1IBKC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibkC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibkC02
3IEVA 3LUSA 3T1YC 1IBLC 4JI0C 2HHHC 4X66C 4K0KC 2UUAC 2E5LC 1UKKA 4DV0C 1J5EC 1HH2P 4JYAC 4DCVA 3JAMD 2XR1A 1HNXC 2UXBC 2E8CA 4LF4C 2YCBA 4NXMC 3R9WA 1FJGC 2JMPA 2BJOA 1HR0C 4NOZA 1IBMC 4JI6C 4DV2C 1N36C 2D7VA 1JOSA 2PT7G 4NXNC 1USPB 3I07A 3J81D 3AF6A 4GKJC 2VQEC 4KHPC 2E8EA 4X64C 4GKKC 1N34C 2ZM6C 2E7GA 1EGAA 2OPLB 4DV7C 3OTOC 4DR3C 1WH9A 5FLXD 1IBKC 4LF9C 4DCUA 2PN2A 4YY3C 4DCTA 1WF3A 1XNQC 4JI1C 4LFBC 4BSZA 4DR2C 1ML8A 4JI5C 2QL8A 4DR4C 5IT9D 3J80D 4DR7C 1HNZC 4JI2C 1XMQC 2UUBC 2UXCC 1XMOC 5LMUC 4DR6C 4X62C 2UU9C 3GKUA 2ATWA 4JI8C 1QWIA 1ZB8A 5LMNC 4DV3C 4DR1C 1XNRC 4LF6C 2VQFC 4JI7C 3R9XA 1MKYA 2E8FA 4LFCC 3J7AD 2F4VC 1I94C 2KZFA 4B3RC 2CXCA 3IEUA 1N33C 1N2FA 5A2QD 4X65C 1PA4A 4OX9C 4MH4A 4DV1C 2UXDC 4B3MC 4DUYC 4AQYC 4LF7C 4DV6C 1L2FA 5IWAC 3AF5A 4DCSA 4B3TC 1NYEA 4LF8C 3CJEA 4MTNA 2HJGA 1K0RA 1ZB9A 3T1HC 3EERA 5BR8C 1KKGA 2ONFA 2EGTA 4DV4C 1N32C 2ASBA 4LF5C 2DYJA 4XX2A 1USPA 4DV5C 1LQLA 4JI4C 4JI3C 4JV5C 2CY1A 2OPLA 2UUCC 4YHHC 4LFAC 4DUZC 1HNWC 1VLAA 4DR5C 4B3SC
chains in the Genus database with same CATH superfamily
5H9UA 3L95X 5BSRA 2P2MA 1YJ7A 4WV3A 2UUAC 1J5EC 1HH2P 4G37A 4JYAC 2XR1A 5T8SA 5BSWA 1FJGC 2JMPA 4NOZA 4GXQA 2M5OA 4JI6C 2V7BA 4PUGA 3L8CA 4U5YD 4D4GA 1FUGA 2E8EA 3OTOC 4DR3C 1IBKC 4FUQA 1P7LA 2PN2A 4KTVA 4YY3C 3SO4A 1WF3A 1XNQC 5BSVA 5GTDA 2M5HA 5IT9D 4JI2C 2D1QA 1V25A 1ULTA 2UXCC 1P4EC 3TR3A 2ATWA 3ETCA 1QWIA 4DV3C 3ETOA 4LF6C 5KYVA 1MDFA 1MKYA 4LFCC 3J7AD 2F4VC 3CW9A 2KZFA 3NI2A 1XHJA 2P02A 1N33C 1XS3A 1O93A 2D1TA 3GPCA 1LCIA 1PA4A 4RMNA 2UXDC 4AQYC 4DV6C 4RM3A 5CZVA 1NYEA 3CJEA 4MTNA 4GXRA 3T1HC 3E7XA 2P20A 1FLOA 1V26A 5BUSA 5BR8C 2ZZMA 5BURA 2ASBA 3DAYA 3LGXA 5KYTA 3A9VA 4DG8A 1USPA 4BCAA 2YX1A 3A26A 4RLFA 1LQLA 3O2EA 1P4EA 4JI3C 2D28C 2OPLA 3RV2A 4YHHC 4LFAC 1HNWC 1VLAA 4DR5C 3IEVA 1AMUA 4GS5A 4FUTA 4D57A 4X66C 4K0KC 3S82A 3CQ1A 4DV0C 2CU6A 4IR7A 3JAMD 1HNXC 5A19A 4NXMC 2ZTBA 1HR0C 2BJOA 3B7WA 3RG2A 4RVOA 4ZJZA 4DV2C 3NPDA 4PHTA 2NCLA 1WCJA 1RY2A 3C5EA 4X64C 4GKKC 2E7GA 1EGAA 4HPVA 5KEIA 4LF9C 2KDNA 3G7SA 4DCUA 4DCTA 4JI1C 4FTFA 4BSZA 4DR2C 4JI5C 2QL8A 2D1RA 5JRHA 4DR4C 2VSQA 1XMQC 4G36A 5BSUA 3GKUA 2QVXX 2VQFC 3R9XA 3A25A 4D56A 5DV9A 1I94C 4B3RC 1TH5A 3FM7A 1N2FA 2QVYX 4RVNA 4BC9A 5A2QD 4OX9C 5LCIA 4B3MC 4L4QA 1L2FA 5IWAC 4DCSA 2HJGA 3LAXA 3EERA 4G1IA 1KKGA 3TDEA 3EQ6A 3N2QA 4ZLPA 3VNQA 1XRBA 3TUFA 4ODJA 2YWCA 4PZPA 5K85A 3FCEA 1V60A 4JV5C 4RLQA 4K0BA 2KZ0A 2P2BA 3IMLA 4I9FA 3LUSA 3T1YC 1XRCA 2E5LC 1UKKA 2Z51A 4L7IA 2Y4NA 2D27A 3CQ2A 4PUHA 4DCVA 2DPLA 3KXWA 2UXBC 2E8CA 5A1GA 2YCBA 2E0GA 1IBMC 5T8TA 4NDNA 3LNOA 4PUIA 1JOSA 4OXIA 2PT7G 4GKJC 3I07A 3A4IA 3N54B 5E7QA 2JNVA 4DV7C 4EATA 2P2JA 5FLXD 3UOWA 3UZ0A 3LNVA 1MDBA 2BH1X 1IB8A 1XRAA 4KTTA 5BUQA 2OBVA 4TPSB 3J80D 4DR7C 2UUBC 1PG4A 4X62C 2UU9C 4ISBA 4JI8C 1PU1A 3UX2A 1RG9A 5LMNC 4DR1C 4JI7C 1GPMA 3GR1A 2E8FA 2MMAB 2P2FA 5CZXA 5BSTA 3I08A 5BSMA 4X65C 1O92A 3DHVA 4DUYC 4LF7C 3PESA 2QW0X 1K0RA 3CQ3A 3NYQA 2ONFA 3FCCA 4LF5C 1O9TA 3K6RA 4XX2A 1M6XC 2P2QA 3VNRA 1PG3A 4JI4C 2CY1A 4BBYA 3IPLA 2WD9A 1MD9A 4R0MA 2D1SA 5A1IA 3E7WA 3UX3A 1IBLC 3TQIA 4JI0C 2HHHC 3CW8X 4L2ZA 4I9GA 4BC7A 1VEHA 3VNSA 2WP0C 1YGTA 4LF4C 3R9WA 5AE1A 1N36C 4OYCA 2Y27A 2D7VA 5IFIA 1USPB 3J81D 4NXNC 3AF6A 2VQEC 1UWDA 5K8FA 4KHPC 1N34C 2ZM6C 2OPLB 1M6XA 1WH9A 4DG9A 2QVZX 2MM9A 2YWBA 4LFBC 1MXCA 1O90A 1ML8A 3AY0A 2DHMA 3GR0A 1HNZC 3UEBA 3A9UA 3R44A 1XMOC 5LMUC 4DR6C 1XDXA 2PROA 1ZB8A 1XNRC 4R1MA 3DLPX 3PBKA 1NY8A 2CXCA 3IEUA 4D4IA 4PROC 2OO4A 4JM1A 4RM2A 4MH4A 5AE3A 4R1LA 4DV1C 1T5DX 3AF5A 3NYRA 4B3TC 4LF8C 2PG1E 1ZB9A 5AE2A 4LE5A 1QM4A 2AYAA 1MXAA 5ADZA 2EGTA 4DV4C 1N32C 2DYJA 1MXBA 3PROC 2VZEA 1BA3A 2MCQA 4WS9A 2ZZNA 4DV5C 1T5HX 2UUCC 3H2TA 4DUZC 2Y4OA 4IZ6A 4B3SC
chains in the Genus database with same CATH topology
5H9UA 3L95X 5BSRA 2P2MA 1YJ7A 4WV3A 2UUAC 1J5EC 1HH2P 4G37A 4JYAC 2XR1A 5T8SA 5BSWA 1FJGC 2JMPA 4NOZA 4GXQA 4JI6C 2V7BA 3L8CA 4U5YD 4D4GA 1FUGA 2E8EA 3OTOC 4DR3C 1IBKC 4FUQA 1P7LA 2PN2A 4KTVA 4YY3C 3SO4A 1WF3A 1XNQC 5BSVA 5GTDA 5IT9D 4JI2C 2D1QA 1V25A 1ULTA 2UXCC 2ATWA 3ETCA 1QWIA 4DV3C 3ETOA 4LF6C 5KYVA 1MDFA 1MKYA 4LFCC 3J7AD 2F4VC 3CW9A 2KZFA 3NI2A 2P02A 1N33C 1O93A 2D1TA 3GPCA 1LCIA 1PA4A 4RMNA 2UXDC 4AQYC 4DV6C 4RM3A 5CZVA 1NYEA 3CJEA 4MTNA 4GXRA 3T1HC 3E7XA 2P20A 1V26A 5BUSA 5BR8C 5BURA 2ASBA 3DAYA 3LGXA 5KYTA 3A9VA 4DG8A 1USPA 4BCAA 4RLFA 1LQLA 4JI3C 2D28C 2OPLA 3RV2A 4YHHC 4LFAC 1HNWC 1VLAA 4DR5C 3IEVA 1AMUA 4GS5A 4FUTA 4D57A 4X66C 4K0KC 3S82A 4DV0C 4IR7A 3JAMD 1HNXC 5A19A 4NXMC 1HR0C 2BJOA 3B7WA 3RG2A 4RVOA 4ZJZA 4DV2C 3NPDA 4PHTA 1RY2A 3C5EA 4X64C 4GKKC 2E7GA 1EGAA 4HPVA 5KEIA 4LF9C 4DCUA 3G7SA 4DCTA 4JI1C 4FTFA 4BSZA 4DR2C 4JI5C 2QL8A 2D1RA 5JRHA 4DR4C 2VSQA 1XMQC 4G36A 5BSUA 3GKUA 2QVXX 2VQFC 3R9XA 4D56A 5DV9A 1I94C 4B3RC 1N2FA 2QVYX 4RVNA 4BC9A 5A2QD 4OX9C 4B3MC 4L4QA 1L2FA 5IWAC 4DCSA 2HJGA 3LAXA 3EERA 4G1IA 1KKGA 3TDEA 3EQ6A 3N2QA 4ZLPA 3VNQA 1XRBA 3TUFA 4ODJA 2YWCA 4PZPA 5K85A 3FCEA 4JV5C 4RLQA 4K0BA 2P2BA 3IMLA 4I9FA 3LUSA 3T1YC 1XRCA 2E5LC 1UKKA 4L7IA 2Y4NA 2D27A 4DCVA 2DPLA 3KXWA 2UXBC 2E8CA 5A1GA 2YCBA 2E0GA 1IBMC 5T8TA 4NDNA 1JOSA 4OXIA 2PT7G 4GKJC 3I07A 3A4IA 3N54B 5E7QA 4DV7C 4EATA 2P2JA 5FLXD 3UOWA 3UZ0A 3LNVA 1MDBA 2BH1X 1XRAA 4KTTA 5BUQA 2OBVA 4TPSB 3J80D 4DR7C 2UUBC 1PG4A 4X62C 2UU9C 4ISBA 4JI8C 1RG9A 5LMNC 4DR1C 4JI7C 1GPMA 3GR1A 2E8FA 2P2FA 5CZXA 5BSTA 3I08A 5BSMA 4X65C 1O92A 3DHVA 4DUYC 4LF7C 3PESA 2QW0X 1K0RA 3NYQA 2ONFA 3FCCA 4LF5C 1O9TA 4XX2A 2P2QA 3VNRA 1PG3A 4JI4C 2CY1A 4BBYA 3IPLA 2WD9A 1MD9A 4R0MA 2D1SA 5A1IA 3E7WA 1IBLC 3TQIA 4JI0C 2HHHC 3CW8X 4L2ZA 4I9GA 4BC7A 3VNSA 2WP0C 4LF4C 3R9WA 5AE1A 1N36C 4OYCA 2Y27A 2D7VA 5IFIA 1USPB 3J81D 4NXNC 3AF6A 2VQEC 5K8FA 4KHPC 1N34C 2ZM6C 2OPLB 1WH9A 4DG9A 2QVZX 2YWBA 4LFBC 1MXCA 1O90A 1ML8A 3GR0A 1HNZC 3A9UA 3R44A 1XMOC 5LMUC 4DR6C 2PROA 1ZB8A 1XNRC 4R1MA 3DLPX 3PBKA 2CXCA 3IEUA 4PROC 4D4IA 2OO4A 4JM1A 4RM2A 4MH4A 5AE3A 4R1LA 4DV1C 1T5DX 3AF5A 3NYRA 4B3TC 4LF8C 1ZB9A 5AE2A 4LE5A 1QM4A 2AYAA 1MXAA 5ADZA 2EGTA 4DV4C 1N32C 2DYJA 1MXBA 3PROC 2VZEA 1BA3A 4WS9A 4DV5C 1T5HX 2UUCC 3H2TA 4DUZC 2Y4OA 4IZ6A 4B3SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEV A;  3LUS A;  3T1Y C;  1IBL C;  4JI0 C;  2HHH C;  4X66 C;  4K0K C;  2UUA C;  2E5L C;  1UKK A;  4DV0 C;  1J5E C;  1HH2 P;  4JYA C;  4DCV A;  3JAM D;  2XR1 A;  1HNX C;  2UXB C;  2E8C A;  4LF4 C;  2YCB A;  4NXM C;  3R9W A;  1FJG C;  2JMP A;  2BJO A;  1HR0 C;  4NOZ A;  1IBM C;  4JI6 C;  4DV2 C;  1N36 C;  2D7V A;  1JOS A;  2PT7 G;  4NXN C;  1USP B;  3I07 A;  3J81 D;  3AF6 A;  4GKJ C;  2VQE C;  4KHP C;  2E8E A;  4X64 C;  4GKK C;  1N34 C;  2ZM6 C;  2E7G A;  1EGA A;  2OPL B;  4DV7 C;  3OTO C;  4DR3 C;  1WH9 A;  5FLX D;  1IBK C;  4LF9 C;  4DCU A;  2PN2 A;  4YY3 C;  4DCT A;  1WF3 A;  1XNQ C;  4JI1 C;  4LFB C;  4BSZ A;  4DR2 C;  1ML8 A;  4JI5 C;  2QL8 A;  4DR4 C;  5IT9 D;  3J80 D;  4DR7 C;  1HNZ C;  4JI2 C;  1XMQ C;  2UUB C;  2UXC C;  1XMO C;  5LMU C;  4DR6 C;  4X62 C;  2UU9 C;  3GKU A;  2ATW A;  4JI8 C;  1QWI A;  1ZB8 A;  5LMN C;  4DV3 C;  4DR1 C;  1XNR C;  4LF6 C;  2VQF C;  4JI7 C;  3R9X A;  1MKY A;  2E8F A;  4LFC C;  3J7A D;  2F4V C;  1I94 C;  2KZF A;  4B3R C;  2CXC A;  3IEU A;  1N33 C;  1N2F A;  5A2Q D;  4X65 C;  1PA4 A;  4OX9 C;  4MH4 A;  4DV1 C;  2UXD C;  4B3M C;  4DUY C;  4AQY C;  4LF7 C;  4DV6 C;  1L2F A;  5IWA C;  3AF5 A;  4DCS A;  4B3T C;  1NYE A;  4LF8 C;  3CJE A;  4MTN A;  2HJG A;  1K0R A;  1ZB9 A;  3T1H C;  3EER A;  5BR8 C;  1KKG A;  2ONF A;  2EGT A;  4DV4 C;  1N32 C;  2ASB A;  4LF5 C;  2DYJ A;  4XX2 A;  1USP A;  4DV5 C;  1LQL A;  4JI4 C;  4JI3 C;  4JV5 C;  2CY1 A;  2OPL A;  2UUC C;  4YHH C;  4LFA C;  4DUZ C;  1HNW C;  1VLA A;  4DR5 C;  4B3S C; 
#chains in the Genus database with same CATH topology
 5H9U A;  3L95 X;  5BSR A;  2P2M A;  1YJ7 A;  4WV3 A;  2UUA C;  1J5E C;  1HH2 P;  4G37 A;  4JYA C;  2XR1 A;  5T8S A;  5BSW A;  1FJG C;  2JMP A;  4NOZ A;  4GXQ A;  2M5O A;  4JI6 C;  2V7B A;  4PUG A;  3L8C A;  4U5Y D;  4D4G A;  1FUG A;  2E8E A;  3OTO C;  4DR3 C;  1IBK C;  4FUQ A;  1P7L A;  2PN2 A;  4KTV A;  4YY3 C;  3SO4 A;  1WF3 A;  1XNQ C;  5BSV A;  5GTD A;  2M5H A;  5IT9 D;  4JI2 C;  2D1Q A;  1V25 A;  1ULT A;  2UXC C;  1P4E C;  3TR3 A;  2ATW A;  3ETC A;  1QWI A;  4DV3 C;  3ETO A;  4LF6 C;  5KYV A;  1MDF A;  1MKY A;  4LFC C;  3J7A D;  2F4V C;  3CW9 A;  2KZF A;  3NI2 A;  1XHJ A;  2P02 A;  1N33 C;  1XS3 A;  1O93 A;  2D1T A;  3GPC A;  1LCI A;  1PA4 A;  4RMN A;  2UXD C;  4AQY C;  4DV6 C;  4RM3 A;  5CZV A;  1NYE A;  3CJE A;  4MTN A;  4GXR A;  3T1H C;  3E7X A;  2P20 A;  1FLO A;  1V26 A;  5BUS A;  5BR8 C;  2ZZM A;  5BUR A;  2ASB A;  3DAY A;  3LGX A;  5KYT A;  3A9V A;  4DG8 A;  1USP A;  4BCA A;  2YX1 A;  3A26 A;  4RLF A;  1LQL A;  3O2E A;  1P4E A;  4JI3 C;  2D28 C;  2OPL A;  3RV2 A;  4YHH C;  4LFA C;  1HNW C;  1VLA A;  4DR5 C;  3IEV A;  1AMU A;  4GS5 A;  4FUT A;  4D57 A;  4X66 C;  4K0K C;  3S82 A;  3CQ1 A;  4DV0 C;  2CU6 A;  4IR7 A;  3JAM D;  1HNX C;  5A19 A;  4NXM C;  2ZTB A;  1HR0 C;  2BJO A;  3B7W A;  3RG2 A;  4RVO A;  4ZJZ A;  4DV2 C;  3NPD A;  4PHT A;  2NCL A;  1WCJ A;  1RY2 A;  3C5E A;  4X64 C;  4GKK C;  2E7G A;  1EGA A;  4HPV A;  5KEI A;  4LF9 C;  2KDN A;  3G7S A;  4DCU A;  4DCT A;  4JI1 C;  4FTF A;  4BSZ A;  4DR2 C;  4JI5 C;  2QL8 A;  2D1R A;  5JRH A;  4DR4 C;  2VSQ A;  1XMQ C;  4G36 A;  5BSU A;  3GKU A;  2QVX X;  2VQF C;  3R9X A;  3A25 A;  4D56 A;  5DV9 A;  1I94 C;  4B3R C;  1TH5 A;  3FM7 A;  1N2F A;  2QVY X;  4RVN A;  4BC9 A;  5A2Q D;  4OX9 C;  5LCI A;  4B3M C;  4L4Q A;  1L2F A;  5IWA C;  4DCS A;  2HJG A;  3LAX A;  3EER A;  4G1I A;  1KKG A;  3TDE A;  3EQ6 A;  3N2Q A;  4ZLP A;  3VNQ A;  1XRB A;  3TUF A;  4ODJ A;  2YWC A;  4PZP A;  5K85 A;  3FCE A;  1V60 A;  4JV5 C;  4RLQ A;  4K0B A;  2KZ0 A;  2P2B A;  3IML A;  4I9F A;  3LUS A;  3T1Y C;  1XRC A;  2E5L C;  1UKK A;  2Z51 A;  4L7I A;  2Y4N A;  2D27 A;  3CQ2 A;  4PUH A;  4DCV A;  2DPL A;  3KXW A;  2UXB C;  2E8C A;  5A1G A;  2YCB A;  2E0G A;  1IBM C;  5T8T A;  4NDN A;  3LNO A;  4PUI A;  1JOS A;  4OXI A;  2PT7 G;  4GKJ C;  3I07 A;  3A4I A;  3N54 B;  5E7Q A;  2JNV A;  4DV7 C;  4EAT A;  2P2J A;  5FLX D;  3UOW A;  3UZ0 A;  3LNV A;  1MDB A;  2BH1 X;  1IB8 A;  1XRA A;  4KTT A;  5BUQ A;  2OBV A;  4TPS B;  3J80 D;  4DR7 C;  2UUB C;  1PG4 A;  4X62 C;  2UU9 C;  4ISB A;  4JI8 C;  1PU1 A;  3UX2 A;  1RG9 A;  5LMN C;  4DR1 C;  4JI7 C;  1GPM A;  3GR1 A;  2E8F A;  2MMA B;  2P2F A;  5CZX A;  5BST A;  3I08 A;  5BSM A;  4X65 C;  1O92 A;  3DHV A;  4DUY C;  4LF7 C;  3PES A;  2QW0 X;  1K0R A;  3CQ3 A;  3NYQ A;  2ONF A;  3FCC A;  4LF5 C;  1O9T A;  3K6R A;  4XX2 A;  1M6X C;  2P2Q A;  3VNR A;  1PG3 A;  4JI4 C;  2CY1 A;  4BBY A;  3IPL A;  2WD9 A;  1MD9 A;  4R0M A;  2D1S A;  5A1I A;  3E7W A;  3UX3 A;  1IBL C;  3TQI A;  4JI0 C;  2HHH C;  3CW8 X;  4L2Z A;  4I9G A;  4BC7 A;  1VEH A;  3VNS A;  2WP0 C;  1YGT A;  4LF4 C;  3R9W A;  5AE1 A;  1N36 C;  4OYC A;  2Y27 A;  2D7V A;  5IFI A;  1USP B;  3J81 D;  4NXN C;  3AF6 A;  2VQE C;  1UWD A;  5K8F A;  4KHP C;  1N34 C;  2ZM6 C;  2OPL B;  1M6X A;  1WH9 A;  4DG9 A;  2QVZ X;  2MM9 A;  2YWB A;  4LFB C;  1MXC A;  1O90 A;  1ML8 A;  3AY0 A;  2DHM A;  3GR0 A;  1HNZ C;  3UEB A;  3A9U A;  3R44 A;  1XMO C;  5LMU C;  4DR6 C;  1XDX A;  2PRO A;  1ZB8 A;  1XNR C;  4R1M A;  3DLP X;  3PBK A;  1NY8 A;  2CXC A;  3IEU A;  4D4I A;  4PRO C;  2OO4 A;  4JM1 A;  4RM2 A;  4MH4 A;  5AE3 A;  4R1L A;  4DV1 C;  1T5D X;  3AF5 A;  3NYR A;  4B3T C;  4LF8 C;  2PG1 E;  1ZB9 A;  5AE2 A;  4LE5 A;  1QM4 A;  2AYA A;  1MXA A;  5ADZ A;  2EGT A;  4DV4 C;  1N32 C;  2DYJ A;  1MXB A;  3PRO C;  2VZE A;  1BA3 A;  2MCQ A;  4WS9 A;  2ZZN A;  4DV5 C;  1T5H X;  2UUC C;  3H2T A;  4DUZ C;  2Y4O A;  4IZ6 A;  4B3S C; 
#chains in the Genus database with same CATH homology
 5H9U A;  3L95 X;  5BSR A;  2P2M A;  1YJ7 A;  4WV3 A;  2UUA C;  1J5E C;  1HH2 P;  4G37 A;  4JYA C;  2XR1 A;  5T8S A;  5BSW A;  1FJG C;  2JMP A;  4NOZ A;  4GXQ A;  4JI6 C;  2V7B A;  3L8C A;  4U5Y D;  4D4G A;  1FUG A;  2E8E A;  3OTO C;  4DR3 C;  1IBK C;  4FUQ A;  1P7L A;  2PN2 A;  4KTV A;  4YY3 C;  3SO4 A;  1WF3 A;  1XNQ C;  5BSV A;  5GTD A;  5IT9 D;  4JI2 C;  2D1Q A;  1V25 A;  1ULT A;  2UXC C;  2ATW A;  3ETC A;  1QWI A;  4DV3 C;  3ETO A;  4LF6 C;  5KYV A;  1MDF A;  1MKY A;  4LFC C;  3J7A D;  2F4V C;  3CW9 A;  2KZF A;  3NI2 A;  2P02 A;  1N33 C;  1O93 A;  2D1T A;  3GPC A;  1LCI A;  1PA4 A;  4RMN A;  2UXD C;  4AQY C;  4DV6 C;  4RM3 A;  5CZV A;  1NYE A;  3CJE A;  4MTN A;  4GXR A;  3T1H C;  3E7X A;  2P20 A;  1V26 A;  5BUS A;  5BR8 C;  5BUR A;  2ASB A;  3DAY A;  3LGX A;  5KYT A;  3A9V A;  4DG8 A;  1USP A;  4BCA A;  4RLF A;  1LQL A;  4JI3 C;  2D28 C;  2OPL A;  3RV2 A;  4YHH C;  4LFA C;  1HNW C;  1VLA A;  4DR5 C;  3IEV A;  1AMU A;  4GS5 A;  4FUT A;  4D57 A;  4X66 C;  4K0K C;  3S82 A;  4DV0 C;  4IR7 A;  3JAM D;  1HNX C;  5A19 A;  4NXM C;  1HR0 C;  2BJO A;  3B7W A;  3RG2 A;  4RVO A;  4ZJZ A;  4DV2 C;  3NPD A;  4PHT A;  1RY2 A;  3C5E A;  4X64 C;  4GKK C;  2E7G A;  1EGA A;  4HPV A;  5KEI A;  4LF9 C;  4DCU A;  3G7S A;  4DCT A;  4JI1 C;  4FTF A;  4BSZ A;  4DR2 C;  4JI5 C;  2QL8 A;  2D1R A;  5JRH A;  4DR4 C;  2VSQ A;  1XMQ C;  4G36 A;  5BSU A;  3GKU A;  2QVX X;  2VQF C;  3R9X A;  4D56 A;  5DV9 A;  1I94 C;  4B3R C;  1N2F A;  2QVY X;  4RVN A;  4BC9 A;  5A2Q D;  4OX9 C;  4B3M C;  4L4Q A;  1L2F A;  5IWA C;  4DCS A;  2HJG A;  3LAX A;  3EER A;  4G1I A;  1KKG A;  3TDE A;  3EQ6 A;  3N2Q A;  4ZLP A;  3VNQ A;  1XRB A;  3TUF A;  4ODJ A;  2YWC A;  4PZP A;  5K85 A;  3FCE A;  4JV5 C;  4RLQ A;  4K0B A;  2P2B A;  3IML A;  4I9F A;  3LUS A;  3T1Y C;  1XRC A;  2E5L C;  1UKK A;  4L7I A;  2Y4N A;  2D27 A;  4DCV A;  2DPL A;  3KXW A;  2UXB C;  2E8C A;  5A1G A;  2YCB A;  2E0G A;  1IBM C;  5T8T A;  4NDN A;  1JOS A;  4OXI A;  2PT7 G;  4GKJ C;  3I07 A;  3A4I A;  3N54 B;  5E7Q A;  4DV7 C;  4EAT A;  2P2J A;  5FLX D;  3UOW A;  3UZ0 A;  3LNV A;  1MDB A;  2BH1 X;  1XRA A;  4KTT A;  5BUQ A;  2OBV A;  4TPS B;  3J80 D;  4DR7 C;  2UUB C;  1PG4 A;  4X62 C;  2UU9 C;  4ISB A;  4JI8 C;  1RG9 A;  5LMN C;  4DR1 C;  4JI7 C;  1GPM A;  3GR1 A;  2E8F A;  2P2F A;  5CZX A;  5BST A;  3I08 A;  5BSM A;  4X65 C;  1O92 A;  3DHV A;  4DUY C;  4LF7 C;  3PES A;  2QW0 X;  1K0R A;  3NYQ A;  2ONF A;  3FCC A;  4LF5 C;  1O9T A;  4XX2 A;  2P2Q A;  3VNR A;  1PG3 A;  4JI4 C;  2CY1 A;  4BBY A;  3IPL A;  2WD9 A;  1MD9 A;  4R0M A;  2D1S A;  5A1I A;  3E7W A;  1IBL C;  3TQI A;  4JI0 C;  2HHH C;  3CW8 X;  4L2Z A;  4I9G A;  4BC7 A;  3VNS A;  2WP0 C;  4LF4 C;  3R9W A;  5AE1 A;  1N36 C;  4OYC A;  2Y27 A;  2D7V A;  5IFI A;  1USP B;  3J81 D;  4NXN C;  3AF6 A;  2VQE C;  5K8F A;  4KHP C;  1N34 C;  2ZM6 C;  2OPL B;  1WH9 A;  4DG9 A;  2QVZ X;  2YWB A;  4LFB C;  1MXC A;  1O90 A;  1ML8 A;  3GR0 A;  1HNZ C;  3A9U A;  3R44 A;  1XMO C;  5LMU C;  4DR6 C;  2PRO A;  1ZB8 A;  1XNR C;  4R1M A;  3DLP X;  3PBK A;  2CXC A;  3IEU A;  4PRO C;  4D4I A;  2OO4 A;  4JM1 A;  4RM2 A;  4MH4 A;  5AE3 A;  4R1L A;  4DV1 C;  1T5D X;  3AF5 A;  3NYR A;  4B3T C;  4LF8 C;  1ZB9 A;  5AE2 A;  4LE5 A;  1QM4 A;  2AYA A;  1MXA A;  5ADZ A;  2EGT A;  4DV4 C;  1N32 C;  2DYJ A;  1MXB A;  3PRO C;  2VZE A;  1BA3 A;  4WS9 A;  4DV5 C;  1T5H X;  2UUC C;  3H2T A;  4DUZ C;  2Y4O A;  4IZ6 A;  4B3S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...