4LF5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf5C02
2E8CA 2ASBA 1MKYA 4JI8C 4DR1C 4YY3C 4DV2C 5LMNC 4B3SC 1XMQC 3LUSA 3IEVA 4JI7C 4X64C 1NYEA 4BSZA 4XX2A 4B3TC 3JAMD 2ONFA 2BJOA 5IT9D 2UUCC 2OPLA 1I94C 4DR4C 2CY1A 3GKUA 4JI3C 4X65C 4DV3C 2E8FA 2QL8A 4DV7C 2ZM6C 4DV0C 2EGTA 4DV4C 4NXNC 1WF3A 3AF6A 4B3MC 4DCSA 4LFCC 2UUAC 2HJGA 4JYAC 5LMUC 2UXCC 1ML8A 4DCVA 4YHHC 3OTOC 4DR6C 4DUYC 1IBLC 1HH2P 4DR7C 1HNWC 1N33C 4DV5C 1IBKC 3R9WA 2UU9C 3T1HC 4DUZC 5FLXD 2XR1A 4MH4A 4JI0C 4DR5C 4LFAC 1N36C 4JI2C 5BR8C 2HHHC 1EGAA 1HNZC 1JOSA 4NOZA 1IBMC 4GKKC 4LF8C 2UXDC 3J7AD 2VQFC 1QWIA 3AF5A 3CJEA 2CXCA 4JI1C 2UUBC 1KKGA 1PA4A 4JI5C 1LQLA 5IWAC 4GKJC 4LF5C 4KHPC 2KZFA 2D7VA 1ZB9A 2DYJA 2E5LC 4X62C 4LF7C 4DR2C 1J5EC 2VQEC 5A2QD 4DR3C 4JV5C 1N32C 1L2FA 1UKKA 4JI6C 4LF6C 1ZB8A 4OX9C 4B3RC 1VLAA 2JMPA 4NXMC 2E7GA 2OPLB 2ATWA 1WH9A 3I07A 4LFBC 1HNXC 1N2FA 2PT7G 2F4VC 4MTNA 4K0KC 4JI4C 4X66C 4AQYC 1USPB 3IEUA 2UXBC 3R9XA 2YCBA 4LF4C 4DCTA 1XNRC 3EERA 4DV6C 2PN2A 1XNQC 1N34C 1FJGC 4DV1C 3J80D 1USPA 2E8EA 4DCUA 3J81D 3T1YC 1XMOC 4LF9C 1HR0C 1K0RA
chains in the Genus database with same CATH superfamily
2E8CA 2YWCA 3VNRA 4JI8C 3PBKA 4YY3C 3LUSA 2ONFA 4DV7C 4DV0C 2EGTA 3I08A 5BSRA 3VNQA 1T5DX 2UXCC 2OBVA 2VSQA 3S82A 1YJ7A 2DHMA 4DCVA 3OTOC 1AMUA 4DG9A 3CQ1A 1HNWC 5FLXD 2YX1A 5GTDA 2P2MA 4D56A 1TH5A 3UX3A 1N36C 4JI2C 4EATA 1EGAA 3UZ0A 2M5HA 4GKKC 5CZXA 4LF8C 2D1QA 3AF5A 3TUFA 1RY2A 4G1IA 2CXCA 2UUBC 2P02A 4RVOA 5BSUA 5IWAC 2ZTBA 4IZ6A 3UX2A 4D4IA 2D7VA 3CW8X 4OYCA 4ODJA 5A2QD 1L2FA 4JI6C 4OX9C 4BC7A 2PG1E 4BBYA 5BUSA 1WH9A 1N2FA 4MTNA 4K0KC 3FM7A 5K8FA 2WP0C 2YWBA 3CW9A 2YCBA 2AYAA 1FUGA 1FJGC 4DCUA 2QVXX 1BA3A 1PG4A 1HR0C 4PROC 2ASBA 1MDBA 2QVYX 4DV2C 5LMNC 1P4EA 4X64C 2D1SA 4BSZA 3CQ2A 5IT9D 1YGTA 1I94C 3GKUA 3R44A 4JI3C 3A9VA 1P7LA 4DV3C 2E8FA 2ZM6C 3AY0A 2DPLA 5E7QA 2E0GA 2HJGA 2P2FA 2QVZX 4PUGA 3A25A 5KEIA 1IBLC 1HH2P 3IMLA 4L2ZA 4DV5C 3DAYA 4I9FA 5BUQA 2D1TA 3E7XA 4MH4A 1O93A 2VZEA 4DG8A 2P20A 4GXRA 1HNZC 1IBMC 4TPSB 3J7AD 4RM3A 2JNVA 1QWIA 1V25A 1KKGA 4JI5C 4GKJC 4RVNA 4ISBA 2E5LC 4X62C 1IB8A 4BC9A 5BSWA 4DR2C 1M6XA 2Y4OA 4JV5C 4DR3C 3PROC 1VLAA 4R0MA 3LAXA 4GXQA 4LFBC 1MDFA 2F4VC 5BSVA 4X66C 4AQYC 2V7BA 3IPLA 5JRHA 4L4QA 3B7WA 3IEUA 4RMNA 4R1LA 2NCLA 3LNVA 4DCTA 2PN2A 4DV1C 1PG3A 3J80D 1USPA 5IFIA 3GR1A 3J81D 1UWDA 5A1GA 4LF9C 3O2EA 2QW0X 1K0RA 1XRCA 3GR0A 5BSTA 1XMQC 3CQ3A 1NYEA 3JAMD 2UUCC 3A26A 5LCIA 4X65C 4G36A 3L8CA 5AE3A 4DV4C 1FLOA 4DCSA 1PU1A 5LMUC 1MD9A 2D28C 4KTTA 1QM4A 4KTVA 3UOWA 4YHHC 4PUHA 4DR6C 4WS9A 5ADZA 4DUYC 4GS5A 4R1MA 1N33C 1IBKC 2P2QA 2UU9C 4DUZC 3H2TA 5CZVA 1XS3A 5KYTA 4HPVA 2KDNA 2P2JA 3EQ6A 1JOSA 2D27A 4NOZA 3NI2A 2UXDC 2KZ0A 2VQFC 3TQIA 3L95X 4PZPA 3CJEA 4JI1C 2MCQA 1PA4A 1LQLA 2Y4NA 5AE1A 1V26A 4ZJZA 3LGXA 4LF7C 4I9GA 4G37A 2VQEC 1N32C 3NYQA 3FCEA 3C5EA 3SO4A 2JMPA 2E7GA 2OPLB 2ATWA 1HNXC 4BCAA 3NPDA 2PROA 1XRBA 1O9TA 1USPB 2ZZMA 1MXAA 5AE2A 3VNSA 2UXBC 4LF4C 3EERA 2Z51A 1XNQC 4LE5A 2MMAB 4PUIA 3T1YC 5H9UA 2P2BA 4FTFA 1MKYA 5DV9A 5KYVA 4DR1C 4B3SC 1V60A 3IEVA 4JI7C 1XDXA 4XX2A 4B3TC 2BJOA 3N2QA 2OPLA 4DR4C 4JM1A 2CY1A 1VEHA 3LNOA 5BSMA 2MM9A 2QL8A 3A4IA 4NXNC 1P4EC 1WF3A 3AF6A 3UEBA 4B3MC 3GPCA 2ZZNA 3A9UA 4LFCC 2UUAC 4JYAC 4ZLPA 1GPMA 4OXIA 3NYRA 1ML8A 4U5YD 4FUQA 3ETOA 4DR7C 5K85A 3R9WA 4PHTA 3T1HC 1XHJA 2D1RA 1MXBA 1ULTA 2XR1A 4JI0C 5T8SA 3PESA 4K0BA 4DR5C 4RLFA 2WD9A 1T5HX 4LFAC 5BURA 3TDEA 5BR8C 2HHHC 3K6RA 1RG9A 3DLPX 1O92A 2OO4A 3FCCA 2CU6A 1O90A 3TR3A 4LF5C 3E7WA 4KHPC 4NDNA 2KZFA 2DYJA 1ZB9A 3KXWA 4RM2A 1J5EC 1NY8A 4D4GA 1MXCA 1UKKA 2Y27A 4LF6C 1ZB8A 4B3RC 1WCJA 5A19A 4RLQA 4NXMC 3I07A 3ETCA 2PT7G 1M6XC 3N54B 4JI4C 1LCIA 5T8TA 3R9XA 1XNRC 3RV2A 4D57A 4DV6C 3G7SA 2BH1X 1N34C 3RG2A 4IR7A 2E8EA 4L7IA 5A1IA 4WV3A 1XMOC 3DHVA 1XRAA 4FUTA 2M5OA
chains in the Genus database with same CATH topology
2E8CA 2YWCA 3VNRA 4JI8C 3PBKA 4YY3C 3LUSA 2ONFA 4DV7C 4DV0C 2EGTA 3I08A 5BSRA 3VNQA 1T5DX 2UXCC 2OBVA 2VSQA 3S82A 1YJ7A 4DCVA 3OTOC 1AMUA 4DG9A 1HNWC 5FLXD 5GTDA 2P2MA 4D56A 1N36C 4JI2C 4EATA 1EGAA 3UZ0A 4GKKC 5CZXA 4LF8C 2D1QA 3AF5A 3TUFA 1RY2A 4G1IA 2CXCA 2UUBC 2P02A 4RVOA 5BSUA 5IWAC 4IZ6A 4D4IA 2D7VA 3CW8X 4OYCA 4ODJA 5A2QD 1L2FA 4JI6C 4OX9C 4BC7A 4BBYA 5BUSA 1WH9A 1N2FA 4MTNA 4K0KC 5K8FA 2WP0C 2YWBA 3CW9A 2YCBA 2AYAA 1FUGA 1FJGC 4DCUA 2QVXX 1BA3A 1PG4A 1HR0C 4PROC 2ASBA 1MDBA 2QVYX 4DV2C 5LMNC 4X64C 2D1SA 4BSZA 5IT9D 1I94C 3GKUA 3R44A 4JI3C 3A9VA 1P7LA 4DV3C 2E8FA 2ZM6C 2DPLA 5E7QA 2E0GA 2HJGA 2P2FA 2QVZX 5KEIA 1IBLC 1HH2P 3IMLA 4L2ZA 4DV5C 3DAYA 4I9FA 5BUQA 2D1TA 3E7XA 4MH4A 1O93A 2VZEA 4DG8A 2P20A 4GXRA 1HNZC 1IBMC 4TPSB 3J7AD 4RM3A 1QWIA 1V25A 1KKGA 4JI5C 4GKJC 4RVNA 4ISBA 2E5LC 4X62C 4BC9A 5BSWA 4DR2C 2Y4OA 4JV5C 4DR3C 3PROC 1VLAA 4R0MA 3LAXA 4GXQA 4LFBC 1MDFA 2F4VC 5BSVA 4X66C 4AQYC 2V7BA 3IPLA 5JRHA 4L4QA 3B7WA 3IEUA 4RMNA 4R1LA 3LNVA 4DCTA 2PN2A 4DV1C 1PG3A 3J80D 1USPA 5IFIA 3GR1A 3J81D 5A1GA 4LF9C 2QW0X 1K0RA 1XRCA 3GR0A 5BSTA 1XMQC 1NYEA 3JAMD 2UUCC 4X65C 4G36A 3L8CA 5AE3A 4DV4C 4DCSA 5LMUC 1MD9A 2D28C 4KTTA 1QM4A 4KTVA 3UOWA 4YHHC 4DR6C 4WS9A 5ADZA 4DUYC 4GS5A 4R1MA 1N33C 1IBKC 2P2QA 2UU9C 4DUZC 3H2TA 5CZVA 5KYTA 4HPVA 2P2JA 3EQ6A 1JOSA 2D27A 4NOZA 3NI2A 2UXDC 2VQFC 3L95X 3TQIA 4PZPA 3CJEA 4JI1C 1PA4A 1LQLA 2Y4NA 5AE1A 1V26A 4ZJZA 3LGXA 4LF7C 4I9GA 4G37A 2VQEC 1N32C 3NYQA 3FCEA 3C5EA 3SO4A 2JMPA 2E7GA 2OPLB 2ATWA 1HNXC 4BCAA 3NPDA 2PROA 1XRBA 1O9TA 1USPB 1MXAA 5AE2A 3VNSA 2UXBC 4LF4C 3EERA 1XNQC 4LE5A 3T1YC 5H9UA 2P2BA 4FTFA 1MKYA 5DV9A 5KYVA 4DR1C 4B3SC 3IEVA 4JI7C 4XX2A 4B3TC 2BJOA 3N2QA 2OPLA 4DR4C 4JM1A 2CY1A 5BSMA 2QL8A 3A4IA 4NXNC 1WF3A 3AF6A 4B3MC 3GPCA 3A9UA 4LFCC 2UUAC 4JYAC 4ZLPA 1GPMA 4OXIA 3NYRA 1ML8A 4U5YD 4FUQA 3ETOA 4DR7C 5K85A 3R9WA 4PHTA 3T1HC 2D1RA 1MXBA 1ULTA 2XR1A 4JI0C 5T8SA 3PESA 4K0BA 4DR5C 4RLFA 2WD9A 1T5HX 4LFAC 5BURA 3TDEA 5BR8C 2HHHC 1RG9A 3DLPX 1O92A 2OO4A 3FCCA 1O90A 4LF5C 3E7WA 4KHPC 4NDNA 2KZFA 2DYJA 1ZB9A 3KXWA 4RM2A 1J5EC 4D4GA 1MXCA 1UKKA 2Y27A 4LF6C 1ZB8A 4B3RC 5A19A 4RLQA 4NXMC 3I07A 3ETCA 2PT7G 3N54B 4JI4C 1LCIA 5T8TA 3R9XA 1XNRC 3RV2A 4D57A 4DV6C 3G7SA 2BH1X 1N34C 3RG2A 4IR7A 2E8EA 4L7IA 5A1IA 4WV3A 1XMOC 3DHVA 1XRAA 4FUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8C A;  2ASB A;  1MKY A;  4JI8 C;  4DR1 C;  4YY3 C;  4DV2 C;  5LMN C;  4B3S C;  1XMQ C;  3LUS A;  3IEV A;  4JI7 C;  4X64 C;  1NYE A;  4BSZ A;  4XX2 A;  4B3T C;  3JAM D;  2ONF A;  2BJO A;  5IT9 D;  2UUC C;  2OPL A;  1I94 C;  4DR4 C;  2CY1 A;  3GKU A;  4JI3 C;  4X65 C;  4DV3 C;  2E8F A;  2QL8 A;  4DV7 C;  2ZM6 C;  4DV0 C;  2EGT A;  4DV4 C;  4NXN C;  1WF3 A;  3AF6 A;  4B3M C;  4DCS A;  4LFC C;  2UUA C;  2HJG A;  4JYA C;  5LMU C;  2UXC C;  1ML8 A;  4DCV A;  4YHH C;  3OTO C;  4DR6 C;  4DUY C;  1IBL C;  1HH2 P;  4DR7 C;  1HNW C;  1N33 C;  4DV5 C;  1IBK C;  3R9W A;  2UU9 C;  3T1H C;  4DUZ C;  5FLX D;  2XR1 A;  4MH4 A;  4JI0 C;  4DR5 C;  4LFA C;  1N36 C;  4JI2 C;  5BR8 C;  2HHH C;  1EGA A;  1HNZ C;  1JOS A;  4NOZ A;  1IBM C;  4GKK C;  4LF8 C;  2UXD C;  3J7A D;  2VQF C;  1QWI A;  3AF5 A;  3CJE A;  2CXC A;  4JI1 C;  2UUB C;  1KKG A;  1PA4 A;  4JI5 C;  1LQL A;  5IWA C;  4GKJ C;  4LF5 C;  4KHP C;  2KZF A;  2D7V A;  1ZB9 A;  2DYJ A;  2E5L C;  4X62 C;  4LF7 C;  4DR2 C;  1J5E C;  2VQE C;  5A2Q D;  4DR3 C;  4JV5 C;  1N32 C;  1L2F A;  1UKK A;  4JI6 C;  4LF6 C;  1ZB8 A;  4OX9 C;  4B3R C;  1VLA A;  2JMP A;  4NXM C;  2E7G A;  2OPL B;  2ATW A;  1WH9 A;  3I07 A;  4LFB C;  1HNX C;  1N2F A;  2PT7 G;  2F4V C;  4MTN A;  4K0K C;  4JI4 C;  4X66 C;  4AQY C;  1USP B;  3IEU A;  2UXB C;  3R9X A;  2YCB A;  4LF4 C;  4DCT A;  1XNR C;  3EER A;  4DV6 C;  2PN2 A;  1XNQ C;  1N34 C;  1FJG C;  4DV1 C;  3J80 D;  1USP A;  2E8E A;  4DCU A;  3J81 D;  3T1Y C;  1XMO C;  4LF9 C;  1HR0 C;  1K0R A; 
#chains in the Genus database with same CATH topology
 2E8C A;  2YWC A;  3VNR A;  4JI8 C;  3PBK A;  4YY3 C;  3LUS A;  2ONF A;  4DV7 C;  4DV0 C;  2EGT A;  3I08 A;  5BSR A;  3VNQ A;  1T5D X;  2UXC C;  2OBV A;  2VSQ A;  3S82 A;  1YJ7 A;  2DHM A;  4DCV A;  3OTO C;  1AMU A;  4DG9 A;  3CQ1 A;  1HNW C;  5FLX D;  2YX1 A;  5GTD A;  2P2M A;  4D56 A;  1TH5 A;  3UX3 A;  1N36 C;  4JI2 C;  4EAT A;  1EGA A;  3UZ0 A;  2M5H A;  4GKK C;  5CZX A;  4LF8 C;  2D1Q A;  3AF5 A;  3TUF A;  1RY2 A;  4G1I A;  2CXC A;  2UUB C;  2P02 A;  4RVO A;  5BSU A;  5IWA C;  2ZTB A;  4IZ6 A;  3UX2 A;  4D4I A;  2D7V A;  3CW8 X;  4OYC A;  4ODJ A;  5A2Q D;  1L2F A;  4JI6 C;  4OX9 C;  4BC7 A;  2PG1 E;  4BBY A;  5BUS A;  1WH9 A;  1N2F A;  4MTN A;  4K0K C;  3FM7 A;  5K8F A;  2WP0 C;  2YWB A;  3CW9 A;  2YCB A;  2AYA A;  1FUG A;  1FJG C;  4DCU A;  2QVX X;  1BA3 A;  1PG4 A;  1HR0 C;  4PRO C;  2ASB A;  1MDB A;  2QVY X;  4DV2 C;  5LMN C;  1P4E A;  4X64 C;  2D1S A;  4BSZ A;  3CQ2 A;  5IT9 D;  1YGT A;  1I94 C;  3GKU A;  3R44 A;  4JI3 C;  3A9V A;  1P7L A;  4DV3 C;  2E8F A;  2ZM6 C;  3AY0 A;  2DPL A;  5E7Q A;  2E0G A;  2HJG A;  2P2F A;  2QVZ X;  4PUG A;  3A25 A;  5KEI A;  1IBL C;  1HH2 P;  3IML A;  4L2Z A;  4DV5 C;  3DAY A;  4I9F A;  5BUQ A;  2D1T A;  3E7X A;  4MH4 A;  1O93 A;  2VZE A;  4DG8 A;  2P20 A;  4GXR A;  1HNZ C;  1IBM C;  4TPS B;  3J7A D;  4RM3 A;  2JNV A;  1QWI A;  1V25 A;  1KKG A;  4JI5 C;  4GKJ C;  4RVN A;  4ISB A;  2E5L C;  4X62 C;  1IB8 A;  4BC9 A;  5BSW A;  4DR2 C;  1M6X A;  2Y4O A;  4JV5 C;  4DR3 C;  3PRO C;  1VLA A;  4R0M A;  3LAX A;  4GXQ A;  4LFB C;  1MDF A;  2F4V C;  5BSV A;  4X66 C;  4AQY C;  2V7B A;  3IPL A;  5JRH A;  4L4Q A;  3B7W A;  3IEU A;  4RMN A;  4R1L A;  2NCL A;  3LNV A;  4DCT A;  2PN2 A;  4DV1 C;  1PG3 A;  3J80 D;  1USP A;  5IFI A;  3GR1 A;  3J81 D;  1UWD A;  5A1G A;  4LF9 C;  3O2E A;  2QW0 X;  1K0R A;  1XRC A;  3GR0 A;  5BST A;  1XMQ C;  3CQ3 A;  1NYE A;  3JAM D;  2UUC C;  3A26 A;  5LCI A;  4X65 C;  4G36 A;  3L8C A;  5AE3 A;  4DV4 C;  1FLO A;  4DCS A;  1PU1 A;  5LMU C;  1MD9 A;  2D28 C;  4KTT A;  1QM4 A;  4KTV A;  3UOW A;  4YHH C;  4PUH A;  4DR6 C;  4WS9 A;  5ADZ A;  4DUY C;  4GS5 A;  4R1M A;  1N33 C;  1IBK C;  2P2Q A;  2UU9 C;  4DUZ C;  3H2T A;  5CZV A;  1XS3 A;  5KYT A;  4HPV A;  2KDN A;  2P2J A;  3EQ6 A;  1JOS A;  2D27 A;  4NOZ A;  3NI2 A;  2UXD C;  2KZ0 A;  2VQF C;  3TQI A;  3L95 X;  4PZP A;  3CJE A;  4JI1 C;  2MCQ A;  1PA4 A;  1LQL A;  2Y4N A;  5AE1 A;  1V26 A;  4ZJZ A;  3LGX A;  4LF7 C;  4I9G A;  4G37 A;  2VQE C;  1N32 C;  3NYQ A;  3FCE A;  3C5E A;  3SO4 A;  2JMP A;  2E7G A;  2OPL B;  2ATW A;  1HNX C;  4BCA A;  3NPD A;  2PRO A;  1XRB A;  1O9T A;  1USP B;  2ZZM A;  1MXA A;  5AE2 A;  3VNS A;  2UXB C;  4LF4 C;  3EER A;  2Z51 A;  1XNQ C;  4LE5 A;  2MMA B;  4PUI A;  3T1Y C;  5H9U A;  2P2B A;  4FTF A;  1MKY A;  5DV9 A;  5KYV A;  4DR1 C;  4B3S C;  1V60 A;  3IEV A;  4JI7 C;  1XDX A;  4XX2 A;  4B3T C;  2BJO A;  3N2Q A;  2OPL A;  4DR4 C;  4JM1 A;  2CY1 A;  1VEH A;  3LNO A;  5BSM A;  2MM9 A;  2QL8 A;  3A4I A;  4NXN C;  1P4E C;  1WF3 A;  3AF6 A;  3UEB A;  4B3M C;  3GPC A;  2ZZN A;  3A9U A;  4LFC C;  2UUA C;  4JYA C;  4ZLP A;  1GPM A;  4OXI A;  3NYR A;  1ML8 A;  4U5Y D;  4FUQ A;  3ETO A;  4DR7 C;  5K85 A;  3R9W A;  4PHT A;  3T1H C;  1XHJ A;  2D1R A;  1MXB A;  1ULT A;  2XR1 A;  4JI0 C;  5T8S A;  3PES A;  4K0B A;  4DR5 C;  4RLF A;  2WD9 A;  1T5H X;  4LFA C;  5BUR A;  3TDE A;  5BR8 C;  2HHH C;  3K6R A;  1RG9 A;  3DLP X;  1O92 A;  2OO4 A;  3FCC A;  2CU6 A;  1O90 A;  3TR3 A;  4LF5 C;  3E7W A;  4KHP C;  4NDN A;  2KZF A;  2DYJ A;  1ZB9 A;  3KXW A;  4RM2 A;  1J5E C;  1NY8 A;  4D4G A;  1MXC A;  1UKK A;  2Y27 A;  4LF6 C;  1ZB8 A;  4B3R C;  1WCJ A;  5A19 A;  4RLQ A;  4NXM C;  3I07 A;  3ETC A;  2PT7 G;  1M6X C;  3N54 B;  4JI4 C;  1LCI A;  5T8T A;  3R9X A;  1XNR C;  3RV2 A;  4D57 A;  4DV6 C;  3G7S A;  2BH1 X;  1N34 C;  3RG2 A;  4IR7 A;  2E8E A;  4L7I A;  5A1I A;  4WV3 A;  1XMO C;  3DHV A;  1XRA A;  4FUT A;  2M5O A; 
#chains in the Genus database with same CATH homology
 2E8C A;  2YWC A;  3VNR A;  4JI8 C;  3PBK A;  4YY3 C;  3LUS A;  2ONF A;  4DV7 C;  4DV0 C;  2EGT A;  3I08 A;  5BSR A;  3VNQ A;  1T5D X;  2UXC C;  2OBV A;  2VSQ A;  3S82 A;  1YJ7 A;  4DCV A;  3OTO C;  1AMU A;  4DG9 A;  1HNW C;  5FLX D;  5GTD A;  2P2M A;  4D56 A;  1N36 C;  4JI2 C;  4EAT A;  1EGA A;  3UZ0 A;  4GKK C;  5CZX A;  4LF8 C;  2D1Q A;  3AF5 A;  3TUF A;  1RY2 A;  4G1I A;  2CXC A;  2UUB C;  2P02 A;  4RVO A;  5BSU A;  5IWA C;  4IZ6 A;  4D4I A;  2D7V A;  3CW8 X;  4OYC A;  4ODJ A;  5A2Q D;  1L2F A;  4JI6 C;  4OX9 C;  4BC7 A;  4BBY A;  5BUS A;  1WH9 A;  1N2F A;  4MTN A;  4K0K C;  5K8F A;  2WP0 C;  2YWB A;  3CW9 A;  2YCB A;  2AYA A;  1FUG A;  1FJG C;  4DCU A;  2QVX X;  1BA3 A;  1PG4 A;  1HR0 C;  4PRO C;  2ASB A;  1MDB A;  2QVY X;  4DV2 C;  5LMN C;  4X64 C;  2D1S A;  4BSZ A;  5IT9 D;  1I94 C;  3GKU A;  3R44 A;  4JI3 C;  3A9V A;  1P7L A;  4DV3 C;  2E8F A;  2ZM6 C;  2DPL A;  5E7Q A;  2E0G A;  2HJG A;  2P2F A;  2QVZ X;  5KEI A;  1IBL C;  1HH2 P;  3IML A;  4L2Z A;  4DV5 C;  3DAY A;  4I9F A;  5BUQ A;  2D1T A;  3E7X A;  4MH4 A;  1O93 A;  2VZE A;  4DG8 A;  2P20 A;  4GXR A;  1HNZ C;  1IBM C;  4TPS B;  3J7A D;  4RM3 A;  1QWI A;  1V25 A;  1KKG A;  4JI5 C;  4GKJ C;  4RVN A;  4ISB A;  2E5L C;  4X62 C;  4BC9 A;  5BSW A;  4DR2 C;  2Y4O A;  4JV5 C;  4DR3 C;  3PRO C;  1VLA A;  4R0M A;  3LAX A;  4GXQ A;  4LFB C;  1MDF A;  2F4V C;  5BSV A;  4X66 C;  4AQY C;  2V7B A;  3IPL A;  5JRH A;  4L4Q A;  3B7W A;  3IEU A;  4RMN A;  4R1L A;  3LNV A;  4DCT A;  2PN2 A;  4DV1 C;  1PG3 A;  3J80 D;  1USP A;  5IFI A;  3GR1 A;  3J81 D;  5A1G A;  4LF9 C;  2QW0 X;  1K0R A;  1XRC A;  3GR0 A;  5BST A;  1XMQ C;  1NYE A;  3JAM D;  2UUC C;  4X65 C;  4G36 A;  3L8C A;  5AE3 A;  4DV4 C;  4DCS A;  5LMU C;  1MD9 A;  2D28 C;  4KTT A;  1QM4 A;  4KTV A;  3UOW A;  4YHH C;  4DR6 C;  4WS9 A;  5ADZ A;  4DUY C;  4GS5 A;  4R1M A;  1N33 C;  1IBK C;  2P2Q A;  2UU9 C;  4DUZ C;  3H2T A;  5CZV A;  5KYT A;  4HPV A;  2P2J A;  3EQ6 A;  1JOS A;  2D27 A;  4NOZ A;  3NI2 A;  2UXD C;  2VQF C;  3L95 X;  3TQI A;  4PZP A;  3CJE A;  4JI1 C;  1PA4 A;  1LQL A;  2Y4N A;  5AE1 A;  1V26 A;  4ZJZ A;  3LGX A;  4LF7 C;  4I9G A;  4G37 A;  2VQE C;  1N32 C;  3NYQ A;  3FCE A;  3C5E A;  3SO4 A;  2JMP A;  2E7G A;  2OPL B;  2ATW A;  1HNX C;  4BCA A;  3NPD A;  2PRO A;  1XRB A;  1O9T A;  1USP B;  1MXA A;  5AE2 A;  3VNS A;  2UXB C;  4LF4 C;  3EER A;  1XNQ C;  4LE5 A;  3T1Y C;  5H9U A;  2P2B A;  4FTF A;  1MKY A;  5DV9 A;  5KYV A;  4DR1 C;  4B3S C;  3IEV A;  4JI7 C;  4XX2 A;  4B3T C;  2BJO A;  3N2Q A;  2OPL A;  4DR4 C;  4JM1 A;  2CY1 A;  5BSM A;  2QL8 A;  3A4I A;  4NXN C;  1WF3 A;  3AF6 A;  4B3M C;  3GPC A;  3A9U A;  4LFC C;  2UUA C;  4JYA C;  4ZLP A;  1GPM A;  4OXI A;  3NYR A;  1ML8 A;  4U5Y D;  4FUQ A;  3ETO A;  4DR7 C;  5K85 A;  3R9W A;  4PHT A;  3T1H C;  2D1R A;  1MXB A;  1ULT A;  2XR1 A;  4JI0 C;  5T8S A;  3PES A;  4K0B A;  4DR5 C;  4RLF A;  2WD9 A;  1T5H X;  4LFA C;  5BUR A;  3TDE A;  5BR8 C;  2HHH C;  1RG9 A;  3DLP X;  1O92 A;  2OO4 A;  3FCC A;  1O90 A;  4LF5 C;  3E7W A;  4KHP C;  4NDN A;  2KZF A;  2DYJ A;  1ZB9 A;  3KXW A;  4RM2 A;  1J5E C;  4D4G A;  1MXC A;  1UKK A;  2Y27 A;  4LF6 C;  1ZB8 A;  4B3R C;  5A19 A;  4RLQ A;  4NXM C;  3I07 A;  3ETC A;  2PT7 G;  3N54 B;  4JI4 C;  1LCI A;  5T8T A;  3R9X A;  1XNR C;  3RV2 A;  4D57 A;  4DV6 C;  3G7S A;  2BH1 X;  1N34 C;  3RG2 A;  4IR7 A;  2E8E A;  4L7I A;  5A1I A;  4WV3 A;  1XMO C;  3DHV A;  1XRA A;  4FUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...