4LF5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf5C02
3CJEA 1NYEA 1UKKA 1JOSA 4YY3C 4DV6C 1XMQC 1L2FA 3JAMD 1ZB8A 1N33C 1WH9A 2VQFC 4DR5C 1ZB9A 2ZM6C 4LFBC 4DCUA 4XX2A 2ASBA 4JI8C 1I94C 5A2QD 5IT9D 1XNRC 4DV1C 2UXDC 2E8CA 2E7GA 4DV3C 4DR4C 4LF7C 1VLAA 4LF5C 1ML8A 1EGAA 4DR7C 2E5LC 4JV5C 2HJGA 1WF3A 2BJOA 3J81D 4DCSA 2UU9C 2XR1A 3R9XA 1IBKC 5LMNC 3J7AD 4OX9C 4X65C 1K0RA 4X64C 1HNXC 4LF9C 4DUYC 2UUAC 1N2FA 4LF8C 1HH2P 1N34C 4YHHC 3IEUA 2OPLB 2PN2A 4DR2C 1HR0C 4JI7C 4NOZA 2OPLA 4LF4C 3AF5A 4DR1C 4X62C 1PA4A 2E8EA 4JI1C 2QL8A 1IBMC 3IEVA 4NXMC 4GKJC 4DR6C 4AQYC 1USPB 3AF6A 1HNZC 1FJGC 1J5EC 2HHHC 2YCBA 4K0KC 2UXBC 4DV5C 4DCTA 4JI4C 2EGTA 2F4VC 2D7VA 3GKUA 3J80D 1MKYA 4JI6C 5BR8C 4JI3C 2KZFA 4X66C 4DV2C 4JI5C 3OTOC 2DYJA 4JI0C 4DV4C 1LQLA 4DCVA 2CXCA 1USPA 3LUSA 4DV7C 4LF6C 1N36C 4LFAC 4JI2C 4MH4A 1XNQC 4LFCC 1HNWC 4DV0C 4B3MC 3R9WA 3EERA 1XMOC 2CY1A 4BSZA 3T1YC 2VQEC 4B3SC 2UXCC 2E8FA 4JYAC 4B3TC 4DUZC 5FLXD 4NXNC 2JMPA 3T1HC 1QWIA 4DR3C 4B3RC 1KKGA 5IWAC 2ATWA 4GKKC 4KHPC 1IBLC 5LMUC 1N32C 2UUCC 2ONFA 3I07A 2UUBC 2PT7G 4MTNA
chains in the Genus database with same CATH superfamily
1XMQC 4G37A 3PESA 2VQFC 5BSMA 1ZB9A 4XX2A 1RG9A 4FUTA 4G36A 3UX3A 5BUSA 1NY8A 5IT9D 4NDNA 4DV1C 2BH1X 2UXDC 2DHMA 4D4GA 1VLAA 2P02A 1MXCA 3PBKA 2HJGA 1WF3A 4D56A 2D1RA 3J81D 2UU9C 2D1QA 3FCCA 4X64C 1HNXC 4L4QA 5AE1A 1WCJA 4DUYC 1MXAA 1HH2P 1N34C 2QVYX 3KXWA 3EQ6A 1YJ7A 3GPCA 3AF5A 4X62C 1PA4A 2PROA 4WS9A 3UX2A 4NXMC 2Y27A 3VNSA 2YCBA 2Z51A 2UXBC 3VNRA 1XRBA 4JI5C 2OBVA 3OTOC 5AE2A 1P4EA 4DG9A 5ADZA 5KYTA 2PG1E 3E7WA 1O9TA 3R9WA 2CY1A 5E7QA 4BSZA 5DV9A 2VQEC 4KTTA 4JYAC 5FLXD 3DHVA 3LNOA 2M5OA 1KKGA 5IWAC 1MD9A 3NPDA 2UUCC 3I07A 4D57A 2UUBC 4MTNA 3CJEA 1PG3A 4YY3C 4TPSB 4ZJZA 3G7SA 5IFIA 5A19A 4DR5C 4RM3A 2ZM6C 2WD9A 3UZ0A 4K0BA 2KZ0A 5BUQA 3K6RA 2NCLA 2E8CA 4DR4C 2VSQA 1V26A 4BCAA 4LF5C 4HPVA 4JV5C 2BJOA 2XR1A 3CQ3A 1O93A 1IBKC 3GR0A 4PZPA 2MCQA 5BSUA 2UUAC 1N2FA 4WV3A 4YHHC 3RV2A 1LCIA 5KYVA 2PN2A 5K85A 5BSWA 4DR2C 4JI7C 4NOZA 1PU1A 3ETOA 3NYRA 1XHJA 1BA3A 4DR1C 2MMAB 4JI1C 4PROC 3C5EA 3A9VA 2M5HA 3AF6A 2YWCA 3DLPX 1J5EC 3R44A 4K0KC 2OO4A 1T5DX 2EGTA 5KEIA 3J80D 2D28C 3TDEA 4JI6C 4JI3C 4JI0C 3DAYA 4DV4C 1PG4A 1FUGA 1MXBA 1USPA 3LUSA 4DV7C 1N36C 4LFAC 3UOWA 4MH4A 3LAXA 1HNWC 4ODJA 3ETCA 5BSRA 1XMOC 2Y4OA 4IZ6A 5CZVA 2UXCC 4I9GA 1GPMA 2E8FA 4GXQA 2MM9A 3FM7A 3T1HC 4FTFA 5T8SA 1XRAA 5LMUC 3N2QA 3O2EA 3NYQA 4D4IA 4PUHA 5JRHA 1N33C 1WH9A 4RMNA 3LNVA 2CU6A 4JM1A 4DCUA 4RM2A 3E7XA 2ASBA 1I94C 3I08A 1M6XA 4RLQA 2E7GA 4LF7C 3PROC 4U5YD 2QW0X 1ML8A 1EGAA 4DR7C 2E5LC 4ZLPA 2E0GA 4DCSA 2D1SA 1MDBA 5LMNC 4R1LA 3A26A 1K0RA 4LF9C 4R1MA 2OPLB 2V7BA 1HR0C 3H2TA 3TQIA 2Y4NA 4LF4C 2QL8A 4GKJC 4I9FA 2P2QA 1UWDA 1AMUA 2AYAA 3L8CA 1HNZC 4L7IA 3A9UA 5A1IA 2F4VC 2D7VA 3GKUA 5CZXA 1MKYA 5BR8C 2KZFA 4DV2C 1XS3A 2DYJA 3CQ1A 1T5HX 1LQLA 4GXRA 2YWBA 3TUFA 3UEBA 4LE5A 4JI2C 5BURA 3IPLA 2DPLA 3CW8X 4LFCC 1XDXA 4DV0C 4B3MC 4BC9A 3CW9A 3EERA 1RY2A 4PUGA 3RG2A 4B3TC 3VNQA 4NXNC 4RLFA 2JMPA 4DR3C 2ATWA 4GKKC 3LGXA 4KHPC 1IBLC 1N32C 3TR3A 2ONFA 1M6XC 3A25A 1NYEA 1UKKA 1JOSA 4DV6C 4GS5A 2KDNA 1L2FA 3JAMD 1ZB8A 5LCIA 2ZTBA 4DG8A 4LFBC 3S82A 5AE3A 3FCEA 4RVOA 1VEHA 4JI8C 5A2QD 1XNRC 2ZZNA 4DV3C 3CQ2A 2WP0C 1FLOA 2ZZMA 1V60A 2QVZX 1O92A 3R9XA 3J7AD 4OX9C 4X65C 3SO4A 3GR1A 1XRCA 4LF8C 3IEUA 5T8TA 1IB8A 2P2FA 1V25A 2OPLA 4BC7A 1O90A 2E8EA 5K8FA 1IBMC 3IEVA 4DR6C 2D27A 4AQYC 1USPB 1FJGC 2HHHC 5H9UA 4DV5C 4DCTA 4JI4C 2P2JA 4R0MA 1P7LA 5A1GA 1ULTA 4BBYA 4PHTA 4X66C 2QVXX 2P2MA 4DCVA 2CXCA 4L2ZA 2D1TA 2P20A 4ISBA 4PUIA 4LF6C 1YGTA 2JNVA 4OXIA 2VZEA 1XNQC 1QM4A 5BSTA 3AY0A 4KTVA 3T1YC 1P4EC 3L95X 4B3SC 3A4IA 3NI2A 3B7WA 4DUZC 3N54B 1QWIA 4FUQA 5BSVA 5GTDA 4B3RC 2P2BA 2YX1A 3IMLA 4G1IA 4EATA 4IR7A 1TH5A 4RVNA 4OYCA 2PT7G 1MDFA
chains in the Genus database with same CATH topology
1XMQC 4G37A 3PESA 2VQFC 5BSMA 1ZB9A 4XX2A 1RG9A 4FUTA 4G36A 5BUSA 5IT9D 4NDNA 4DV1C 2BH1X 2UXDC 4D4GA 1VLAA 2P02A 1MXCA 3PBKA 2HJGA 1WF3A 4D56A 2D1RA 3J81D 2UU9C 2D1QA 3FCCA 4X64C 1HNXC 4L4QA 5AE1A 4DUYC 1MXAA 1HH2P 1N34C 2QVYX 3KXWA 3EQ6A 1YJ7A 3GPCA 3AF5A 4X62C 1PA4A 2PROA 4WS9A 4NXMC 2Y27A 3VNSA 2YCBA 2UXBC 3VNRA 1XRBA 4JI5C 2OBVA 3OTOC 5AE2A 4DG9A 5ADZA 5KYTA 3E7WA 1O9TA 3R9WA 2CY1A 5E7QA 4BSZA 5DV9A 2VQEC 4KTTA 4JYAC 5FLXD 3DHVA 1KKGA 5IWAC 1MD9A 3NPDA 2UUCC 3I07A 4D57A 2UUBC 4MTNA 3CJEA 1PG3A 4YY3C 4TPSB 4ZJZA 3G7SA 5IFIA 5A19A 4DR5C 4RM3A 2ZM6C 2WD9A 3UZ0A 4K0BA 5BUQA 2E8CA 4DR4C 2VSQA 1V26A 4BCAA 4LF5C 4HPVA 4JV5C 2BJOA 2XR1A 1O93A 1IBKC 3GR0A 4PZPA 5BSUA 2UUAC 1N2FA 4WV3A 4YHHC 3RV2A 1LCIA 5KYVA 2PN2A 5K85A 5BSWA 4DR2C 4JI7C 4NOZA 3ETOA 3NYRA 1BA3A 4DR1C 4JI1C 4PROC 3C5EA 3A9VA 3AF6A 2YWCA 3DLPX 1J5EC 3R44A 4K0KC 2OO4A 1T5DX 2EGTA 5KEIA 3J80D 2D28C 3TDEA 4JI6C 4JI3C 4JI0C 3DAYA 4DV4C 1PG4A 1FUGA 1MXBA 1USPA 3LUSA 4DV7C 4LFAC 1N36C 3UOWA 4MH4A 3LAXA 1HNWC 4ODJA 3ETCA 5BSRA 1XMOC 2Y4OA 4IZ6A 5CZVA 2UXCC 4I9GA 1GPMA 2E8FA 4GXQA 3T1HC 4FTFA 5T8SA 1XRAA 5LMUC 3N2QA 3NYQA 4D4IA 5JRHA 1N33C 1WH9A 4RMNA 3LNVA 4JM1A 4DCUA 4RM2A 3E7XA 2ASBA 1I94C 3I08A 4RLQA 2E7GA 4LF7C 3PROC 4U5YD 2QW0X 1ML8A 1EGAA 4DR7C 2E5LC 4ZLPA 2E0GA 4DCSA 2D1SA 1MDBA 5LMNC 4R1LA 1K0RA 4LF9C 4R1MA 2OPLB 2V7BA 1HR0C 3H2TA 3TQIA 2Y4NA 4LF4C 2QL8A 4GKJC 4I9FA 2P2QA 1AMUA 2AYAA 3L8CA 1HNZC 4L7IA 3A9UA 5A1IA 2F4VC 2D7VA 3GKUA 5CZXA 1MKYA 5BR8C 2KZFA 4DV2C 2DYJA 1T5HX 1LQLA 4GXRA 2YWBA 3TUFA 4JI2C 4LE5A 5BURA 3IPLA 2DPLA 3CW8X 4LFCC 4DV0C 4B3MC 4BC9A 3CW9A 3EERA 1RY2A 3RG2A 4B3TC 3VNQA 4NXNC 4RLFA 2JMPA 4DR3C 2ATWA 4GKKC 3LGXA 4KHPC 1IBLC 1N32C 2ONFA 1NYEA 1UKKA 1JOSA 4DV6C 4GS5A 1L2FA 3JAMD 1ZB8A 4DG8A 4LFBC 3S82A 5AE3A 3FCEA 4RVOA 4JI8C 5A2QD 1XNRC 4DV3C 2WP0C 2QVZX 1O92A 3R9XA 3J7AD 4OX9C 4X65C 3SO4A 3GR1A 1XRCA 4LF8C 3IEUA 5T8TA 2P2FA 1V25A 2OPLA 4BC7A 1O90A 2E8EA 5K8FA 1IBMC 3IEVA 4DR6C 2D27A 4AQYC 1USPB 1FJGC 2HHHC 5H9UA 4DV5C 4DCTA 4JI4C 2P2JA 4R0MA 1P7LA 5A1GA 1ULTA 4BBYA 4PHTA 4X66C 2QVXX 2P2MA 4DCVA 2CXCA 4L2ZA 2D1TA 2P20A 4ISBA 4LF6C 4OXIA 2VZEA 1XNQC 1QM4A 5BSTA 4KTVA 3T1YC 3L95X 4B3SC 3A4IA 3NI2A 3B7WA 4DUZC 3N54B 1QWIA 4FUQA 5BSVA 5GTDA 4B3RC 2P2BA 3IMLA 4G1IA 4EATA 4IR7A 4RVNA 4OYCA 2PT7G 1MDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJE A;  1NYE A;  1UKK A;  1JOS A;  4YY3 C;  4DV6 C;  1XMQ C;  1L2F A;  3JAM D;  1ZB8 A;  1N33 C;  1WH9 A;  2VQF C;  4DR5 C;  1ZB9 A;  2ZM6 C;  4LFB C;  4DCU A;  4XX2 A;  2ASB A;  4JI8 C;  1I94 C;  5A2Q D;  5IT9 D;  1XNR C;  4DV1 C;  2UXD C;  2E8C A;  2E7G A;  4DV3 C;  4DR4 C;  4LF7 C;  1VLA A;  4LF5 C;  1ML8 A;  1EGA A;  4DR7 C;  2E5L C;  4JV5 C;  2HJG A;  1WF3 A;  2BJO A;  3J81 D;  4DCS A;  2UU9 C;  2XR1 A;  3R9X A;  1IBK C;  5LMN C;  3J7A D;  4OX9 C;  4X65 C;  1K0R A;  4X64 C;  1HNX C;  4LF9 C;  4DUY C;  2UUA C;  1N2F A;  4LF8 C;  1HH2 P;  1N34 C;  4YHH C;  3IEU A;  2OPL B;  2PN2 A;  4DR2 C;  1HR0 C;  4JI7 C;  4NOZ A;  2OPL A;  4LF4 C;  3AF5 A;  4DR1 C;  4X62 C;  1PA4 A;  2E8E A;  4JI1 C;  2QL8 A;  1IBM C;  3IEV A;  4NXM C;  4GKJ C;  4DR6 C;  4AQY C;  1USP B;  3AF6 A;  1HNZ C;  1FJG C;  1J5E C;  2HHH C;  2YCB A;  4K0K C;  2UXB C;  4DV5 C;  4DCT A;  4JI4 C;  2EGT A;  2F4V C;  2D7V A;  3GKU A;  3J80 D;  1MKY A;  4JI6 C;  5BR8 C;  4JI3 C;  2KZF A;  4X66 C;  4DV2 C;  4JI5 C;  3OTO C;  2DYJ A;  4JI0 C;  4DV4 C;  1LQL A;  4DCV A;  2CXC A;  1USP A;  3LUS A;  4DV7 C;  4LF6 C;  1N36 C;  4LFA C;  4JI2 C;  4MH4 A;  1XNQ C;  4LFC C;  1HNW C;  4DV0 C;  4B3M C;  3R9W A;  3EER A;  1XMO C;  2CY1 A;  4BSZ A;  3T1Y C;  2VQE C;  4B3S C;  2UXC C;  2E8F A;  4JYA C;  4B3T C;  4DUZ C;  5FLX D;  4NXN C;  2JMP A;  3T1H C;  1QWI A;  4DR3 C;  4B3R C;  1KKG A;  5IWA C;  2ATW A;  4GKK C;  4KHP C;  1IBL C;  5LMU C;  1N32 C;  2UUC C;  2ONF A;  3I07 A;  2UUB C;  2PT7 G;  4MTN A; 
#chains in the Genus database with same CATH topology
 1XMQ C;  4G37 A;  3PES A;  2VQF C;  5BSM A;  1ZB9 A;  4XX2 A;  1RG9 A;  4FUT A;  4G36 A;  3UX3 A;  5BUS A;  1NY8 A;  5IT9 D;  4NDN A;  4DV1 C;  2BH1 X;  2UXD C;  2DHM A;  4D4G A;  1VLA A;  2P02 A;  1MXC A;  3PBK A;  2HJG A;  1WF3 A;  4D56 A;  2D1R A;  3J81 D;  2UU9 C;  2D1Q A;  3FCC A;  4X64 C;  1HNX C;  4L4Q A;  5AE1 A;  1WCJ A;  4DUY C;  1MXA A;  1HH2 P;  1N34 C;  2QVY X;  3KXW A;  3EQ6 A;  1YJ7 A;  3GPC A;  3AF5 A;  4X62 C;  1PA4 A;  2PRO A;  4WS9 A;  3UX2 A;  4NXM C;  2Y27 A;  3VNS A;  2YCB A;  2Z51 A;  2UXB C;  3VNR A;  1XRB A;  4JI5 C;  2OBV A;  3OTO C;  5AE2 A;  1P4E A;  4DG9 A;  5ADZ A;  5KYT A;  2PG1 E;  3E7W A;  1O9T A;  3R9W A;  2CY1 A;  5E7Q A;  4BSZ A;  5DV9 A;  2VQE C;  4KTT A;  4JYA C;  5FLX D;  3DHV A;  3LNO A;  2M5O A;  1KKG A;  5IWA C;  1MD9 A;  3NPD A;  2UUC C;  3I07 A;  4D57 A;  2UUB C;  4MTN A;  3CJE A;  1PG3 A;  4YY3 C;  4TPS B;  4ZJZ A;  3G7S A;  5IFI A;  5A19 A;  4DR5 C;  4RM3 A;  2ZM6 C;  2WD9 A;  3UZ0 A;  4K0B A;  2KZ0 A;  5BUQ A;  3K6R A;  2NCL A;  2E8C A;  4DR4 C;  2VSQ A;  1V26 A;  4BCA A;  4LF5 C;  4HPV A;  4JV5 C;  2BJO A;  2XR1 A;  3CQ3 A;  1O93 A;  1IBK C;  3GR0 A;  4PZP A;  2MCQ A;  5BSU A;  2UUA C;  1N2F A;  4WV3 A;  4YHH C;  3RV2 A;  1LCI A;  5KYV A;  2PN2 A;  5K85 A;  5BSW A;  4DR2 C;  4JI7 C;  4NOZ A;  1PU1 A;  3ETO A;  3NYR A;  1XHJ A;  1BA3 A;  4DR1 C;  2MMA B;  4JI1 C;  4PRO C;  3C5E A;  3A9V A;  2M5H A;  3AF6 A;  2YWC A;  3DLP X;  1J5E C;  3R44 A;  4K0K C;  2OO4 A;  1T5D X;  2EGT A;  5KEI A;  3J80 D;  2D28 C;  3TDE A;  4JI6 C;  4JI3 C;  4JI0 C;  3DAY A;  4DV4 C;  1PG4 A;  1FUG A;  1MXB A;  1USP A;  3LUS A;  4DV7 C;  1N36 C;  4LFA C;  3UOW A;  4MH4 A;  3LAX A;  1HNW C;  4ODJ A;  3ETC A;  5BSR A;  1XMO C;  2Y4O A;  4IZ6 A;  5CZV A;  2UXC C;  4I9G A;  1GPM A;  2E8F A;  4GXQ A;  2MM9 A;  3FM7 A;  3T1H C;  4FTF A;  5T8S A;  1XRA A;  5LMU C;  3N2Q A;  3O2E A;  3NYQ A;  4D4I A;  4PUH A;  5JRH A;  1N33 C;  1WH9 A;  4RMN A;  3LNV A;  2CU6 A;  4JM1 A;  4DCU A;  4RM2 A;  3E7X A;  2ASB A;  1I94 C;  3I08 A;  1M6X A;  4RLQ A;  2E7G A;  4LF7 C;  3PRO C;  4U5Y D;  2QW0 X;  1ML8 A;  1EGA A;  4DR7 C;  2E5L C;  4ZLP A;  2E0G A;  4DCS A;  2D1S A;  1MDB A;  5LMN C;  4R1L A;  3A26 A;  1K0R A;  4LF9 C;  4R1M A;  2OPL B;  2V7B A;  1HR0 C;  3H2T A;  3TQI A;  2Y4N A;  4LF4 C;  2QL8 A;  4GKJ C;  4I9F A;  2P2Q A;  1UWD A;  1AMU A;  2AYA A;  3L8C A;  1HNZ C;  4L7I A;  3A9U A;  5A1I A;  2F4V C;  2D7V A;  3GKU A;  5CZX A;  1MKY A;  5BR8 C;  2KZF A;  4DV2 C;  1XS3 A;  2DYJ A;  3CQ1 A;  1T5H X;  1LQL A;  4GXR A;  2YWB A;  3TUF A;  3UEB A;  4LE5 A;  4JI2 C;  5BUR A;  3IPL A;  2DPL A;  3CW8 X;  4LFC C;  1XDX A;  4DV0 C;  4B3M C;  4BC9 A;  3CW9 A;  3EER A;  1RY2 A;  4PUG A;  3RG2 A;  4B3T C;  3VNQ A;  4NXN C;  4RLF A;  2JMP A;  4DR3 C;  2ATW A;  4GKK C;  3LGX A;  4KHP C;  1IBL C;  1N32 C;  3TR3 A;  2ONF A;  1M6X C;  3A25 A;  1NYE A;  1UKK A;  1JOS A;  4DV6 C;  4GS5 A;  2KDN A;  1L2F A;  3JAM D;  1ZB8 A;  5LCI A;  2ZTB A;  4DG8 A;  4LFB C;  3S82 A;  5AE3 A;  3FCE A;  4RVO A;  1VEH A;  4JI8 C;  5A2Q D;  1XNR C;  2ZZN A;  4DV3 C;  3CQ2 A;  2WP0 C;  1FLO A;  2ZZM A;  1V60 A;  2QVZ X;  1O92 A;  3R9X A;  3J7A D;  4OX9 C;  4X65 C;  3SO4 A;  3GR1 A;  1XRC A;  4LF8 C;  3IEU A;  5T8T A;  1IB8 A;  2P2F A;  1V25 A;  2OPL A;  4BC7 A;  1O90 A;  2E8E A;  5K8F A;  1IBM C;  3IEV A;  4DR6 C;  2D27 A;  4AQY C;  1USP B;  1FJG C;  2HHH C;  5H9U A;  4DV5 C;  4DCT A;  4JI4 C;  2P2J A;  4R0M A;  1P7L A;  5A1G A;  1ULT A;  4BBY A;  4PHT A;  4X66 C;  2QVX X;  2P2M A;  4DCV A;  2CXC A;  4L2Z A;  2D1T A;  2P20 A;  4ISB A;  4PUI A;  4LF6 C;  1YGT A;  2JNV A;  4OXI A;  2VZE A;  1XNQ C;  1QM4 A;  5BST A;  3AY0 A;  4KTV A;  3T1Y C;  1P4E C;  3L95 X;  4B3S C;  3A4I A;  3NI2 A;  3B7W A;  4DUZ C;  3N54 B;  1QWI A;  4FUQ A;  5BSV A;  5GTD A;  4B3R C;  2P2B A;  2YX1 A;  3IML A;  4G1I A;  4EAT A;  4IR7 A;  1TH5 A;  4RVN A;  4OYC A;  2PT7 G;  1MDF A; 
#chains in the Genus database with same CATH homology
 1XMQ C;  4G37 A;  3PES A;  2VQF C;  5BSM A;  1ZB9 A;  4XX2 A;  1RG9 A;  4FUT A;  4G36 A;  5BUS A;  5IT9 D;  4NDN A;  4DV1 C;  2BH1 X;  2UXD C;  4D4G A;  1VLA A;  2P02 A;  1MXC A;  3PBK A;  2HJG A;  1WF3 A;  4D56 A;  2D1R A;  3J81 D;  2UU9 C;  2D1Q A;  3FCC A;  4X64 C;  1HNX C;  4L4Q A;  5AE1 A;  4DUY C;  1MXA A;  1HH2 P;  1N34 C;  2QVY X;  3KXW A;  3EQ6 A;  1YJ7 A;  3GPC A;  3AF5 A;  4X62 C;  1PA4 A;  2PRO A;  4WS9 A;  4NXM C;  2Y27 A;  3VNS A;  2YCB A;  2UXB C;  3VNR A;  1XRB A;  4JI5 C;  2OBV A;  3OTO C;  5AE2 A;  4DG9 A;  5ADZ A;  5KYT A;  3E7W A;  1O9T A;  3R9W A;  2CY1 A;  5E7Q A;  4BSZ A;  5DV9 A;  2VQE C;  4KTT A;  4JYA C;  5FLX D;  3DHV A;  1KKG A;  5IWA C;  1MD9 A;  3NPD A;  2UUC C;  3I07 A;  4D57 A;  2UUB C;  4MTN A;  3CJE A;  1PG3 A;  4YY3 C;  4TPS B;  4ZJZ A;  3G7S A;  5IFI A;  5A19 A;  4DR5 C;  4RM3 A;  2ZM6 C;  2WD9 A;  3UZ0 A;  4K0B A;  5BUQ A;  2E8C A;  4DR4 C;  2VSQ A;  1V26 A;  4BCA A;  4LF5 C;  4HPV A;  4JV5 C;  2BJO A;  2XR1 A;  1O93 A;  1IBK C;  3GR0 A;  4PZP A;  5BSU A;  2UUA C;  1N2F A;  4WV3 A;  4YHH C;  3RV2 A;  1LCI A;  5KYV A;  2PN2 A;  5K85 A;  5BSW A;  4DR2 C;  4JI7 C;  4NOZ A;  3ETO A;  3NYR A;  1BA3 A;  4DR1 C;  4JI1 C;  4PRO C;  3C5E A;  3A9V A;  3AF6 A;  2YWC A;  3DLP X;  1J5E C;  3R44 A;  4K0K C;  2OO4 A;  1T5D X;  2EGT A;  5KEI A;  3J80 D;  2D28 C;  3TDE A;  4JI6 C;  4JI3 C;  4JI0 C;  3DAY A;  4DV4 C;  1PG4 A;  1FUG A;  1MXB A;  1USP A;  3LUS A;  4DV7 C;  4LFA C;  1N36 C;  3UOW A;  4MH4 A;  3LAX A;  1HNW C;  4ODJ A;  3ETC A;  5BSR A;  1XMO C;  2Y4O A;  4IZ6 A;  5CZV A;  2UXC C;  4I9G A;  1GPM A;  2E8F A;  4GXQ A;  3T1H C;  4FTF A;  5T8S A;  1XRA A;  5LMU C;  3N2Q A;  3NYQ A;  4D4I A;  5JRH A;  1N33 C;  1WH9 A;  4RMN A;  3LNV A;  4JM1 A;  4DCU A;  4RM2 A;  3E7X A;  2ASB A;  1I94 C;  3I08 A;  4RLQ A;  2E7G A;  4LF7 C;  3PRO C;  4U5Y D;  2QW0 X;  1ML8 A;  1EGA A;  4DR7 C;  2E5L C;  4ZLP A;  2E0G A;  4DCS A;  2D1S A;  1MDB A;  5LMN C;  4R1L A;  1K0R A;  4LF9 C;  4R1M A;  2OPL B;  2V7B A;  1HR0 C;  3H2T A;  3TQI A;  2Y4N A;  4LF4 C;  2QL8 A;  4GKJ C;  4I9F A;  2P2Q A;  1AMU A;  2AYA A;  3L8C A;  1HNZ C;  4L7I A;  3A9U A;  5A1I A;  2F4V C;  2D7V A;  3GKU A;  5CZX A;  1MKY A;  5BR8 C;  2KZF A;  4DV2 C;  2DYJ A;  1T5H X;  1LQL A;  4GXR A;  2YWB A;  3TUF A;  4JI2 C;  4LE5 A;  5BUR A;  3IPL A;  2DPL A;  3CW8 X;  4LFC C;  4DV0 C;  4B3M C;  4BC9 A;  3CW9 A;  3EER A;  1RY2 A;  3RG2 A;  4B3T C;  3VNQ A;  4NXN C;  4RLF A;  2JMP A;  4DR3 C;  2ATW A;  4GKK C;  3LGX A;  4KHP C;  1IBL C;  1N32 C;  2ONF A;  1NYE A;  1UKK A;  1JOS A;  4DV6 C;  4GS5 A;  1L2F A;  3JAM D;  1ZB8 A;  4DG8 A;  4LFB C;  3S82 A;  5AE3 A;  3FCE A;  4RVO A;  4JI8 C;  5A2Q D;  1XNR C;  4DV3 C;  2WP0 C;  2QVZ X;  1O92 A;  3R9X A;  3J7A D;  4OX9 C;  4X65 C;  3SO4 A;  3GR1 A;  1XRC A;  4LF8 C;  3IEU A;  5T8T A;  2P2F A;  1V25 A;  2OPL A;  4BC7 A;  1O90 A;  2E8E A;  5K8F A;  1IBM C;  3IEV A;  4DR6 C;  2D27 A;  4AQY C;  1USP B;  1FJG C;  2HHH C;  5H9U A;  4DV5 C;  4DCT A;  4JI4 C;  2P2J A;  4R0M A;  1P7L A;  5A1G A;  1ULT A;  4BBY A;  4PHT A;  4X66 C;  2QVX X;  2P2M A;  4DCV A;  2CXC A;  4L2Z A;  2D1T A;  2P20 A;  4ISB A;  4LF6 C;  4OXI A;  2VZE A;  1XNQ C;  1QM4 A;  5BST A;  4KTV A;  3T1Y C;  3L95 X;  4B3S C;  3A4I A;  3NI2 A;  3B7W A;  4DUZ C;  3N54 B;  1QWI A;  4FUQ A;  5BSV A;  5GTD A;  4B3R C;  2P2B A;  3IML A;  4G1I A;  4EAT A;  4IR7 A;  4RVN A;  4OYC A;  2PT7 G;  1MDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...