4LF5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf5C02
2UUAC 3T1YC 1N36C 2VQEC 5IT9D 4DUYC 1JOSA 1ZB8A 3J81D 2E8CA 1KKGA 2ZM6C 2VQFC 4BSZA 4DV3C 4DR6C 3J7AD 1XNQC 1EGAA 4LF9C 2EGTA 1N32C 4DR3C 4JI6C 5LMNC 1USPA 2CXCA 3AF5A 3IEUA 1IBMC 4DV7C 1N2FA 3OTOC 4JI5C 4X66C 4DV6C 2OPLB 1ZB9A 1HNWC 1UKKA 1N34C 1K0RA 4B3MC 2QL8A 3IEVA 4YHHC 2OPLA 1L2FA 3T1HC 4NXNC 4JYAC 2D7VA 4LF7C 1XNRC 4GKKC 1PA4A 4X64C 1IBLC 4MH4A 5LMUC 2UXDC 4DV1C 4DCTA 4XX2A 1J5EC 4LFBC 4DV5C 3AF6A 4LF6C 4LFAC 2DYJA 4X65C 3JAMD 5A2QD 4DUZC 4JI7C 2JMPA 5BR8C 4LF5C 4B3TC 1USPB 4JI8C 4DR7C 1WH9A 1HH2P 4B3SC 4LF4C 3R9WA 1XMQC 4DCUA 4MTNA 4DR1C 2E5LC 2UUCC 1XMOC 4JI3C 4DCSA 2UU9C 4JI1C 2UXCC 1NYEA 1IBKC 2UUBC 4DV4C 2E7GA 1WF3A 4LFCC 1HR0C 1HNZC 1ML8A 2UXBC 4DV0C 1LQLA 4LF8C 4KHPC 4JV5C 2HJGA 4GKJC 4YY3C 4DV2C 5IWAC 2PN2A 3I07A 2BJOA 1FJGC 5FLXD 1N33C 2ONFA 1QWIA 2PT7G 4K0KC 4DR2C 2HHHC 2E8EA 4DCVA 3LUSA 4NOZA 4NXMC 3R9XA 1MKYA 1HNXC 2ATWA 3CJEA 4JI4C 3EERA 3J80D 2F4VC 4B3RC 4AQYC 4JI0C 2XR1A 4DR5C 2YCBA 1I94C 2CY1A 2E8FA 1VLAA 2ASBA 4OX9C 3GKUA 4JI2C 4DR4C 2KZFA 4X62C
chains in the Genus database with same CATH superfamily
2UUAC 3LNOA 5BSRA 3C5EA 1KKGA 3DAYA 2VQFC 4DV3C 3PBKA 5K8FA 4K0BA 1XNQC 3I08A 4BC9A 2KDNA 1USPA 3AF5A 3OTOC 4X66C 3CW9A 3E7WA 1ZB9A 1QM4A 1K0RA 4PUIA 4B3MC 2QL8A 4G1IA 4JYAC 4LF7C 1XNRC 1PA4A 4PZPA 5A19A 5BSWA 2UXDC 4DV1C 3H2TA 1V60A 1ULTA 2YWCA 4LFAC 4NDNA 3K6RA 4PUGA 5BR8C 4HPVA 4DR7C 3R9WA 1RY2A 4PROC 2WP0C 4DR1C 3LAXA 4PHTA 5A1GA 1IBKC 4FTFA 2E7GA 1PG3A 4FUQA 2D1QA 4DV0C 2M5HA 4BC7A 4FUTA 5LCIA 1GPMA 2P2QA 1MXAA 3VNSA 2PN2A 1V26A 1XS3A 4U5YD 5E7QA 2ONFA 4K0KC 1O93A 3S82A 4R1MA 2MM9A 3LUSA 4NOZA 2M5OA 1WCJA 1HNXC 2ATWA 4JI4C 4JI0C 1P7LA 1M6XA 2Y4NA 5KYTA 4R0MA 4JI2C 2MMAB 4X62C 1O90A 1MXCA 3UZ0A 3T1YC 2VQEC 1N36C 3J81D 2E8CA 2ZM6C 4BSZA 3FCCA 1BA3A 4L7IA 5BSTA 1EGAA 4WS9A 2CXCA 3IEUA 3NPDA 5CZXA 3L8CA 4DV6C 2D1RA 3LGXA 1IB8A 3UX2A 3UEBA 2OPLA 3T1HC 2ZZMA 2D7VA 4GKKC 3A26A 3TQIA 4DCTA 4D57A 2D27A 1J5EC 4DV5C 4LF6C 4L4QA 2DYJA 4X65C 4DUZC 2PG1E 4JI7C 2JMPA 1MDBA 1HH2P 3O2EA 4D4IA 4LF4C 1MXBA 4RVNA 2D1TA 3B7WA 1XMOC 4JI3C 2UU9C 3GPCA 4GXRA 2D1SA 2UXBC 1LQLA 5CZVA 4KHPC 4JV5C 2DPLA 4GKJC 4JM1A 2OBVA 1FUGA 1T5DX 2QW0X 3I07A 5ADZA 5AE3A 4IZ6A 5FLXD 3A4IA 3G7SA 2ZTBA 4ODJA 2E8EA 4DCVA 1YGTA 2V7BA 4ISBA 4RLQA 3J80D 2KZ0A 4DR5C 4BBYA 1T5HX 3CQ2A 2CU6A 3GKUA 1ZB8A 2P2BA 1UWDA 4LF9C 2EGTA 5BSMA 2DHMA 3ETCA 2Z51A 4JI6C 1PU1A 1IBMC 3PROC 4JI5C 2Y27A 5BUSA 3CQ3A 2OPLB 5JRHA 5BURA 2QVZX 3RV2A 4DG9A 5AE2A 2YWBA 4RMNA 4YHHC 3FM7A 4NXNC 3ETOA 1IBLC 5LMUC 1XHJA 3FCEA 2WD9A 3IPLA 4EATA 3NI2A 3AF6A 3TR3A 5KEIA 3R44A 4LF5C 1O9TA 4B3TC 1USPB 1WH9A 4OYCA 4B3SC 4LE5A 1AMUA 2E5LC 4BCAA 1RG9A 1XRBA 1NYEA 4DV4C 1XRAA 1WF3A 4LFCC 1ML8A 3RG2A 2AYAA 5DV9A 4GS5A 4RVOA 5K85A 3TUFA 3A9UA 1MDFA 1VEHA 4KTTA 5IWAC 3GR0A 1FJGC 3TDEA 5IFIA 3A9VA 4OXIA 5T8TA 4NXMC 3DHVA 3R9XA 3NYQA 3CJEA 1LCIA 2P2JA 2VZEA 4IR7A 4RLFA 2F4VC 2YCBA 1I94C 2P2FA 2E8FA 1VLAA 4L2ZA 4GXQA 3A25A 3IMLA 3SO4A 2KZFA 4DV7C 2OO4A 5IT9D 4DUYC 3DLPX 1JOSA 2BH1X 5A1IA 3N2QA 4DR6C 3J7AD 1MD9A 4R1LA 5BSUA 1N32C 4DR3C 1TH5A 2JNVA 5LMNC 1FLOA 4WV3A 1N2FA 4TPSB 1YJ7A 3E7XA 3N54B 3CW8X 1HNWC 2ZZNA 3NYRA 1UKKA 2D28C 1N34C 3IEVA 2Y4OA 1L2FA 5BUQA 3CQ1A 4X64C 4MH4A 5AE1A 3VNRA 4G36A 2QVYX 3L95X 3GR1A 4XX2A 4LFBC 1O92A 4I9GA 5A2QD 2P20A 3EQ6A 3JAMD 1PG4A 4JI8C 1XMQC 4DCUA 1P4EA 4MTNA 2UUCC 2UXCC 4DCSA 4JI1C 3AY0A 2UUBC 4G37A 5GTDA 4ZJZA 3PESA 2MCQA 1HR0C 1HNZC 3LNVA 1V25A 4DG8A 4LF8C 4ZLPA 3UOWA 4RM3A 2HJGA 1NY8A 4D56A 1XDXA 4YY3C 4DV2C 2P02A 2QVXX 4KTVA 2NCLA 4I9FA 2BJOA 1N33C 1M6XC 5KYVA 1QWIA 2PT7G 4DR2C 4D4GA 2HHHC 2P2MA 2VSQA 1P4EC 1MKYA 2PROA 5H9UA 3VNQA 5BSVA 3EERA 5T8SA 4PUHA 4B3RC 4AQYC 3UX3A 2XR1A 3KXWA 2E0GA 2CY1A 2YX1A 2ASBA 4OX9C 4DR4C 1XRCA 4RM2A
chains in the Genus database with same CATH topology
2UUAC 5BSRA 3C5EA 1KKGA 3DAYA 2VQFC 4DV3C 3PBKA 5K8FA 4K0BA 1XNQC 3I08A 4BC9A 1USPA 3AF5A 3OTOC 4X66C 3CW9A 3E7WA 1ZB9A 1QM4A 1K0RA 4B3MC 2QL8A 4G1IA 4JYAC 4LF7C 1XNRC 1PA4A 4PZPA 5A19A 5BSWA 2UXDC 4DV1C 3H2TA 1ULTA 2YWCA 4LFAC 4NDNA 5BR8C 4HPVA 4DR7C 3R9WA 1RY2A 4PROC 2WP0C 4DR1C 3LAXA 4PHTA 5A1GA 1IBKC 4FTFA 2E7GA 1PG3A 4FUQA 2D1QA 4DV0C 4BC7A 4FUTA 1GPMA 2P2QA 1MXAA 3VNSA 2PN2A 1V26A 4U5YD 5E7QA 2ONFA 4K0KC 1O93A 3S82A 4R1MA 3LUSA 4NOZA 1HNXC 2ATWA 4JI4C 4JI0C 1P7LA 2Y4NA 5KYTA 4R0MA 4JI2C 4X62C 1O90A 1MXCA 3UZ0A 3T1YC 2VQEC 1N36C 3J81D 2E8CA 2ZM6C 4BSZA 3FCCA 1BA3A 4L7IA 5BSTA 1EGAA 4WS9A 2CXCA 3IEUA 3NPDA 5CZXA 3L8CA 4DV6C 2D1RA 3LGXA 2OPLA 3T1HC 2D7VA 4GKKC 3TQIA 4DCTA 4D57A 2D27A 1J5EC 4DV5C 4LF6C 4L4QA 2DYJA 4X65C 4DUZC 4JI7C 2JMPA 1MDBA 1HH2P 4D4IA 4LF4C 1MXBA 4RVNA 2D1TA 3B7WA 1XMOC 4JI3C 2UU9C 3GPCA 4GXRA 2D1SA 2UXBC 1LQLA 5CZVA 4KHPC 4JV5C 2DPLA 4GKJC 4JM1A 2OBVA 1FUGA 1T5DX 2QW0X 3I07A 5ADZA 5AE3A 4IZ6A 5FLXD 3A4IA 3G7SA 4ODJA 2E8EA 4DCVA 2V7BA 4ISBA 4RLQA 3J80D 4BBYA 1T5HX 4DR5C 3GKUA 1ZB8A 2P2BA 4LF9C 2EGTA 5BSMA 3ETCA 4JI6C 1IBMC 3PROC 4JI5C 2Y27A 5BUSA 2OPLB 5JRHA 5BURA 2QVZX 3RV2A 4DG9A 5AE2A 2YWBA 4RMNA 4YHHC 4NXNC 3ETOA 1IBLC 5LMUC 3FCEA 2WD9A 3IPLA 4EATA 3NI2A 3AF6A 5KEIA 3R44A 4LF5C 1O9TA 4B3TC 1USPB 1WH9A 4OYCA 4B3SC 4LE5A 1AMUA 2E5LC 4BCAA 1RG9A 1XRBA 1NYEA 4DV4C 1XRAA 1WF3A 4LFCC 1ML8A 3RG2A 2AYAA 5DV9A 4GS5A 4RVOA 5K85A 3TUFA 3A9UA 1MDFA 4KTTA 5IWAC 3GR0A 1FJGC 3TDEA 5IFIA 3A9VA 4OXIA 5T8TA 4NXMC 3DHVA 3R9XA 3NYQA 3CJEA 1LCIA 2P2JA 2VZEA 4IR7A 4RLFA 2F4VC 2YCBA 1I94C 2P2FA 2E8FA 1VLAA 4L2ZA 4GXQA 3IMLA 3SO4A 2KZFA 4DV7C 2OO4A 5IT9D 4DUYC 3DLPX 1JOSA 2BH1X 5A1IA 3N2QA 4DR6C 3J7AD 1MD9A 4R1LA 5BSUA 1N32C 4DR3C 5LMNC 4WV3A 1N2FA 4TPSB 1YJ7A 3E7XA 3N54B 3CW8X 1HNWC 3NYRA 1UKKA 2D28C 1N34C 3IEVA 2Y4OA 1L2FA 5BUQA 4X64C 4MH4A 5AE1A 3VNRA 4G36A 2QVYX 3L95X 3GR1A 4XX2A 4LFBC 1O92A 4I9GA 5A2QD 2P20A 3EQ6A 3JAMD 1PG4A 4JI8C 1XMQC 4DCUA 4MTNA 2UUCC 2UXCC 4DCSA 4JI1C 2UUBC 4G37A 5GTDA 4ZJZA 3PESA 1HR0C 1HNZC 3LNVA 1V25A 4DG8A 4LF8C 4ZLPA 3UOWA 4RM3A 2HJGA 4D56A 4YY3C 4DV2C 2P02A 2QVXX 4KTVA 4I9FA 2BJOA 1N33C 5KYVA 1QWIA 2PT7G 4DR2C 4D4GA 2HHHC 2P2MA 2VSQA 1MKYA 2PROA 5H9UA 3VNQA 5BSVA 3EERA 5T8SA 4B3RC 4AQYC 2XR1A 3KXWA 2E0GA 2CY1A 2ASBA 4OX9C 4DR4C 1XRCA 4RM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  3T1Y C;  1N36 C;  2VQE C;  5IT9 D;  4DUY C;  1JOS A;  1ZB8 A;  3J81 D;  2E8C A;  1KKG A;  2ZM6 C;  2VQF C;  4BSZ A;  4DV3 C;  4DR6 C;  3J7A D;  1XNQ C;  1EGA A;  4LF9 C;  2EGT A;  1N32 C;  4DR3 C;  4JI6 C;  5LMN C;  1USP A;  2CXC A;  3AF5 A;  3IEU A;  1IBM C;  4DV7 C;  1N2F A;  3OTO C;  4JI5 C;  4X66 C;  4DV6 C;  2OPL B;  1ZB9 A;  1HNW C;  1UKK A;  1N34 C;  1K0R A;  4B3M C;  2QL8 A;  3IEV A;  4YHH C;  2OPL A;  1L2F A;  3T1H C;  4NXN C;  4JYA C;  2D7V A;  4LF7 C;  1XNR C;  4GKK C;  1PA4 A;  4X64 C;  1IBL C;  4MH4 A;  5LMU C;  2UXD C;  4DV1 C;  4DCT A;  4XX2 A;  1J5E C;  4LFB C;  4DV5 C;  3AF6 A;  4LF6 C;  4LFA C;  2DYJ A;  4X65 C;  3JAM D;  5A2Q D;  4DUZ C;  4JI7 C;  2JMP A;  5BR8 C;  4LF5 C;  4B3T C;  1USP B;  4JI8 C;  4DR7 C;  1WH9 A;  1HH2 P;  4B3S C;  4LF4 C;  3R9W A;  1XMQ C;  4DCU A;  4MTN A;  4DR1 C;  2E5L C;  2UUC C;  1XMO C;  4JI3 C;  4DCS A;  2UU9 C;  4JI1 C;  2UXC C;  1NYE A;  1IBK C;  2UUB C;  4DV4 C;  2E7G A;  1WF3 A;  4LFC C;  1HR0 C;  1HNZ C;  1ML8 A;  2UXB C;  4DV0 C;  1LQL A;  4LF8 C;  4KHP C;  4JV5 C;  2HJG A;  4GKJ C;  4YY3 C;  4DV2 C;  5IWA C;  2PN2 A;  3I07 A;  2BJO A;  1FJG C;  5FLX D;  1N33 C;  2ONF A;  1QWI A;  2PT7 G;  4K0K C;  4DR2 C;  2HHH C;  2E8E A;  4DCV A;  3LUS A;  4NOZ A;  4NXM C;  3R9X A;  1MKY A;  1HNX C;  2ATW A;  3CJE A;  4JI4 C;  3EER A;  3J80 D;  2F4V C;  4B3R C;  4AQY C;  4JI0 C;  2XR1 A;  4DR5 C;  2YCB A;  1I94 C;  2CY1 A;  2E8F A;  1VLA A;  2ASB A;  4OX9 C;  3GKU A;  4JI2 C;  4DR4 C;  2KZF A;  4X62 C; 
#chains in the Genus database with same CATH topology
 2UUA C;  3LNO A;  5BSR A;  3C5E A;  1KKG A;  3DAY A;  2VQF C;  4DV3 C;  3PBK A;  5K8F A;  4K0B A;  1XNQ C;  3I08 A;  4BC9 A;  2KDN A;  1USP A;  3AF5 A;  3OTO C;  4X66 C;  3CW9 A;  3E7W A;  1ZB9 A;  1QM4 A;  1K0R A;  4PUI A;  4B3M C;  2QL8 A;  4G1I A;  4JYA C;  4LF7 C;  1XNR C;  1PA4 A;  4PZP A;  5A19 A;  5BSW A;  2UXD C;  4DV1 C;  3H2T A;  1V60 A;  1ULT A;  2YWC A;  4LFA C;  4NDN A;  3K6R A;  4PUG A;  5BR8 C;  4HPV A;  4DR7 C;  3R9W A;  1RY2 A;  4PRO C;  2WP0 C;  4DR1 C;  3LAX A;  4PHT A;  5A1G A;  1IBK C;  4FTF A;  2E7G A;  1PG3 A;  4FUQ A;  2D1Q A;  4DV0 C;  2M5H A;  4BC7 A;  4FUT A;  5LCI A;  1GPM A;  2P2Q A;  1MXA A;  3VNS A;  2PN2 A;  1V26 A;  1XS3 A;  4U5Y D;  5E7Q A;  2ONF A;  4K0K C;  1O93 A;  3S82 A;  4R1M A;  2MM9 A;  3LUS A;  4NOZ A;  2M5O A;  1WCJ A;  1HNX C;  2ATW A;  4JI4 C;  4JI0 C;  1P7L A;  1M6X A;  2Y4N A;  5KYT A;  4R0M A;  4JI2 C;  2MMA B;  4X62 C;  1O90 A;  1MXC A;  3UZ0 A;  3T1Y C;  2VQE C;  1N36 C;  3J81 D;  2E8C A;  2ZM6 C;  4BSZ A;  3FCC A;  1BA3 A;  4L7I A;  5BST A;  1EGA A;  4WS9 A;  2CXC A;  3IEU A;  3NPD A;  5CZX A;  3L8C A;  4DV6 C;  2D1R A;  3LGX A;  1IB8 A;  3UX2 A;  3UEB A;  2OPL A;  3T1H C;  2ZZM A;  2D7V A;  4GKK C;  3A26 A;  3TQI A;  4DCT A;  4D57 A;  2D27 A;  1J5E C;  4DV5 C;  4LF6 C;  4L4Q A;  2DYJ A;  4X65 C;  4DUZ C;  2PG1 E;  4JI7 C;  2JMP A;  1MDB A;  1HH2 P;  3O2E A;  4D4I A;  4LF4 C;  1MXB A;  4RVN A;  2D1T A;  3B7W A;  1XMO C;  4JI3 C;  2UU9 C;  3GPC A;  4GXR A;  2D1S A;  2UXB C;  1LQL A;  5CZV A;  4KHP C;  4JV5 C;  2DPL A;  4GKJ C;  4JM1 A;  2OBV A;  1FUG A;  1T5D X;  2QW0 X;  3I07 A;  5ADZ A;  5AE3 A;  4IZ6 A;  5FLX D;  3A4I A;  3G7S A;  2ZTB A;  4ODJ A;  2E8E A;  4DCV A;  1YGT A;  2V7B A;  4ISB A;  4RLQ A;  3J80 D;  2KZ0 A;  4DR5 C;  4BBY A;  1T5H X;  3CQ2 A;  2CU6 A;  3GKU A;  1ZB8 A;  2P2B A;  1UWD A;  4LF9 C;  2EGT A;  5BSM A;  2DHM A;  3ETC A;  2Z51 A;  4JI6 C;  1PU1 A;  1IBM C;  3PRO C;  4JI5 C;  2Y27 A;  5BUS A;  3CQ3 A;  2OPL B;  5JRH A;  5BUR A;  2QVZ X;  3RV2 A;  4DG9 A;  5AE2 A;  2YWB A;  4RMN A;  4YHH C;  3FM7 A;  4NXN C;  3ETO A;  1IBL C;  5LMU C;  1XHJ A;  3FCE A;  2WD9 A;  3IPL A;  4EAT A;  3NI2 A;  3AF6 A;  3TR3 A;  5KEI A;  3R44 A;  4LF5 C;  1O9T A;  4B3T C;  1USP B;  1WH9 A;  4OYC A;  4B3S C;  4LE5 A;  1AMU A;  2E5L C;  4BCA A;  1RG9 A;  1XRB A;  1NYE A;  4DV4 C;  1XRA A;  1WF3 A;  4LFC C;  1ML8 A;  3RG2 A;  2AYA A;  5DV9 A;  4GS5 A;  4RVO A;  5K85 A;  3TUF A;  3A9U A;  1MDF A;  1VEH A;  4KTT A;  5IWA C;  3GR0 A;  1FJG C;  3TDE A;  5IFI A;  3A9V A;  4OXI A;  5T8T A;  4NXM C;  3DHV A;  3R9X A;  3NYQ A;  3CJE A;  1LCI A;  2P2J A;  2VZE A;  4IR7 A;  4RLF A;  2F4V C;  2YCB A;  1I94 C;  2P2F A;  2E8F A;  1VLA A;  4L2Z A;  4GXQ A;  3A25 A;  3IML A;  3SO4 A;  2KZF A;  4DV7 C;  2OO4 A;  5IT9 D;  4DUY C;  3DLP X;  1JOS A;  2BH1 X;  5A1I A;  3N2Q A;  4DR6 C;  3J7A D;  1MD9 A;  4R1L A;  5BSU A;  1N32 C;  4DR3 C;  1TH5 A;  2JNV A;  5LMN C;  1FLO A;  4WV3 A;  1N2F A;  4TPS B;  1YJ7 A;  3E7X A;  3N54 B;  3CW8 X;  1HNW C;  2ZZN A;  3NYR A;  1UKK A;  2D28 C;  1N34 C;  3IEV A;  2Y4O A;  1L2F A;  5BUQ A;  3CQ1 A;  4X64 C;  4MH4 A;  5AE1 A;  3VNR A;  4G36 A;  2QVY X;  3L95 X;  3GR1 A;  4XX2 A;  4LFB C;  1O92 A;  4I9G A;  5A2Q D;  2P20 A;  3EQ6 A;  3JAM D;  1PG4 A;  4JI8 C;  1XMQ C;  4DCU A;  1P4E A;  4MTN A;  2UUC C;  2UXC C;  4DCS A;  4JI1 C;  3AY0 A;  2UUB C;  4G37 A;  5GTD A;  4ZJZ A;  3PES A;  2MCQ A;  1HR0 C;  1HNZ C;  3LNV A;  1V25 A;  4DG8 A;  4LF8 C;  4ZLP A;  3UOW A;  4RM3 A;  2HJG A;  1NY8 A;  4D56 A;  1XDX A;  4YY3 C;  4DV2 C;  2P02 A;  2QVX X;  4KTV A;  2NCL A;  4I9F A;  2BJO A;  1N33 C;  1M6X C;  5KYV A;  1QWI A;  2PT7 G;  4DR2 C;  4D4G A;  2HHH C;  2P2M A;  2VSQ A;  1P4E C;  1MKY A;  2PRO A;  5H9U A;  3VNQ A;  5BSV A;  3EER A;  5T8S A;  4PUH A;  4B3R C;  4AQY C;  3UX3 A;  2XR1 A;  3KXW A;  2E0G A;  2CY1 A;  2YX1 A;  2ASB A;  4OX9 C;  4DR4 C;  1XRC A;  4RM2 A; 
#chains in the Genus database with same CATH homology
 2UUA C;  5BSR A;  3C5E A;  1KKG A;  3DAY A;  2VQF C;  4DV3 C;  3PBK A;  5K8F A;  4K0B A;  1XNQ C;  3I08 A;  4BC9 A;  1USP A;  3AF5 A;  3OTO C;  4X66 C;  3CW9 A;  3E7W A;  1ZB9 A;  1QM4 A;  1K0R A;  4B3M C;  2QL8 A;  4G1I A;  4JYA C;  4LF7 C;  1XNR C;  1PA4 A;  4PZP A;  5A19 A;  5BSW A;  2UXD C;  4DV1 C;  3H2T A;  1ULT A;  2YWC A;  4LFA C;  4NDN A;  5BR8 C;  4HPV A;  4DR7 C;  3R9W A;  1RY2 A;  4PRO C;  2WP0 C;  4DR1 C;  3LAX A;  4PHT A;  5A1G A;  1IBK C;  4FTF A;  2E7G A;  1PG3 A;  4FUQ A;  2D1Q A;  4DV0 C;  4BC7 A;  4FUT A;  1GPM A;  2P2Q A;  1MXA A;  3VNS A;  2PN2 A;  1V26 A;  4U5Y D;  5E7Q A;  2ONF A;  4K0K C;  1O93 A;  3S82 A;  4R1M A;  3LUS A;  4NOZ A;  1HNX C;  2ATW A;  4JI4 C;  4JI0 C;  1P7L A;  2Y4N A;  5KYT A;  4R0M A;  4JI2 C;  4X62 C;  1O90 A;  1MXC A;  3UZ0 A;  3T1Y C;  2VQE C;  1N36 C;  3J81 D;  2E8C A;  2ZM6 C;  4BSZ A;  3FCC A;  1BA3 A;  4L7I A;  5BST A;  1EGA A;  4WS9 A;  2CXC A;  3IEU A;  3NPD A;  5CZX A;  3L8C A;  4DV6 C;  2D1R A;  3LGX A;  2OPL A;  3T1H C;  2D7V A;  4GKK C;  3TQI A;  4DCT A;  4D57 A;  2D27 A;  1J5E C;  4DV5 C;  4LF6 C;  4L4Q A;  2DYJ A;  4X65 C;  4DUZ C;  4JI7 C;  2JMP A;  1MDB A;  1HH2 P;  4D4I A;  4LF4 C;  1MXB A;  4RVN A;  2D1T A;  3B7W A;  1XMO C;  4JI3 C;  2UU9 C;  3GPC A;  4GXR A;  2D1S A;  2UXB C;  1LQL A;  5CZV A;  4KHP C;  4JV5 C;  2DPL A;  4GKJ C;  4JM1 A;  2OBV A;  1FUG A;  1T5D X;  2QW0 X;  3I07 A;  5ADZ A;  5AE3 A;  4IZ6 A;  5FLX D;  3A4I A;  3G7S A;  4ODJ A;  2E8E A;  4DCV A;  2V7B A;  4ISB A;  4RLQ A;  3J80 D;  4BBY A;  1T5H X;  4DR5 C;  3GKU A;  1ZB8 A;  2P2B A;  4LF9 C;  2EGT A;  5BSM A;  3ETC A;  4JI6 C;  1IBM C;  3PRO C;  4JI5 C;  2Y27 A;  5BUS A;  2OPL B;  5JRH A;  5BUR A;  2QVZ X;  3RV2 A;  4DG9 A;  5AE2 A;  2YWB A;  4RMN A;  4YHH C;  4NXN C;  3ETO A;  1IBL C;  5LMU C;  3FCE A;  2WD9 A;  3IPL A;  4EAT A;  3NI2 A;  3AF6 A;  5KEI A;  3R44 A;  4LF5 C;  1O9T A;  4B3T C;  1USP B;  1WH9 A;  4OYC A;  4B3S C;  4LE5 A;  1AMU A;  2E5L C;  4BCA A;  1RG9 A;  1XRB A;  1NYE A;  4DV4 C;  1XRA A;  1WF3 A;  4LFC C;  1ML8 A;  3RG2 A;  2AYA A;  5DV9 A;  4GS5 A;  4RVO A;  5K85 A;  3TUF A;  3A9U A;  1MDF A;  4KTT A;  5IWA C;  3GR0 A;  1FJG C;  3TDE A;  5IFI A;  3A9V A;  4OXI A;  5T8T A;  4NXM C;  3DHV A;  3R9X A;  3NYQ A;  3CJE A;  1LCI A;  2P2J A;  2VZE A;  4IR7 A;  4RLF A;  2F4V C;  2YCB A;  1I94 C;  2P2F A;  2E8F A;  1VLA A;  4L2Z A;  4GXQ A;  3IML A;  3SO4 A;  2KZF A;  4DV7 C;  2OO4 A;  5IT9 D;  4DUY C;  3DLP X;  1JOS A;  2BH1 X;  5A1I A;  3N2Q A;  4DR6 C;  3J7A D;  1MD9 A;  4R1L A;  5BSU A;  1N32 C;  4DR3 C;  5LMN C;  4WV3 A;  1N2F A;  4TPS B;  1YJ7 A;  3E7X A;  3N54 B;  3CW8 X;  1HNW C;  3NYR A;  1UKK A;  2D28 C;  1N34 C;  3IEV A;  2Y4O A;  1L2F A;  5BUQ A;  4X64 C;  4MH4 A;  5AE1 A;  3VNR A;  4G36 A;  2QVY X;  3L95 X;  3GR1 A;  4XX2 A;  4LFB C;  1O92 A;  4I9G A;  5A2Q D;  2P20 A;  3EQ6 A;  3JAM D;  1PG4 A;  4JI8 C;  1XMQ C;  4DCU A;  4MTN A;  2UUC C;  2UXC C;  4DCS A;  4JI1 C;  2UUB C;  4G37 A;  5GTD A;  4ZJZ A;  3PES A;  1HR0 C;  1HNZ C;  3LNV A;  1V25 A;  4DG8 A;  4LF8 C;  4ZLP A;  3UOW A;  4RM3 A;  2HJG A;  4D56 A;  4YY3 C;  4DV2 C;  2P02 A;  2QVX X;  4KTV A;  4I9F A;  2BJO A;  1N33 C;  5KYV A;  1QWI A;  2PT7 G;  4DR2 C;  4D4G A;  2HHH C;  2P2M A;  2VSQ A;  1MKY A;  2PRO A;  5H9U A;  3VNQ A;  5BSV A;  3EER A;  5T8S A;  4B3R C;  4AQY C;  2XR1 A;  3KXW A;  2E0G A;  2CY1 A;  2ASB A;  4OX9 C;  4DR4 C;  1XRC A;  4RM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...