O92A 4BSZA 5T8SA 3JAMD 4RVOA 1HR0C 3CQ2A 2PN2A 4FTFA 2VQFC 3IEUA 4ZLPA 4DV2C 2UXBC 1IBLC 4PZPA 2P2QA 1HH2P 2PROA 4GXQA 5ADZA 1V25A 3PROC 2BH1X 3I08A 4G36A 1N36C 4BBYA 4LF7C 1XS3A 4X66C 2HJGA 4PUHA 3TDEA 1IB8A 5AE1A 3G7SA 4NXMC 4GXRA 4DV3C 4K0BA 1XHJA 1QM4A 4X65C 3GPCA 4PHTA 4D57A 2E0GA 1FUGA 2JMPA 4D4GA 3A4IA 4DR1C 5E7QA 1MD9A 2BJOA 2M5HA 3CQ3A 5BUSA 4R1MA 2JNVA 1YGTA 4DV1C 2OPLA 1V60A 4PUGA 4TPSB 4DR3C 2WP0C 3OTOC 4R1LA 2ATWA 1WCJA 2E5LC 2ASBA 5CZXA 2AYAA 2P2JA 5K8FA 4B3SC 2Z51A 3DAYA 1XRCA 3UX3A 5A1IA 2HHHC 1IBKC
chains in the Genus database with same CATH topology
3N2QA 5KEIA 4GKKC 4YHHC 2P02A 2P2FA 1MDBA 1XMOC 4K0KC 3PESA 1T5DX 3RG2A 3J7AD 1HNWC 3RV2A 4OXIA 2XR1A 3DHVA 1V26A 2YCBA 3E7WA 3TQIA 4BC9A 4DV0C 2E8EA 4IR7A 2DPLA 2ONFA 5BUQA 4BCAA 4DCUA 3IEVA 4D4IA 4NXNC 5K85A 4B3TC 2UXDC 5GTDA 1EGAA 3FCEA 4JYAC 5FLXD 2ZM6C 4D56A 1MXCA 1LCIA 1WF3A 2F4VC 4I9FA 5DV9A 4RM3A 4L7IA 3PBKA 4KHPC 3VNQA 3A9VA 3IPLA 4JV5C 4LE5A 3GR0A 3L95X 3A9UA 4ZJZA 4YY3C 3EERA 2QL8A 4JI2C 2P2BA 4BC7A 3S82A 3H2TA 5KYTA 1QWIA 1N32C 1MKYA 3TUFA 1XRBA 4B3RC 2DYJA 1NYEA 3LNVA 1K0RA 3N54B 3AF5A 4LF9C 4LFAC 3VNRA 4XX2A 5H9UA 2D28C 1LQLA 1VLAA 4JI8C 1WH9A 3SO4A 4LFBC 3T1HC 2P2MA 4NOZA 2WD9A 3AF6A 3KXWA 2VQEC 1RY2A 4G37A 2P20A 4NDNA 4LF8C 4MH4A 4DCSA 4ODJA 4MTNA 3R9WA 4PROC 1L2FA 2UUCC 1ULTA 3NYQA 5AE2A 4GS5A 3GR1A 4RLQA 5LMUC 4L2ZA 4JI1C 4OYCA 2QW0X 4B3MC 5BSVA 4DV6C 4JI0C 4RVNA 2PT7G 3R9XA 1KKGA 4X62C 5AE3A 4HPVA 2E7GA 1XNQC 3UZ0A 4U5YD 5BSMA 3FCCA 4L4QA 2YWCA 3LUSA 2D1TA 4JI6C 3DLPX 3IMLA 4JI3C 1UKKA 5BSRA 3T1YC 4I9GA 4FUQA 4JI5C 4ISBA 4IZ6A 1XMQC 3J80D 2D1SA 1ZB8A 1P7LA 4R0MA 4DUYC 4AQYC 4EATA 2E8FA 1HNXC 2QVYX 5LMNC 1FJGC 4DR7C 5BSWA 4X64C 2VSQA 5BURA 1USPA 3CW8X 3UOWA 1JOSA 4LF4C 2UXCC 2D27A 2E8CA 3LAXA 4RM2A 4WV3A 1I94C 3C5EA 1MXBA 2CXCA 1RG9A 3B7WA 3NPDA 1N34C 1PA4A 1IBMC 2UU9C 2QVXX 3VNSA 5A19A 5IWAC 2OBVA 4DV4C 1ZB9A 3J81D 4JI7C 2VZEA 4GKJC 1ML8A 1O9TA 4G1IA 2D1RA 3NYRA 3I07A 4DG8A 2Y4OA 4JM1A 4KTVA 3CW9A 2UUBC 1O93A 1N33C 2CY1A 5JRHA 4DV5C 2V7BA 1XRAA 2Y27A 1MDFA 4DR2C 2D7VA 1YJ7A 5CZVA 1MXAA 3E7XA 2UUAC 4RLFA 4LF5C 2EGTA 3GKUA 5BSTA 5KYVA 4DUZC 1HNZC 1BA3A 4LF6C 4DV7C 4JI4C 1T5HX 5IFIA 5A1GA 2KZFA 5BR8C 4FUTA 5IT9D 5A2QD 3NI2A 2Y4NA 1AMUA 4DR4C 4DR6C 2OO4A 3L8CA 5T8TA 1N2FA 2OPLB 5BSUA 1J5EC 4DG9A 4OX9C 4KTTA 4DR5C 3CJEA 1XNRC 4LFCC 2D1QA 3ETOA 1GPMA 4DCTA 1PG3A 1O90A 1USPB 3LGXA 4RMNA 4DCVA 3R44A 2YWBA 1PG4A 4WS9A 3ETCA 2QVZX 3EQ6A 1O92A 4BSZA 5T8SA 3JAMD 4RVOA 1HR0C 2PN2A 4FTFA 2VQFC 3IEUA 4ZLPA 4DV2C 2UXBC 1IBLC 4PZPA 2P2QA 1HH2P 2PROA 4GXQA 5ADZA 1V25A 3PROC 2BH1X 3I08A 4G36A 1N36C 4BBYA 4LF7C 4X66C 2HJGA 3TDEA 5AE1A 3G7SA 4NXMC 4GXRA 4DV3C 4K0BA 4X65C 1QM4A 3GPCA 4PHTA 4D57A 2E0GA 1FUGA 2JMPA 4D4GA 3A4IA 4DR1C 5E7QA 1MD9A 2BJOA 5BUSA 4R1MA 4DV1C 2OPLA 4TPSB 4DR3C 2WP0C 3OTOC 4R1LA 2ATWA 2E5LC 2ASBA 5CZXA 2AYAA 2P2JA 5K8FA 4B3SC 3DAYA 1XRCA 5A1IA 2HHHC 1IBKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 C;  3CJE A;  1XNR C;  1USP A;  4LFC C;  4GKK C;  4YHH C;  1JOS A;  1LQL A;  1VLA A;  4JI8 C;  1WH9 A;  4DCT A;  4LF4 C;  1XMO C;  4LFB C;  2UXC C;  3T1H C;  4K0K C;  4NOZ A;  2E8C A;  3AF6 A;  1USP B;  3J7A D;  1I94 C;  2VQE C;  4DCV A;  1HNW C;  2CXC A;  2XR1 A;  4LF8 C;  4MH4 A;  4DCS A;  2YCB A;  4MTN A;  4DV0 C;  3R9W A;  2E8E A;  4BSZ A;  2ONF A;  1N34 C;  1PA4 A;  3JAM D;  1IBM C;  1L2F A;  1HR0 C;  2UUC C;  2PN2 A;  2UU9 C;  2VQF C;  4DCU A;  5IWA C;  3IEU A;  3IEV A;  4DV4 C;  4B3T C;  4DV2 C;  4NXN C;  1IBL C;  2UXB C;  5LMU C;  1ZB9 A;  1HH2 P;  3J81 D;  4JI7 C;  4JI1 C;  4GKJ C;  1ML8 A;  2UXD C;  1EGA A;  4B3M C;  1N36 C;  4JYA C;  3I07 A;  4LF7 C;  5FLX D;  2ZM6 C;  4X66 C;  2HJG A;  4DV6 C;  2UUB C;  4JI0 C;  1N33 C;  2PT7 G;  2CY1 A;  3R9X A;  1WF3 A;  1KKG A;  4X62 C;  4DV5 C;  2F4V C;  4NXM C;  4DR2 C;  2E7G A;  2D7V A;  1XNQ C;  4DV3 C;  4KHP C;  4JV5 C;  2UUA C;  4X65 C;  3LUS A;  4LF5 C;  4JI6 C;  2EGT A;  2JMP A;  3GKU A;  4JI3 C;  4DUZ C;  4DR1 C;  4YY3 C;  3EER A;  2QL8 A;  4JI2 C;  1HNZ C;  2BJO A;  1UKK A;  4LF6 C;  4DV7 C;  3T1Y C;  4JI4 C;  4DV1 C;  4JI5 C;  1XMQ C;  2OPL A;  1QWI A;  3J80 D;  1ZB8 A;  2KZF A;  5BR8 C;  1N32 C;  1MKY A;  3OTO C;  4DUY C;  4DR3 C;  5IT9 D;  2ATW A;  5A2Q D;  4AQY C;  2E5L C;  4B3R C;  2ASB A;  2DYJ A;  1NYE A;  2E8F A;  4DR4 C;  4DR6 C;  1HNX C;  5LMN C;  1N2F A;  1K0R A;  4LF9 C;  3AF5 A;  2OPL B;  4B3S C;  4LFA C;  1J5E C;  4XX2 A;  4OX9 C;  1FJG C;  4DR7 C;  4X64 C;  2HHH C;  1IBK C; 
#chains in the Genus database with same CATH topology
 3N2Q A;  5KEI A;  4GKK C;  4YHH C;  2P02 A;  2P2F A;  1MDB A;  1XMO C;  4K0K C;  3PES A;  1T5D X;  3RG2 A;  3J7A D;  1HNW C;  3RV2 A;  4OXI A;  2XR1 A;  3DHV A;  1V26 A;  2MM9 A;  2YCB A;  3FM7 A;  3E7W A;  3TQI A;  4BC9 A;  4DV0 C;  2E8E A;  4IR7 A;  2DPL A;  2ONF A;  5BUQ A;  4BCA A;  4DCU A;  3IEV A;  4D4I A;  4B3T C;  5K85 A;  4NXN C;  1FLO A;  2PG1 E;  2UXD C;  5GTD A;  3UEB A;  1EGA A;  3FCE A;  4JYA C;  1XDX A;  5FLX D;  2ZM6 C;  2M5O A;  4D56 A;  1MXC A;  3A26 A;  1LCI A;  1WF3 A;  2F4V C;  4I9F A;  5DV9 A;  4RM3 A;  4L7I A;  3PBK A;  4KHP C;  3VNQ A;  2ZZM A;  3A9V A;  3IPL A;  4JV5 C;  3AY0 A;  4LE5 A;  3A25 A;  3GR0 A;  3L95 X;  3A9U A;  4ZJZ A;  4YY3 C;  3EER A;  2QL8 A;  4JI2 C;  2P2B A;  4BC7 A;  3S82 A;  3H2T A;  5KYT A;  1QWI A;  1N32 C;  1MKY A;  3TUF A;  1XRB A;  4B3R C;  2DYJ A;  1NYE A;  3LNV A;  1K0R A;  3N54 B;  3AF5 A;  4LF9 C;  2CU6 A;  4LFA C;  3VNR A;  4XX2 A;  2KDN A;  5H9U A;  2D28 C;  1LQL A;  1VLA A;  4JI8 C;  1WH9 A;  3SO4 A;  4LFB C;  3T1H C;  2P2M A;  3CQ1 A;  4NOZ A;  2WD9 A;  3AF6 A;  3KXW A;  2VQE C;  1RY2 A;  4G37 A;  2P20 A;  4NDN A;  4LF8 C;  4MH4 A;  4DCS A;  4ODJ A;  4MTN A;  3R9W A;  4PRO C;  1L2F A;  2YX1 A;  2UUC C;  1ULT A;  3NYQ A;  5AE2 A;  4GS5 A;  3GR1 A;  4RLQ A;  5LMU C;  4L2Z A;  4JI1 C;  4OYC A;  2QW0 X;  4B3M C;  5BSV A;  4DV6 C;  4JI0 C;  4RVN A;  2PT7 G;  3R9X A;  1KKG A;  4X62 C;  5AE3 A;  4HPV A;  3TR3 A;  1UWD A;  2E7G A;  1XNQ C;  3UZ0 A;  4U5Y D;  5BSM A;  3FCC A;  4L4Q A;  1P4E C;  2YWC A;  3LUS A;  2D1T A;  4JI6 C;  3DLP X;  3UX2 A;  3IML A;  4JI3 C;  3O2E A;  1UKK A;  5BSR A;  3T1Y C;  4I9G A;  4FUQ A;  4ISB A;  4JI5 C;  4IZ6 A;  1XMQ C;  3J80 D;  2D1S A;  1ZB8 A;  1P7L A;  4R0M A;  4DUY C;  2ZZN A;  4AQY C;  4EAT A;  2E8F A;  1HNX C;  2QVY X;  5LMN C;  2MCQ A;  1FJG C;  2MMA B;  4DR7 C;  5BSW A;  4X64 C;  2VSQ A;  5BUR A;  1USP A;  3CW8 X;  3UOW A;  1P4E A;  1JOS A;  1M6X C;  4LF4 C;  2UXC C;  2D27 A;  2E8C A;  3LAX A;  4RM2 A;  4WV3 A;  1I94 C;  3C5E A;  1MXB A;  2KZ0 A;  2CXC A;  1RG9 A;  1M6X A;  3B7W A;  1PU1 A;  3NPD A;  1N34 C;  1PA4 A;  1IBM C;  2UU9 C;  2QVX X;  3VNS A;  5A19 A;  5IWA C;  1VEH A;  2OBV A;  4DV4 C;  1ZB9 A;  3J81 D;  4JI7 C;  2VZE A;  1TH5 A;  4GKJ C;  1ML8 A;  2ZTB A;  1O9T A;  4G1I A;  2D1R A;  3NYR A;  3I07 A;  4DG8 A;  2Y4O A;  4PUI A;  4JM1 A;  4KTV A;  3CW9 A;  2UUB C;  1O93 A;  1N33 C;  2CY1 A;  5JRH A;  4DV5 C;  2V7B A;  1XRA A;  2Y27 A;  1MDF A;  4DR2 C;  2D7V A;  1YJ7 A;  5CZV A;  1MXA A;  3E7X A;  2UUA C;  4RLF A;  4LF5 C;  2EGT A;  3GKU A;  5BST A;  5KYV A;  4DUZ C;  1HNZ C;  1BA3 A;  5LCI A;  4LF6 C;  4DV7 C;  4JI4 C;  1T5H X;  5IFI A;  5A1G A;  2KZF A;  5BR8 C;  4FUT A;  5IT9 D;  5A2Q D;  3NI2 A;  2Y4N A;  1AMU A;  4DR4 C;  4DR6 C;  2OO4 A;  3L8C A;  5T8T A;  1N2F A;  2OPL B;  5BSU A;  1J5E C;  4DG9 A;  4OX9 C;  4KTT A;  1NY8 A;  4DR5 C;  3CJE A;  1XNR C;  3LNO A;  4LFC C;  2D1Q A;  3ETO A;  1GPM A;  4DCT A;  3K6R A;  1PG3 A;  1O90 A;  1USP B;  3LGX A;  4RMN A;  4DCV A;  3R44 A;  2DHM A;  2YWB A;  2NCL A;  1PG4 A;  4WS9 A;  3ETC A;  2QVZ X;  3EQ6 A;  1O92 A;  4BSZ A;  5T8S A;  3JAM D;  4RVO A;  1HR0 C;  3CQ2 A;  2PN2 A;  4FTF A;  2VQF C;  3IEU A;  4ZLP A;  4DV2 C;  2UXB C;  1IBL C;  4PZP A;  2P2Q A;  1HH2 P;  2PRO A;  4GXQ A;  5ADZ A;  1V25 A;  3PRO C;  2BH1 X;  3I08 A;  4G36 A;  1N36 C;  4BBY A;  4LF7 C;  1XS3 A;  4X66 C;  2HJG A;  4PUH A;  3TDE A;  1IB8 A;  5AE1 A;  3G7S A;  4NXM C;  4GXR A;  4DV3 C;  4K0B A;  1XHJ A;  1QM4 A;  4X65 C;  3GPC A;  4PHT A;  4D57 A;  2E0G A;  1FUG A;  2JMP A;  4D4G A;  3A4I A;  4DR1 C;  5E7Q A;  1MD9 A;  2BJO A;  2M5H A;  3CQ3 A;  5BUS A;  4R1M A;  2JNV A;  1YGT A;  4DV1 C;  2OPL A;  1V60 A;  4PUG A;  4TPS B;  4DR3 C;  2WP0 C;  3OTO C;  4R1L A;  2ATW A;  1WCJ A;  2E5L C;  2ASB A;  5CZX A;  2AYA A;  2P2J A;  5K8F A;  4B3S C;  2Z51 A;  3DAY A;  1XRC A;  3UX3 A;  5A1I A;  2HHH C;  1IBK C; 
#chains in the Genus database with same CATH homology
 3N2Q A;  5KEI A;  4GKK C;  4YHH C;  2P02 A;  2P2F A;  1MDB A;  1XMO C;  4K0K C;  3PES A;  1T5D X;  3RG2 A;  3J7A D;  1HNW C;  3RV2 A;  4OXI A;  2XR1 A;  3DHV A;  1V26 A;  2YCB A;  3E7W A;  3TQI A;  4BC9 A;  4DV0 C;  2E8E A;  4IR7 A;  2DPL A;  2ONF A;  5BUQ A;  4BCA A;  4DCU A;  3IEV A;  4D4I A;  4NXN C;  5K85 A;  4B3T C;  2UXD C;  5GTD A;  1EGA A;  3FCE A;  4JYA C;  5FLX D;  2ZM6 C;  4D56 A;  1MXC A;  1LCI A;  1WF3 A;  2F4V C;  4I9F A;  5DV9 A;  4RM3 A;  4L7I A;  3PBK A;  4KHP C;  3VNQ A;  3A9V A;  3IPL A;  4JV5 C;  4LE5 A;  3GR0 A;  3L95 X;  3A9U A;  4ZJZ A;  4YY3 C;  3EER A;  2QL8 A;  4JI2 C;  2P2B A;  4BC7 A;  3S82 A;  3H2T A;  5KYT A;  1QWI A;  1N32 C;  1MKY A;  3TUF A;  1XRB A;  4B3R C;  2DYJ A;  1NYE A;  3LNV A;  1K0R A;  3N54 B;  3AF5 A;  4LF9 C;  4LFA C;  3VNR A;  4XX2 A;  5H9U A;  2D28 C;  1LQL A;  1VLA A;  4JI8 C;  1WH9 A;  3SO4 A;  4LFB C;  3T1H C;  2P2M A;  4NOZ A;  2WD9 A;  3AF6 A;  3KXW A;  2VQE C;  1RY2 A;  4G37 A;  2P20 A;  4NDN A;  4LF8 C;  4MH4 A;  4DCS A;  4ODJ A;  4MTN A;  3R9W A;  4PRO C;  1L2F A;  2UUC C;  1ULT A;  3NYQ A;  5AE2 A;  4GS5 A;  3GR1 A;  4RLQ A;  5LMU C;  4L2Z A;  4JI1 C;  4OYC A;  2QW0 X;  4B3M C;  5BSV A;  4DV6 C;  4JI0 C;  4RVN A;  2PT7 G;  3R9X A;  1KKG A;  4X62 C;  5AE3 A;  4HPV A;  2E7G A;  1XNQ C;  3UZ0 A;  4U5Y D;  5BSM A;  3FCC A;  4L4Q A;  2YWC A;  3LUS A;  2D1T A;  4JI6 C;  3DLP X;  3IML A;  4JI3 C;  1UKK A;  5BSR A;  3T1Y C;  4I9G A;  4FUQ A;  4JI5 C;  4ISB A;  4IZ6 A;  1XMQ C;  3J80 D;  2D1S A;  1ZB8 A;  1P7L A;  4R0M A;  4DUY C;  4AQY C;  4EAT A;  2E8F A;  1HNX C;  2QVY X;  5LMN C;  1FJG C;  4DR7 C;  5BSW A;  4X64 C;  2VSQ A;  5BUR A;  1USP A;  3CW8 X;  3UOW A;  1JOS A;  4LF4 C;  2UXC C;  2D27 A;  2E8C A;  3LAX A;  4RM2 A;  4WV3 A;  1I94 C;  3C5E A;  1MXB A;  2CXC A;  1RG9 A;  3B7W A;  3NPD A;  1N34 C;  1PA4 A;  1IBM C;  2UU9 C;  2QVX X;  3VNS A;  5A19 A;  5IWA C;  2OBV A;  4DV4 C;  1ZB9 A;  3J81 D;  4JI7 C;  2VZE A;  4GKJ C;  1ML8 A;  1O9T A;  4G1I A;  2D1R A;  3NYR A;  3I07 A;  4DG8 A;  2Y4O A;  4JM1 A;  4KTV A;  3CW9 A;  2UUB C;  1O93 A;  1N33 C;  2CY1 A;  5JRH A;  4DV5 C;  2V7B A;  1XRA A;  2Y27 A;  1MDF A;  4DR2 C;  2D7V A;  1YJ7 A;  5CZV A;  1MXA A;  3E7X A;  2UUA C;  4RLF A;  4LF5 C;  2EGT A;  3GKU A;  5BST A;  5KYV A;  4DUZ C;  1HNZ C;  1BA3 A;  4LF6 C;  4DV7 C;  4JI4 C;  1T5H X;  5IFI A;  5A1G A;  2KZF A;  5BR8 C;  4FUT A;  5IT9 D;  5A2Q D;  3NI2 A;  2Y4N A;  1AMU A;  4DR4 C;  4DR6 C;  2OO4 A;  3L8C A;  5T8T A;  1N2F A;  2OPL B;  5BSU A;  1J5E C;  4DG9 A;  4OX9 C;  4KTT A;  4DR5 C;  3CJE A;  1XNR C;  4LFC C;  2D1Q A;  3ETO A;  1GPM A;  4DCT A;  1PG3 A;  1O90 A;  1USP B;  3LGX A;  4RMN A;  4DCV A;  3R44 A;  2YWB A;  1PG4 A;  4WS9 A;  3ETC A;  2QVZ X;  3EQ6 A;  1O92 A;  4BSZ A;  5T8S A;  3JAM D;  4RVO A;  1HR0 C;  2PN2 A;  4FTF A;  2VQF C;  3IEU A;  4ZLP A;  4DV2 C;  2UXB C;  1IBL C;  4PZP A;  2P2Q A;  1HH2 P;  2PRO A;  4GXQ A;  5ADZ A;  1V25 A;  3PRO C;  2BH1 X;  3I08 A;  4G36 A;  1N36 C;  4BBY A;  4LF7 C;  4X66 C;  2HJG A;  3TDE A;  5AE1 A;  3G7S A;  4NXM C;  4GXR A;  4DV3 C;  4K0B A;  4X65 C;  1QM4 A;  3GPC A;  4PHT A;  4D57 A;  2E0G A;  1FUG A;  2JMP A;  4D4G A;  3A4I A;  4DR1 C;  5E7Q A;  1MD9 A;  2BJO A;  5BUS A;  4R1M A;  4DV1 C;  2OPL A;  4TPS B;  4DR3 C;  2WP0 C;  3OTO C;  4R1L A;  2ATW A;  2E5L C;  2ASB A;  5CZX A;  2AYA A;  2P2J A;  5K8F A;  4B3S C;  3DAY A;  1XRC A;  5A1I A;  2HHH C;  1IBK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...