4LF5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf5C02
4JI3C 4JI0C 2OPLB 2QL8A 4AQYC 4JI6C 3CJEA 4LFCC 2ZM6C 3R9XA 4JYAC 5IWAC 1JOSA 4X62C 4DR3C 3I07A 1WH9A 2E8FA 2CY1A 4LF7C 4MH4A 1XNQC 4NXNC 2BJOA 2HJGA 1EGAA 2DYJA 1N2FA 1NYEA 4DCSA 1VLAA 3OTOC 4GKKC 2D7VA 4DR1C 4JI4C 4NOZA 4XX2A 3R9WA 1HNZC 4X66C 1HNXC 2UUBC 1PA4A 1L2FA 2PN2A 5IT9D 5A2QD 4DCUA 4B3SC 2VQFC 4KHPC 5BR8C 4X64C 1N32C 3J7AD 4DV3C 3JAMD 1HNWC 2PT7G 4LF9C 2ATWA 4GKJC 4BSZA 2UUCC 4DR6C 5LMUC 1USPB 1K0RA 1IBMC 4DV2C 4DV4C 3T1YC 4DV7C 1HH2P 3IEUA 1J5EC 1LQLA 2UXBC 4YY3C 1N36C 3J81D 3LUSA 2F4VC 4JI5C 4LF8C 2OPLA 4B3MC 4B3RC 5LMNC 4B3TC 1MKYA 4DV6C 5FLXD 2UXDC 4MTNA 4NXMC 1KKGA 4DV1C 1XNRC 4DUYC 4LF6C 1ZB8A 2CXCA 4DCVA 1ML8A 1IBKC 4JI2C 2HHHC 4K0KC 4OX9C 4X65C 3J80D 2YCBA 4DV5C 3IEVA 3GKUA 1ZB9A 3AF5A 2ASBA 2E7GA 1FJGC 4DR4C 4DUZC 4JV5C 4LF5C 2E8EA 4LFBC 4JI8C 4DR5C 1N33C 1N34C 1UKKA 2JMPA 2UU9C 4LF4C 1XMOC 1HR0C 2KZFA 4DR7C 1QWIA 3T1HC 1XMQC 2ONFA 4YHHC 3EERA 2UXCC 4DCTA 2VQEC 2XR1A 4DV0C 2E5LC 2UUAC 1I94C 1IBLC 1WF3A 4JI7C 4DR2C 4JI1C 2EGTA 4LFAC 1USPA 2E8CA 3AF6A
chains in the Genus database with same CATH superfamily
2OPLB 5IFIA 1PG4A 5H9UA 2BH1X 1QM4A 3UOWA 1O90A 4RVOA 1JOSA 3I07A 4D4GA 3L95X 1WH9A 3GR0A 2D28C 4L2ZA 1VLAA 5JRHA 4GKKC 2D7VA 3ETCA 4DR1C 2YX1A 4RLQA 4NOZA 3TQIA 4X66C 1PA4A 3H2TA 1L2FA 5BSMA 5IT9D 5LCIA 2VZEA 3A4IA 2VQFC 5KYVA 4DG9A 3J7AD 1GPMA 3TDEA 3TUFA 5K85A 2AYAA 3C5EA 1T5HX 3CQ3A 1K0RA 3SO4A 3T1YC 2UXBC 4YY3C 1N36C 4IZ6A 4LF8C 1RY2A 3VNRA 2P2FA 4ISBA 5LMNC 3LNVA 4B3TC 4DV6C 4MTNA 4NXMC 1KKGA 3UX2A 4GXRA 1P4EC 1V25A 5A1IA 3EQ6A 5BUQA 1IBKC 5T8TA 2QVYX 4PHTA 3NYRA 2P02A 1PU1A 2D1RA 1YJ7A 1ZB9A 2ASBA 5AE2A 3A26A 2Y4OA 4DR4C 3CQ2A 2E8EA 1MDFA 3LNOA 4I9GA 3O2EA 4DR7C 2ONFA 3N2QA 5BSWA 5K8FA 2VQEC 4DV0C 3NPDA 3FCCA 1I94C 1UWDA 2EGTA 2OO4A 1USPA 4ODJA 4JI0C 3B7WA 3FM7A 2QL8A 3PBKA 4AQYC 1XS3A 4WV3A 1WCJA 2PG1E 4JYAC 4X62C 4DR3C 2VSQA 1VEHA 2CY1A 5E7QA 4LF7C 3IPLA 4MH4A 4BCAA 4NXNC 2DYJA 1N2FA 1P7LA 1V60A 3OTOC 1M6XA 5BUSA 4XX2A 2UUBC 4RMNA 2ZTBA 5BSRA 3GR1A 3DAYA 1USPB 4KTVA 2QVZX 2QW0X 3VNQA 3UX3A 4OXIA 4L7IA 1V26A 4B3RC 5FLXD 4DV1C 4LF6C 2Y27A 1ML8A 1O93A 5BSVA 2HHHC 2Y4NA 1T5DX 5BURA 3S82A 2KZ0A 5KEIA 4DV5C 3N54B 4D57A 1TH5A 1ULTA 5A19A 2E7GA 4LF5C 2WP0C 4JI8C 4DR5C 3UZ0A 1N33C 4LF4C 3AY0A 3R44A 3VNSA 3T1HC 2ZZMA 3DLPX 4YHHC 2UXCC 2XR1A 1FLOA 4FUTA 4FTFA 3LGXA 3A9UA 2E8CA 4LE5A 2OBVA 4JI3C 4RLFA 3E7XA 1MD9A 1M6XC 3CJEA 4LFCC 1MDBA 5IWAC 5DV9A 1NY8A 5CZVA 2E8FA 2QVXX 1XNQC 5BSUA 3L8CA 2BJOA 2HJGA 1EGAA 4FUQA 1NYEA 1PG3A 4JI4C 3PROC 1HNZC 3E7WA 2PN2A 4DCUA 4KHPC 4X64C 4GXQA 1HNWC 3RV2A 4PROC 5BSTA 2ATWA 4BSZA 2UUCC 4G1IA 3A25A 3UEBA 3GPCA 3I08A 4R1LA 1MXBA 4DV2C 2NCLA 4OYCA 4DV7C 1J5EC 3J81D 2F4VC 3CW9A 2D1SA 4JI5C 2MCQA 4U5YD 4RVNA 1MKYA 1XHJA 4WS9A 4ZJZA 1MXCA 1XNRC 2M5HA 1ZB8A 4JI2C 4DCVA 2MM9A 2P2JA 2P2MA 2JNVA 2P20A 4X65C 2CU6A 3IEVA 4BC7A 1FJGC 2D1QA 4KTTA 4DUZC 1O92A 4K0BA 3DHVA 1N34C 1UKKA 2JMPA 2UU9C 1XMOC 1HR0C 3ETOA 4GS5A 1QWIA 1LCIA 2MMAB 1XRBA 4ZLPA 3A9VA 1RG9A 4PUHA 2DPLA 4IR7A 3RG2A 4JI7C 2V7BA 2KDNA 4JM1A 4DR2C 4LFAC 3AF6A 3TR3A 1YGTA 5ADZA 4JI6C 2ZM6C 3R9XA 3IMLA 4PZPA 4R1MA 2Z51A 1MXAA 4HPVA 2D27A 2D1TA 4DCSA 4NDNA 2P2BA 1XDXA 3R9WA 1HNXC 4D4IA 4EATA 5A1GA 5A2QD 4B3SC 5BR8C 3NYQA 3PESA 1N32C 4DV3C 3JAMD 1XRAA 2E0GA 2PT7G 4LF9C 4GKJC 4DR6C 1XRCA 4TPSB 5LMUC 5CZXA 4RM3A 2YWBA 4D56A 1IBMC 4DV4C 1HH2P 3IEUA 1LQLA 4I9FA 2PROA 1FUGA 3LUSA 4BBYA 1AMUA 2OPLA 4B3MC 4BC9A 3K6RA 4RM2A 2M5OA 2UXDC 4PUGA 5T8SA 4DUYC 3LAXA 2CXCA 4K0KC 3G7SA 4OX9C 3CQ1A 3CW8X 3J80D 2YCBA 3FCEA 4G37A 3GKUA 3AF5A 2YWCA 4G36A 1IB8A 5AE3A 1O9TA 3NI2A 4JV5C 5GTDA 4LFBC 1P4EA 2KZFA 2ZZNA 4DG8A 1XMQC 1BA3A 3KXWA 3EERA 4DCTA 4R0MA 4PUIA 2E5LC 2UUAC 1IBLC 1WF3A 5AE1A 4JI1C 2WD9A 2DHMA 5KYTA 4L4QA 2P2QA
chains in the Genus database with same CATH topology
2OPLB 5IFIA 1PG4A 5H9UA 2BH1X 1QM4A 3UOWA 1O90A 4RVOA 1JOSA 3I07A 4D4GA 3L95X 1WH9A 3GR0A 2D28C 4L2ZA 1VLAA 5JRHA 4GKKC 2D7VA 3ETCA 4DR1C 4RLQA 4NOZA 3TQIA 4X66C 1PA4A 3H2TA 1L2FA 5BSMA 5IT9D 2VZEA 3A4IA 2VQFC 5KYVA 4DG9A 3J7AD 1GPMA 3TDEA 3TUFA 5K85A 2AYAA 3C5EA 1T5HX 1K0RA 3SO4A 3T1YC 2UXBC 4YY3C 1N36C 4IZ6A 4LF8C 1RY2A 3VNRA 2P2FA 4ISBA 5LMNC 3LNVA 4B3TC 4DV6C 4MTNA 4NXMC 1KKGA 4GXRA 1V25A 5A1IA 3EQ6A 5BUQA 1IBKC 5T8TA 2QVYX 4PHTA 3NYRA 2P02A 2D1RA 1YJ7A 1ZB9A 2ASBA 5AE2A 2Y4OA 4DR4C 2E8EA 1MDFA 4I9GA 4DR7C 2ONFA 3N2QA 5BSWA 5K8FA 2VQEC 4DV0C 3NPDA 3FCCA 1I94C 2EGTA 2OO4A 1USPA 4ODJA 4JI0C 3B7WA 2QL8A 3PBKA 4AQYC 4WV3A 4JYAC 4X62C 4DR3C 2VSQA 2CY1A 5E7QA 4LF7C 3IPLA 4MH4A 4BCAA 4NXNC 2DYJA 1N2FA 1P7LA 3OTOC 5BUSA 4XX2A 2UUBC 4RMNA 5BSRA 3GR1A 3DAYA 1USPB 4KTVA 2QVZX 2QW0X 3VNQA 4OXIA 4L7IA 1V26A 4B3RC 5FLXD 4DV1C 4LF6C 2Y27A 1ML8A 1O93A 5BSVA 2HHHC 2Y4NA 1T5DX 5BURA 3S82A 5KEIA 4DV5C 3N54B 4D57A 1ULTA 5A19A 2E7GA 4LF5C 2WP0C 4JI8C 4DR5C 3UZ0A 1N33C 4LF4C 3R44A 3VNSA 3T1HC 3DLPX 4YHHC 2UXCC 2XR1A 4FUTA 4FTFA 3LGXA 3A9UA 2E8CA 4LE5A 2OBVA 4JI3C 4RLFA 3E7XA 1MD9A 3CJEA 4LFCC 1MDBA 5IWAC 5DV9A 5CZVA 2E8FA 2QVXX 1XNQC 5BSUA 3L8CA 2BJOA 2HJGA 1EGAA 4FUQA 1NYEA 1PG3A 4JI4C 3PROC 1HNZC 3E7WA 2PN2A 4DCUA 4KHPC 4X64C 4GXQA 1HNWC 3RV2A 4PROC 5BSTA 2ATWA 4BSZA 2UUCC 4G1IA 3GPCA 3I08A 4R1LA 1MXBA 4DV2C 4OYCA 4DV7C 1J5EC 3J81D 2F4VC 3CW9A 2D1SA 4JI5C 4U5YD 4RVNA 1MKYA 4WS9A 4ZJZA 1MXCA 1XNRC 1ZB8A 4JI2C 4DCVA 2P2JA 2P2MA 2P20A 4X65C 3IEVA 4BC7A 1FJGC 2D1QA 4KTTA 4DUZC 1O92A 4K0BA 3DHVA 1N34C 1UKKA 2JMPA 2UU9C 1XMOC 1HR0C 3ETOA 4GS5A 1QWIA 1LCIA 1XRBA 4ZLPA 3A9VA 1RG9A 2DPLA 4IR7A 3RG2A 4JI7C 2V7BA 4DR2C 4JM1A 4LFAC 3AF6A 5ADZA 4JI6C 2ZM6C 3R9XA 3IMLA 4PZPA 4R1MA 1MXAA 4HPVA 2D27A 2D1TA 4DCSA 4NDNA 2P2BA 3R9WA 1HNXC 4D4IA 4EATA 5A1GA 5A2QD 4B3SC 5BR8C 3NYQA 3PESA 1N32C 4DV3C 3JAMD 1XRAA 2E0GA 2PT7G 4LF9C 4GKJC 4DR6C 1XRCA 4TPSB 5LMUC 5CZXA 4RM3A 2YWBA 4D56A 1IBMC 4DV4C 1HH2P 3IEUA 1LQLA 4I9FA 2PROA 1FUGA 3LUSA 4BBYA 1AMUA 2OPLA 4B3MC 4BC9A 4RM2A 2UXDC 5T8SA 4DUYC 3LAXA 2CXCA 4K0KC 3G7SA 4OX9C 3CW8X 3J80D 2YCBA 3FCEA 4G37A 3GKUA 3AF5A 2YWCA 4G36A 5AE3A 1O9TA 3NI2A 4JV5C 5GTDA 4LFBC 2KZFA 4DG8A 1XMQC 1BA3A 3KXWA 3EERA 4DCTA 4R0MA 2E5LC 2UUAC 1IBLC 1WF3A 5AE1A 4JI1C 2WD9A 5KYTA 4L4QA 2P2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 C;  4JI0 C;  2OPL B;  2QL8 A;  4AQY C;  4JI6 C;  3CJE A;  4LFC C;  2ZM6 C;  3R9X A;  4JYA C;  5IWA C;  1JOS A;  4X62 C;  4DR3 C;  3I07 A;  1WH9 A;  2E8F A;  2CY1 A;  4LF7 C;  4MH4 A;  1XNQ C;  4NXN C;  2BJO A;  2HJG A;  1EGA A;  2DYJ A;  1N2F A;  1NYE A;  4DCS A;  1VLA A;  3OTO C;  4GKK C;  2D7V A;  4DR1 C;  4JI4 C;  4NOZ A;  4XX2 A;  3R9W A;  1HNZ C;  4X66 C;  1HNX C;  2UUB C;  1PA4 A;  1L2F A;  2PN2 A;  5IT9 D;  5A2Q D;  4DCU A;  4B3S C;  2VQF C;  4KHP C;  5BR8 C;  4X64 C;  1N32 C;  3J7A D;  4DV3 C;  3JAM D;  1HNW C;  2PT7 G;  4LF9 C;  2ATW A;  4GKJ C;  4BSZ A;  2UUC C;  4DR6 C;  5LMU C;  1USP B;  1K0R A;  1IBM C;  4DV2 C;  4DV4 C;  3T1Y C;  4DV7 C;  1HH2 P;  3IEU A;  1J5E C;  1LQL A;  2UXB C;  4YY3 C;  1N36 C;  3J81 D;  3LUS A;  2F4V C;  4JI5 C;  4LF8 C;  2OPL A;  4B3M C;  4B3R C;  5LMN C;  4B3T C;  1MKY A;  4DV6 C;  5FLX D;  2UXD C;  4MTN A;  4NXM C;  1KKG A;  4DV1 C;  1XNR C;  4DUY C;  4LF6 C;  1ZB8 A;  2CXC A;  4DCV A;  1ML8 A;  1IBK C;  4JI2 C;  2HHH C;  4K0K C;  4OX9 C;  4X65 C;  3J80 D;  2YCB A;  4DV5 C;  3IEV A;  3GKU A;  1ZB9 A;  3AF5 A;  2ASB A;  2E7G A;  1FJG C;  4DR4 C;  4DUZ C;  4JV5 C;  4LF5 C;  2E8E A;  4LFB C;  4JI8 C;  4DR5 C;  1N33 C;  1N34 C;  1UKK A;  2JMP A;  2UU9 C;  4LF4 C;  1XMO C;  1HR0 C;  2KZF A;  4DR7 C;  1QWI A;  3T1H C;  1XMQ C;  2ONF A;  4YHH C;  3EER A;  2UXC C;  4DCT A;  2VQE C;  2XR1 A;  4DV0 C;  2E5L C;  2UUA C;  1I94 C;  1IBL C;  1WF3 A;  4JI7 C;  4DR2 C;  4JI1 C;  2EGT A;  4LFA C;  1USP A;  2E8C A;  3AF6 A; 
#chains in the Genus database with same CATH topology
 2OPL B;  5IFI A;  1PG4 A;  5H9U A;  2BH1 X;  1QM4 A;  3UOW A;  1O90 A;  4RVO A;  1JOS A;  3I07 A;  4D4G A;  3L95 X;  1WH9 A;  3GR0 A;  2D28 C;  4L2Z A;  1VLA A;  5JRH A;  4GKK C;  2D7V A;  3ETC A;  4DR1 C;  2YX1 A;  4RLQ A;  4NOZ A;  3TQI A;  4X66 C;  1PA4 A;  3H2T A;  1L2F A;  5BSM A;  5IT9 D;  5LCI A;  2VZE A;  3A4I A;  2VQF C;  5KYV A;  4DG9 A;  3J7A D;  1GPM A;  3TDE A;  3TUF A;  5K85 A;  2AYA A;  3C5E A;  1T5H X;  3CQ3 A;  1K0R A;  3SO4 A;  3T1Y C;  2UXB C;  4YY3 C;  1N36 C;  4IZ6 A;  4LF8 C;  1RY2 A;  3VNR A;  2P2F A;  4ISB A;  5LMN C;  3LNV A;  4B3T C;  4DV6 C;  4MTN A;  4NXM C;  1KKG A;  3UX2 A;  4GXR A;  1P4E C;  1V25 A;  5A1I A;  3EQ6 A;  5BUQ A;  1IBK C;  5T8T A;  2QVY X;  4PHT A;  3NYR A;  2P02 A;  1PU1 A;  2D1R A;  1YJ7 A;  1ZB9 A;  2ASB A;  5AE2 A;  3A26 A;  2Y4O A;  4DR4 C;  3CQ2 A;  2E8E A;  1MDF A;  3LNO A;  4I9G A;  3O2E A;  4DR7 C;  2ONF A;  3N2Q A;  5BSW A;  5K8F A;  2VQE C;  4DV0 C;  3NPD A;  3FCC A;  1I94 C;  1UWD A;  2EGT A;  2OO4 A;  1USP A;  4ODJ A;  4JI0 C;  3B7W A;  3FM7 A;  2QL8 A;  3PBK A;  4AQY C;  1XS3 A;  4WV3 A;  1WCJ A;  2PG1 E;  4JYA C;  4X62 C;  4DR3 C;  2VSQ A;  1VEH A;  2CY1 A;  5E7Q A;  4LF7 C;  3IPL A;  4MH4 A;  4BCA A;  4NXN C;  2DYJ A;  1N2F A;  1P7L A;  1V60 A;  3OTO C;  1M6X A;  5BUS A;  4XX2 A;  2UUB C;  4RMN A;  2ZTB A;  5BSR A;  3GR1 A;  3DAY A;  1USP B;  4KTV A;  2QVZ X;  2QW0 X;  3VNQ A;  3UX3 A;  4OXI A;  4L7I A;  1V26 A;  4B3R C;  5FLX D;  4DV1 C;  4LF6 C;  2Y27 A;  1ML8 A;  1O93 A;  5BSV A;  2HHH C;  2Y4N A;  1T5D X;  5BUR A;  3S82 A;  2KZ0 A;  5KEI A;  4DV5 C;  3N54 B;  4D57 A;  1TH5 A;  1ULT A;  5A19 A;  2E7G A;  4LF5 C;  2WP0 C;  4JI8 C;  4DR5 C;  3UZ0 A;  1N33 C;  4LF4 C;  3AY0 A;  3R44 A;  3VNS A;  3T1H C;  2ZZM A;  3DLP X;  4YHH C;  2UXC C;  2XR1 A;  1FLO A;  4FUT A;  4FTF A;  3LGX A;  3A9U A;  2E8C A;  4LE5 A;  2OBV A;  4JI3 C;  4RLF A;  3E7X A;  1MD9 A;  1M6X C;  3CJE A;  4LFC C;  1MDB A;  5IWA C;  5DV9 A;  1NY8 A;  5CZV A;  2E8F A;  2QVX X;  1XNQ C;  5BSU A;  3L8C A;  2BJO A;  2HJG A;  1EGA A;  4FUQ A;  1NYE A;  1PG3 A;  4JI4 C;  3PRO C;  1HNZ C;  3E7W A;  2PN2 A;  4DCU A;  4KHP C;  4X64 C;  4GXQ A;  1HNW C;  3RV2 A;  4PRO C;  5BST A;  2ATW A;  4BSZ A;  2UUC C;  4G1I A;  3A25 A;  3UEB A;  3GPC A;  3I08 A;  4R1L A;  1MXB A;  4DV2 C;  2NCL A;  4OYC A;  4DV7 C;  1J5E C;  3J81 D;  2F4V C;  3CW9 A;  2D1S A;  4JI5 C;  2MCQ A;  4U5Y D;  4RVN A;  1MKY A;  1XHJ A;  4WS9 A;  4ZJZ A;  1MXC A;  1XNR C;  2M5H A;  1ZB8 A;  4JI2 C;  4DCV A;  2MM9 A;  2P2J A;  2P2M A;  2JNV A;  2P20 A;  4X65 C;  2CU6 A;  3IEV A;  4BC7 A;  1FJG C;  2D1Q A;  4KTT A;  4DUZ C;  1O92 A;  4K0B A;  3DHV A;  1N34 C;  1UKK A;  2JMP A;  2UU9 C;  1XMO C;  1HR0 C;  3ETO A;  4GS5 A;  1QWI A;  1LCI A;  2MMA B;  1XRB A;  4ZLP A;  3A9V A;  1RG9 A;  4PUH A;  2DPL A;  4IR7 A;  3RG2 A;  4JI7 C;  2V7B A;  2KDN A;  4JM1 A;  4DR2 C;  4LFA C;  3AF6 A;  3TR3 A;  1YGT A;  5ADZ A;  4JI6 C;  2ZM6 C;  3R9X A;  3IML A;  4PZP A;  4R1M A;  2Z51 A;  1MXA A;  4HPV A;  2D27 A;  2D1T A;  4DCS A;  4NDN A;  2P2B A;  1XDX A;  3R9W A;  1HNX C;  4D4I A;  4EAT A;  5A1G A;  5A2Q D;  4B3S C;  5BR8 C;  3NYQ A;  3PES A;  1N32 C;  4DV3 C;  3JAM D;  1XRA A;  2E0G A;  2PT7 G;  4LF9 C;  4GKJ C;  4DR6 C;  1XRC A;  4TPS B;  5LMU C;  5CZX A;  4RM3 A;  2YWB A;  4D56 A;  1IBM C;  4DV4 C;  1HH2 P;  3IEU A;  1LQL A;  4I9F A;  2PRO A;  1FUG A;  3LUS A;  4BBY A;  1AMU A;  2OPL A;  4B3M C;  4BC9 A;  3K6R A;  4RM2 A;  2M5O A;  2UXD C;  4PUG A;  5T8S A;  4DUY C;  3LAX A;  2CXC A;  4K0K C;  3G7S A;  4OX9 C;  3CQ1 A;  3CW8 X;  3J80 D;  2YCB A;  3FCE A;  4G37 A;  3GKU A;  3AF5 A;  2YWC A;  4G36 A;  1IB8 A;  5AE3 A;  1O9T A;  3NI2 A;  4JV5 C;  5GTD A;  4LFB C;  1P4E A;  2KZF A;  2ZZN A;  4DG8 A;  1XMQ C;  1BA3 A;  3KXW A;  3EER A;  4DCT A;  4R0M A;  4PUI A;  2E5L C;  2UUA C;  1IBL C;  1WF3 A;  5AE1 A;  4JI1 C;  2WD9 A;  2DHM A;  5KYT A;  4L4Q A;  2P2Q A; 
#chains in the Genus database with same CATH homology
 2OPL B;  5IFI A;  1PG4 A;  5H9U A;  2BH1 X;  1QM4 A;  3UOW A;  1O90 A;  4RVO A;  1JOS A;  3I07 A;  4D4G A;  3L95 X;  1WH9 A;  3GR0 A;  2D28 C;  4L2Z A;  1VLA A;  5JRH A;  4GKK C;  2D7V A;  3ETC A;  4DR1 C;  4RLQ A;  4NOZ A;  3TQI A;  4X66 C;  1PA4 A;  3H2T A;  1L2F A;  5BSM A;  5IT9 D;  2VZE A;  3A4I A;  2VQF C;  5KYV A;  4DG9 A;  3J7A D;  1GPM A;  3TDE A;  3TUF A;  5K85 A;  2AYA A;  3C5E A;  1T5H X;  1K0R A;  3SO4 A;  3T1Y C;  2UXB C;  4YY3 C;  1N36 C;  4IZ6 A;  4LF8 C;  1RY2 A;  3VNR A;  2P2F A;  4ISB A;  5LMN C;  3LNV A;  4B3T C;  4DV6 C;  4MTN A;  4NXM C;  1KKG A;  4GXR A;  1V25 A;  5A1I A;  3EQ6 A;  5BUQ A;  1IBK C;  5T8T A;  2QVY X;  4PHT A;  3NYR A;  2P02 A;  2D1R A;  1YJ7 A;  1ZB9 A;  2ASB A;  5AE2 A;  2Y4O A;  4DR4 C;  2E8E A;  1MDF A;  4I9G A;  4DR7 C;  2ONF A;  3N2Q A;  5BSW A;  5K8F A;  2VQE C;  4DV0 C;  3NPD A;  3FCC A;  1I94 C;  2EGT A;  2OO4 A;  1USP A;  4ODJ A;  4JI0 C;  3B7W A;  2QL8 A;  3PBK A;  4AQY C;  4WV3 A;  4JYA C;  4X62 C;  4DR3 C;  2VSQ A;  2CY1 A;  5E7Q A;  4LF7 C;  3IPL A;  4MH4 A;  4BCA A;  4NXN C;  2DYJ A;  1N2F A;  1P7L A;  3OTO C;  5BUS A;  4XX2 A;  2UUB C;  4RMN A;  5BSR A;  3GR1 A;  3DAY A;  1USP B;  4KTV A;  2QVZ X;  2QW0 X;  3VNQ A;  4OXI A;  4L7I A;  1V26 A;  4B3R C;  5FLX D;  4DV1 C;  4LF6 C;  2Y27 A;  1ML8 A;  1O93 A;  5BSV A;  2HHH C;  2Y4N A;  1T5D X;  5BUR A;  3S82 A;  5KEI A;  4DV5 C;  3N54 B;  4D57 A;  1ULT A;  5A19 A;  2E7G A;  4LF5 C;  2WP0 C;  4JI8 C;  4DR5 C;  3UZ0 A;  1N33 C;  4LF4 C;  3R44 A;  3VNS A;  3T1H C;  3DLP X;  4YHH C;  2UXC C;  2XR1 A;  4FUT A;  4FTF A;  3LGX A;  3A9U A;  2E8C A;  4LE5 A;  2OBV A;  4JI3 C;  4RLF A;  3E7X A;  1MD9 A;  3CJE A;  4LFC C;  1MDB A;  5IWA C;  5DV9 A;  5CZV A;  2E8F A;  2QVX X;  1XNQ C;  5BSU A;  3L8C A;  2BJO A;  2HJG A;  1EGA A;  4FUQ A;  1NYE A;  1PG3 A;  4JI4 C;  3PRO C;  1HNZ C;  3E7W A;  2PN2 A;  4DCU A;  4KHP C;  4X64 C;  4GXQ A;  1HNW C;  3RV2 A;  4PRO C;  5BST A;  2ATW A;  4BSZ A;  2UUC C;  4G1I A;  3GPC A;  3I08 A;  4R1L A;  1MXB A;  4DV2 C;  4OYC A;  4DV7 C;  1J5E C;  3J81 D;  2F4V C;  3CW9 A;  2D1S A;  4JI5 C;  4U5Y D;  4RVN A;  1MKY A;  4WS9 A;  4ZJZ A;  1MXC A;  1XNR C;  1ZB8 A;  4JI2 C;  4DCV A;  2P2J A;  2P2M A;  2P20 A;  4X65 C;  3IEV A;  4BC7 A;  1FJG C;  2D1Q A;  4KTT A;  4DUZ C;  1O92 A;  4K0B A;  3DHV A;  1N34 C;  1UKK A;  2JMP A;  2UU9 C;  1XMO C;  1HR0 C;  3ETO A;  4GS5 A;  1QWI A;  1LCI A;  1XRB A;  4ZLP A;  3A9V A;  1RG9 A;  2DPL A;  4IR7 A;  3RG2 A;  4JI7 C;  2V7B A;  4DR2 C;  4JM1 A;  4LFA C;  3AF6 A;  5ADZ A;  4JI6 C;  2ZM6 C;  3R9X A;  3IML A;  4PZP A;  4R1M A;  1MXA A;  4HPV A;  2D27 A;  2D1T A;  4DCS A;  4NDN A;  2P2B A;  3R9W A;  1HNX C;  4D4I A;  4EAT A;  5A1G A;  5A2Q D;  4B3S C;  5BR8 C;  3NYQ A;  3PES A;  1N32 C;  4DV3 C;  3JAM D;  1XRA A;  2E0G A;  2PT7 G;  4LF9 C;  4GKJ C;  4DR6 C;  1XRC A;  4TPS B;  5LMU C;  5CZX A;  4RM3 A;  2YWB A;  4D56 A;  1IBM C;  4DV4 C;  1HH2 P;  3IEU A;  1LQL A;  4I9F A;  2PRO A;  1FUG A;  3LUS A;  4BBY A;  1AMU A;  2OPL A;  4B3M C;  4BC9 A;  4RM2 A;  2UXD C;  5T8S A;  4DUY C;  3LAX A;  2CXC A;  4K0K C;  3G7S A;  4OX9 C;  3CW8 X;  3J80 D;  2YCB A;  3FCE A;  4G37 A;  3GKU A;  3AF5 A;  2YWC A;  4G36 A;  5AE3 A;  1O9T A;  3NI2 A;  4JV5 C;  5GTD A;  4LFB C;  2KZF A;  4DG8 A;  1XMQ C;  1BA3 A;  3KXW A;  3EER A;  4DCT A;  4R0M A;  2E5L C;  2UUA C;  1IBL C;  1WF3 A;  5AE1 A;  4JI1 C;  2WD9 A;  5KYT A;  4L4Q A;  2P2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...