4LF5C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 51
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf5C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf5C02
1XNQC 4LFBC 2EGTA 4OX9C 4JI3C 2HJGA 4LF6C 4JI0C 2UXDC 1KKGA 2ATWA 3T1YC 4DR4C 5FLXD 4DR1C 2UXCC 2PN2A 2E8FA 3R9XA 1IBLC 1PA4A 2UUAC 4JI1C 3GKUA 4K0KC 1ML8A 2ZM6C 4DCVA 2E8CA 4LF4C 2VQFC 2YCBA 1JOSA 4DR7C 1HNWC 3OTOC 1MKYA 4LF8C 1VLAA 2CY1A 1EGAA 5LMUC 4DUZC 2HHHC 4JV5C 4B3MC 4JYAC 4B3TC 2XR1A 2UUCC 1HR0C 3JAMD 4DV0C 2PT7G 1L2FA 4GKJC 2VQEC 5A2QD 4X65C 4DV3C 4LF5C 1N34C 1WF3A 1NYEA 1ZB9A 4NXMC 1LQLA 1XMOC 1QWIA 4GKKC 4NOZA 1USPB 3J7AD 4X62C 1XMQC 1XNRC 2ONFA 4DR6C 4JI4C 3J80D 2KZFA 1N36C 1N32C 1HNXC 4LF7C 2E8EA 2OPLB 1K0RA 4BSZA 3T1HC 1J5EC 4JI8C 4LFAC 1I94C 4JI2C 2QL8A 5LMNC 3I07A 4DV4C 2D7VA 4DCTA 4X64C 4DUYC 2F4VC 2BJOA 3LUSA 4DV2C 4DCUA 4DR2C 4JI5C 4XX2A 1WH9A 1N2FA 2UXBC 2CXCA 3CJEA 4X66C 4DV6C 4DV5C 4DV7C 1IBMC 2JMPA 4NXNC 2UUBC 4YY3C 4DCSA 4AQYC 3J81D 4B3SC 3AF6A 3AF5A 4MH4A 5BR8C 1FJGC 3EERA 4JI7C 3IEVA 3R9WA 4DV1C 4DR3C 4KHPC 2E7GA 1HNZC 1IBKC 2UU9C 1ZB8A 1UKKA 2DYJA 4LF9C 1USPA 4DR5C 1N33C 5IT9D 4B3RC 3IEUA 4JI6C 5IWAC 2OPLA 4LFCC 2ASBA 4YHHC 2E5LC 1HH2P 4MTNA
chains in the Genus database with same CATH superfamily
2EGTA 4JI3C 2P02A 1KKGA 1IB8A 5FLXD 2UXCC 2E8FA 3PESA 1IBLC 1PA4A 2UUAC 4JI1C 3GKUA 4K0KC 3FCEA 4OYCA 4DCVA 2ZZNA 2D1RA 2P2JA 2M5HA 2E8CA 5CZVA 2VQFC 2YCBA 3A4IA 3GR0A 3NPDA 3OTOC 1VLAA 2CY1A 4RMNA 1EGAA 2HHHC 4WS9A 4B3MC 1MDBA 3L95X 4B3TC 4PUHA 4DV0C 2PT7G 3CQ3A 1P4EA 4GXRA 2VQEC 5JRHA 5A1IA 1YGTA 2YX1A 3B7WA 5AE2A 4NXMC 2MMAB 4X62C 1XNRC 1N36C 4KTTA 1MXBA 1WCJA 4I9FA 4BSZA 3T1HC 1J5EC 4ISBA 3NI2A 4JI8C 5T8TA 3R44A 5DV9A 1M6XA 3I07A 4DV4C 2F4VC 3LUSA 5GTDA 2WP0C 3IPLA 4XX2A 4RVOA 4DV7C 2MM9A 1IBMC 1XRAA 1O90A 4L2ZA 4AQYC 3DAYA 1V26A 1LCIA 3AF5A 2WD9A 5BR8C 5K85A 2D1TA 3EERA 2QW0X 3R9WA 3DLPX 2YWCA 2BH1X 2Y4NA 4DR5C 4IZ6A 3VNRA 5H9UA 4B3RC 2P2QA 4G37A 2D27A 5LMUC 4OX9C 4FTFA 2VSQA 4KTVA 2UXDC 2DHMA 2ATWA 3T1YC 1PU1A 1XDXA 5KYVA 4TPSB 1YJ7A 5E7QA 4R0MA 3K6RA 4LF4C 4DR7C 3GPCA 1MKYA 4RVNA 1O9TA 1RG9A 4JV5C 2XR1A 1PG3A 2UUCC 4RLQA 2P2BA 1L2FA 3LAXA 5A2QD 4ODJA 5BSMA 4X65C 4DV3C 4LF5C 2Y4OA 1WF3A 1LQLA 1XMOC 1QWIA 4NOZA 1USPB 5K8FA 1NY8A 4D57A 5A1GA 4DR6C 3J80D 1N32C 3VNQA 4RM3A 2OPLB 3LNOA 4BCAA 2AYAA 3PBKA 1XS3A 4FUQA 2D7VA 2OO4A 2BJOA 4DR2C 1AMUA 1ULTA 3RV2A 3ETCA 2UXBC 3CJEA 4GXQA 1GPMA 4ZLPA 4RLFA 5BSUA 1XRBA 3DHVA 4HPVA 4B3SC 1V60A 5AE1A 3LNVA 3S82A 3IEVA 4DV1C 4L4QA 4DR3C 2E7GA 1HNZC 2DPLA 1IBKC 3UEBA 5KYTA 1UKKA 4LF9C 2E0GA 5BUSA 3ETOA 4DG9A 4L7IA 4JI6C 5IWAC 4LE5A 3TUFA 5ADZA 4LFCC 2ASBA 1HH2P 4DV6C 1BA3A 3NYQA 1M6XC 1XNQC 4IR7A 1UWDA 3G7SA 2HJGA 4BC9A 4LF6C 3CQ1A 3LGXA 4DR4C 3O2EA 4RM2A 1O92A 3A25A 4JM1A 4U5YD 1ML8A 3E7WA 5BUQA 3EQ6A 1HNWC 3AY0A 3TR3A 3L8CA 3FCCA 3RG2A 4DUZC 1PG4A 1T5HX 3UX3A 4DG8A 3IMLA 1VEHA 5CZXA 2ONFA 4K0BA 2KZFA 2ZTBA 1MD9A 4GS5A 2QVXX 5BSTA 2E8EA 1I94C 4JI2C 2QL8A 3CW8X 1XHJA 3UZ0A 2P2FA 4D4GA 2OBVA 4X64C 4DUYC 4FUTA 4DV2C 4DCUA 4JI5C 2Z51A 1FUGA 4D56A 4X66C 2YWBA 4DV5C 3UOWA 4NXNC 2UUBC 1MXAA 2KZ0A 3AF6A 2JNVA 2CU6A 3VNSA 1T5DX 2D1SA 2NCLA 4G36A 4OXIA 4JI7C 1V25A 3NYRA 4KHPC 1ZB8A 2DYJA 1USPA 1P7LA 1N33C 2MCQA 2QVZX 4R1LA 3IEUA 2OPLA 3PROC 4YHHC 3GR1A 4MTNA 4GKKC 4LFBC 5AE3A 2ZZMA 1P4EC 4JI0C 3A9UA 4DR1C 2D28C 2PN2A 3E7XA 4PHTA 1XRCA 3R9XA 2V7BA 3CQ2A 2QVYX 3UX2A 5BURA 1QM4A 4R1MA 2ZM6C 1MDFA 4PZPA 5BSWA 1JOSA 5KEIA 4PROC 3N54B 4LF8C 3SO4A 1O93A 4JYAC 4PUIA 2VZEA 1HR0C 3JAMD 3I08A 3N2QA 3KXWA 4GKJC 3CW9A 3H2TA 5BSVA 1N34C 1NYEA 1ZB9A 3C5EA 4BC7A 4BBYA 3J7AD 1XMQC 3FM7A 4D4IA 4JI4C 2D1QA 1MXCA 1HNXC 4LF7C 5LCIA 1K0RA 2KDNA 4LFAC 5T8SA 2P2MA 5LMNC 4DCTA 5BSRA 2Y27A 1N2FA 1WH9A 2CXCA 4ZJZA 3A26A 4I9GA 2JMPA 4YY3C 5IFIA 4EATA 4DCSA 3J81D 1TH5A 3A9VA 1FLOA 2PROA 4MH4A 1FJGC 3TQIA 4PUGA 4WV3A 5A19A 2P20A 3TDEA 2UU9C 2PG1E 1RY2A 5IT9D 4G1IA 2M5OA 2E5LC 4NDNA
chains in the Genus database with same CATH topology
2EGTA 4JI3C 2P02A 1KKGA 5FLXD 2UXCC 2E8FA 3PESA 1IBLC 1PA4A 2UUAC 4JI1C 3GKUA 4K0KC 3FCEA 4OYCA 4DCVA 2D1RA 2P2JA 5CZVA 2E8CA 2VQFC 2YCBA 3A4IA 3GR0A 3NPDA 3OTOC 1VLAA 2CY1A 4RMNA 1EGAA 2HHHC 4WS9A 4B3MC 1MDBA 3L95X 4B3TC 4DV0C 2PT7G 4GXRA 2VQEC 5JRHA 5A1IA 3B7WA 5AE2A 4NXMC 4X62C 1XNRC 1N36C 4KTTA 1MXBA 4I9FA 4BSZA 3T1HC 1J5EC 4ISBA 3NI2A 4JI8C 5T8TA 3R44A 5DV9A 3I07A 4DV4C 2F4VC 3LUSA 5GTDA 2WP0C 3IPLA 4XX2A 4RVOA 4DV7C 1IBMC 1XRAA 1O90A 4L2ZA 4AQYC 3DAYA 1V26A 1LCIA 3AF5A 2WD9A 5BR8C 5K85A 2D1TA 3EERA 2QW0X 3R9WA 3DLPX 2YWCA 2BH1X 2Y4NA 4DR5C 4IZ6A 3VNRA 5H9UA 4B3RC 2P2QA 4G37A 2D27A 5LMUC 4OX9C 4FTFA 2VSQA 4KTVA 2UXDC 2ATWA 3T1YC 5KYVA 4TPSB 1YJ7A 5E7QA 4R0MA 4LF4C 4DR7C 3GPCA 1MKYA 4RVNA 1O9TA 1RG9A 4JV5C 2XR1A 1PG3A 2UUCC 4RLQA 2P2BA 1L2FA 3LAXA 5A2QD 4ODJA 5BSMA 4X65C 4DV3C 4LF5C 2Y4OA 1WF3A 1LQLA 1XMOC 1QWIA 4NOZA 1USPB 5K8FA 4D57A 5A1GA 4DR6C 3J80D 1N32C 3VNQA 4RM3A 2OPLB 4BCAA 2AYAA 3PBKA 4FUQA 2D7VA 2OO4A 2BJOA 4DR2C 1AMUA 1ULTA 3ETCA 3RV2A 2UXBC 3CJEA 4GXQA 1GPMA 4ZLPA 4RLFA 5BSUA 1XRBA 3DHVA 4HPVA 4B3SC 5AE1A 3LNVA 3S82A 3IEVA 4DV1C 4L4QA 4DR3C 2E7GA 1HNZC 2DPLA 1IBKC 5KYTA 1UKKA 4LF9C 2E0GA 5BUSA 3ETOA 4DG9A 4L7IA 4JI6C 5IWAC 4LE5A 3TUFA 5ADZA 4LFCC 2ASBA 1HH2P 4DV6C 1BA3A 3NYQA 1XNQC 4IR7A 3G7SA 2HJGA 4BC9A 4LF6C 3LGXA 4DR4C 4RM2A 1O92A 4JM1A 4U5YD 1ML8A 3E7WA 5BUQA 3EQ6A 1HNWC 3L8CA 3FCCA 3RG2A 4DUZC 1PG4A 1T5HX 4DG8A 3IMLA 5CZXA 2ONFA 4K0BA 2KZFA 1MD9A 4GS5A 2QVXX 5BSTA 2E8EA 1I94C 4JI2C 2QL8A 3CW8X 3UZ0A 2P2FA 4D4GA 2OBVA 4X64C 4DUYC 4FUTA 4DV2C 4DCUA 4JI5C 1FUGA 4D56A 4X66C 2YWBA 4DV5C 3UOWA 4NXNC 2UUBC 1MXAA 3AF6A 3VNSA 1T5DX 2D1SA 4G36A 4OXIA 4JI7C 1V25A 3NYRA 4KHPC 1ZB8A 2DYJA 1USPA 1P7LA 1N33C 2QVZX 4R1LA 3IEUA 2OPLA 3PROC 4YHHC 3GR1A 4MTNA 4GKKC 4LFBC 5AE3A 4JI0C 3A9UA 4DR1C 2D28C 2PN2A 3E7XA 4PHTA 1XRCA 3R9XA 2V7BA 2QVYX 5BURA 1QM4A 4R1MA 2ZM6C 1MDFA 4PZPA 5BSWA 1JOSA 5KEIA 4PROC 3N54B 4LF8C 3SO4A 1O93A 4JYAC 2VZEA 1HR0C 3JAMD 3I08A 3N2QA 3KXWA 4GKJC 3CW9A 3H2TA 5BSVA 1N34C 1NYEA 1ZB9A 3C5EA 4BC7A 4BBYA 3J7AD 1XMQC 4D4IA 4JI4C 2D1QA 1MXCA 1HNXC 4LF7C 1K0RA 4LFAC 5T8SA 2P2MA 5LMNC 4DCTA 5BSRA 2Y27A 1N2FA 1WH9A 2CXCA 4ZJZA 4I9GA 2JMPA 4YY3C 5IFIA 4EATA 4DCSA 3J81D 3A9VA 2PROA 4MH4A 1FJGC 3TQIA 4WV3A 5A19A 2P20A 3TDEA 2UU9C 1RY2A 5IT9D 4G1IA 2E5LC 4NDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ C;  4LFB C;  2EGT A;  4OX9 C;  4JI3 C;  2HJG A;  4LF6 C;  4JI0 C;  2UXD C;  1KKG A;  2ATW A;  3T1Y C;  4DR4 C;  5FLX D;  4DR1 C;  2UXC C;  2PN2 A;  2E8F A;  3R9X A;  1IBL C;  1PA4 A;  2UUA C;  4JI1 C;  3GKU A;  4K0K C;  1ML8 A;  2ZM6 C;  4DCV A;  2E8C A;  4LF4 C;  2VQF C;  2YCB A;  1JOS A;  4DR7 C;  1HNW C;  3OTO C;  1MKY A;  4LF8 C;  1VLA A;  2CY1 A;  1EGA A;  5LMU C;  4DUZ C;  2HHH C;  4JV5 C;  4B3M C;  4JYA C;  4B3T C;  2XR1 A;  2UUC C;  1HR0 C;  3JAM D;  4DV0 C;  2PT7 G;  1L2F A;  4GKJ C;  2VQE C;  5A2Q D;  4X65 C;  4DV3 C;  4LF5 C;  1N34 C;  1WF3 A;  1NYE A;  1ZB9 A;  4NXM C;  1LQL A;  1XMO C;  1QWI A;  4GKK C;  4NOZ A;  1USP B;  3J7A D;  4X62 C;  1XMQ C;  1XNR C;  2ONF A;  4DR6 C;  4JI4 C;  3J80 D;  2KZF A;  1N36 C;  1N32 C;  1HNX C;  4LF7 C;  2E8E A;  2OPL B;  1K0R A;  4BSZ A;  3T1H C;  1J5E C;  4JI8 C;  4LFA C;  1I94 C;  4JI2 C;  2QL8 A;  5LMN C;  3I07 A;  4DV4 C;  2D7V A;  4DCT A;  4X64 C;  4DUY C;  2F4V C;  2BJO A;  3LUS A;  4DV2 C;  4DCU A;  4DR2 C;  4JI5 C;  4XX2 A;  1WH9 A;  1N2F A;  2UXB C;  2CXC A;  3CJE A;  4X66 C;  4DV6 C;  4DV5 C;  4DV7 C;  1IBM C;  2JMP A;  4NXN C;  2UUB C;  4YY3 C;  4DCS A;  4AQY C;  3J81 D;  4B3S C;  3AF6 A;  3AF5 A;  4MH4 A;  5BR8 C;  1FJG C;  3EER A;  4JI7 C;  3IEV A;  3R9W A;  4DV1 C;  4DR3 C;  4KHP C;  2E7G A;  1HNZ C;  1IBK C;  2UU9 C;  1ZB8 A;  1UKK A;  2DYJ A;  4LF9 C;  1USP A;  4DR5 C;  1N33 C;  5IT9 D;  4B3R C;  3IEU A;  4JI6 C;  5IWA C;  2OPL A;  4LFC C;  2ASB A;  4YHH C;  2E5L C;  1HH2 P;  4MTN A; 
#chains in the Genus database with same CATH topology
 2EGT A;  4JI3 C;  2P02 A;  1KKG A;  1IB8 A;  5FLX D;  2UXC C;  2E8F A;  3PES A;  1IBL C;  1PA4 A;  2UUA C;  4JI1 C;  3GKU A;  4K0K C;  3FCE A;  4OYC A;  4DCV A;  2ZZN A;  2D1R A;  2P2J A;  2M5H A;  2E8C A;  5CZV A;  2VQF C;  2YCB A;  3A4I A;  3GR0 A;  3NPD A;  3OTO C;  1VLA A;  2CY1 A;  4RMN A;  1EGA A;  2HHH C;  4WS9 A;  4B3M C;  1MDB A;  3L95 X;  4B3T C;  4PUH A;  4DV0 C;  2PT7 G;  3CQ3 A;  1P4E A;  4GXR A;  2VQE C;  5JRH A;  5A1I A;  1YGT A;  2YX1 A;  3B7W A;  5AE2 A;  4NXM C;  2MMA B;  4X62 C;  1XNR C;  1N36 C;  4KTT A;  1MXB A;  1WCJ A;  4I9F A;  4BSZ A;  3T1H C;  1J5E C;  4ISB A;  3NI2 A;  4JI8 C;  5T8T A;  3R44 A;  5DV9 A;  1M6X A;  3I07 A;  4DV4 C;  2F4V C;  3LUS A;  5GTD A;  2WP0 C;  3IPL A;  4XX2 A;  4RVO A;  4DV7 C;  2MM9 A;  1IBM C;  1XRA A;  1O90 A;  4L2Z A;  4AQY C;  3DAY A;  1V26 A;  1LCI A;  3AF5 A;  2WD9 A;  5BR8 C;  5K85 A;  2D1T A;  3EER A;  2QW0 X;  3R9W A;  3DLP X;  2YWC A;  2BH1 X;  2Y4N A;  4DR5 C;  4IZ6 A;  3VNR A;  5H9U A;  4B3R C;  2P2Q A;  4G37 A;  2D27 A;  5LMU C;  4OX9 C;  4FTF A;  2VSQ A;  4KTV A;  2UXD C;  2DHM A;  2ATW A;  3T1Y C;  1PU1 A;  1XDX A;  5KYV A;  4TPS B;  1YJ7 A;  5E7Q A;  4R0M A;  3K6R A;  4LF4 C;  4DR7 C;  3GPC A;  1MKY A;  4RVN A;  1O9T A;  1RG9 A;  4JV5 C;  2XR1 A;  1PG3 A;  2UUC C;  4RLQ A;  2P2B A;  1L2F A;  3LAX A;  5A2Q D;  4ODJ A;  5BSM A;  4X65 C;  4DV3 C;  4LF5 C;  2Y4O A;  1WF3 A;  1LQL A;  1XMO C;  1QWI A;  4NOZ A;  1USP B;  5K8F A;  1NY8 A;  4D57 A;  5A1G A;  4DR6 C;  3J80 D;  1N32 C;  3VNQ A;  4RM3 A;  2OPL B;  3LNO A;  4BCA A;  2AYA A;  3PBK A;  1XS3 A;  4FUQ A;  2D7V A;  2OO4 A;  2BJO A;  4DR2 C;  1AMU A;  1ULT A;  3RV2 A;  3ETC A;  2UXB C;  3CJE A;  4GXQ A;  1GPM A;  4ZLP A;  4RLF A;  5BSU A;  1XRB A;  3DHV A;  4HPV A;  4B3S C;  1V60 A;  5AE1 A;  3LNV A;  3S82 A;  3IEV A;  4DV1 C;  4L4Q A;  4DR3 C;  2E7G A;  1HNZ C;  2DPL A;  1IBK C;  3UEB A;  5KYT A;  1UKK A;  4LF9 C;  2E0G A;  5BUS A;  3ETO A;  4DG9 A;  4L7I A;  4JI6 C;  5IWA C;  4LE5 A;  3TUF A;  5ADZ A;  4LFC C;  2ASB A;  1HH2 P;  4DV6 C;  1BA3 A;  3NYQ A;  1M6X C;  1XNQ C;  4IR7 A;  1UWD A;  3G7S A;  2HJG A;  4BC9 A;  4LF6 C;  3CQ1 A;  3LGX A;  4DR4 C;  3O2E A;  4RM2 A;  1O92 A;  3A25 A;  4JM1 A;  4U5Y D;  1ML8 A;  3E7W A;  5BUQ A;  3EQ6 A;  1HNW C;  3AY0 A;  3TR3 A;  3L8C A;  3FCC A;  3RG2 A;  4DUZ C;  1PG4 A;  1T5H X;  3UX3 A;  4DG8 A;  3IML A;  1VEH A;  5CZX A;  2ONF A;  4K0B A;  2KZF A;  2ZTB A;  1MD9 A;  4GS5 A;  2QVX X;  5BST A;  2E8E A;  1I94 C;  4JI2 C;  2QL8 A;  3CW8 X;  1XHJ A;  3UZ0 A;  2P2F A;  4D4G A;  2OBV A;  4X64 C;  4DUY C;  4FUT A;  4DV2 C;  4DCU A;  4JI5 C;  2Z51 A;  1FUG A;  4D56 A;  4X66 C;  2YWB A;  4DV5 C;  3UOW A;  4NXN C;  2UUB C;  1MXA A;  2KZ0 A;  3AF6 A;  2JNV A;  2CU6 A;  3VNS A;  1T5D X;  2D1S A;  2NCL A;  4G36 A;  4OXI A;  4JI7 C;  1V25 A;  3NYR A;  4KHP C;  1ZB8 A;  2DYJ A;  1USP A;  1P7L A;  1N33 C;  2MCQ A;  2QVZ X;  4R1L A;  3IEU A;  2OPL A;  3PRO C;  4YHH C;  3GR1 A;  4MTN A;  4GKK C;  4LFB C;  5AE3 A;  2ZZM A;  1P4E C;  4JI0 C;  3A9U A;  4DR1 C;  2D28 C;  2PN2 A;  3E7X A;  4PHT A;  1XRC A;  3R9X A;  2V7B A;  3CQ2 A;  2QVY X;  3UX2 A;  5BUR A;  1QM4 A;  4R1M A;  2ZM6 C;  1MDF A;  4PZP A;  5BSW A;  1JOS A;  5KEI A;  4PRO C;  3N54 B;  4LF8 C;  3SO4 A;  1O93 A;  4JYA C;  4PUI A;  2VZE A;  1HR0 C;  3JAM D;  3I08 A;  3N2Q A;  3KXW A;  4GKJ C;  3CW9 A;  3H2T A;  5BSV A;  1N34 C;  1NYE A;  1ZB9 A;  3C5E A;  4BC7 A;  4BBY A;  3J7A D;  1XMQ C;  3FM7 A;  4D4I A;  4JI4 C;  2D1Q A;  1MXC A;  1HNX C;  4LF7 C;  5LCI A;  1K0R A;  2KDN A;  4LFA C;  5T8S A;  2P2M A;  5LMN C;  4DCT A;  5BSR A;  2Y27 A;  1N2F A;  1WH9 A;  2CXC A;  4ZJZ A;  3A26 A;  4I9G A;  2JMP A;  4YY3 C;  5IFI A;  4EAT A;  4DCS A;  3J81 D;  1TH5 A;  3A9V A;  1FLO A;  2PRO A;  4MH4 A;  1FJG C;  3TQI A;  4PUG A;  4WV3 A;  5A19 A;  2P20 A;  3TDE A;  2UU9 C;  2PG1 E;  1RY2 A;  5IT9 D;  4G1I A;  2M5O A;  2E5L C;  4NDN A; 
#chains in the Genus database with same CATH homology
 2EGT A;  4JI3 C;  2P02 A;  1KKG A;  5FLX D;  2UXC C;  2E8F A;  3PES A;  1IBL C;  1PA4 A;  2UUA C;  4JI1 C;  3GKU A;  4K0K C;  3FCE A;  4OYC A;  4DCV A;  2D1R A;  2P2J A;  5CZV A;  2E8C A;  2VQF C;  2YCB A;  3A4I A;  3GR0 A;  3NPD A;  3OTO C;  1VLA A;  2CY1 A;  4RMN A;  1EGA A;  2HHH C;  4WS9 A;  4B3M C;  1MDB A;  3L95 X;  4B3T C;  4DV0 C;  2PT7 G;  4GXR A;  2VQE C;  5JRH A;  5A1I A;  3B7W A;  5AE2 A;  4NXM C;  4X62 C;  1XNR C;  1N36 C;  4KTT A;  1MXB A;  4I9F A;  4BSZ A;  3T1H C;  1J5E C;  4ISB A;  3NI2 A;  4JI8 C;  5T8T A;  3R44 A;  5DV9 A;  3I07 A;  4DV4 C;  2F4V C;  3LUS A;  5GTD A;  2WP0 C;  3IPL A;  4XX2 A;  4RVO A;  4DV7 C;  1IBM C;  1XRA A;  1O90 A;  4L2Z A;  4AQY C;  3DAY A;  1V26 A;  1LCI A;  3AF5 A;  2WD9 A;  5BR8 C;  5K85 A;  2D1T A;  3EER A;  2QW0 X;  3R9W A;  3DLP X;  2YWC A;  2BH1 X;  2Y4N A;  4DR5 C;  4IZ6 A;  3VNR A;  5H9U A;  4B3R C;  2P2Q A;  4G37 A;  2D27 A;  5LMU C;  4OX9 C;  4FTF A;  2VSQ A;  4KTV A;  2UXD C;  2ATW A;  3T1Y C;  5KYV A;  4TPS B;  1YJ7 A;  5E7Q A;  4R0M A;  4LF4 C;  4DR7 C;  3GPC A;  1MKY A;  4RVN A;  1O9T A;  1RG9 A;  4JV5 C;  2XR1 A;  1PG3 A;  2UUC C;  4RLQ A;  2P2B A;  1L2F A;  3LAX A;  5A2Q D;  4ODJ A;  5BSM A;  4X65 C;  4DV3 C;  4LF5 C;  2Y4O A;  1WF3 A;  1LQL A;  1XMO C;  1QWI A;  4NOZ A;  1USP B;  5K8F A;  4D57 A;  5A1G A;  4DR6 C;  3J80 D;  1N32 C;  3VNQ A;  4RM3 A;  2OPL B;  4BCA A;  2AYA A;  3PBK A;  4FUQ A;  2D7V A;  2OO4 A;  2BJO A;  4DR2 C;  1AMU A;  1ULT A;  3ETC A;  3RV2 A;  2UXB C;  3CJE A;  4GXQ A;  1GPM A;  4ZLP A;  4RLF A;  5BSU A;  1XRB A;  3DHV A;  4HPV A;  4B3S C;  5AE1 A;  3LNV A;  3S82 A;  3IEV A;  4DV1 C;  4L4Q A;  4DR3 C;  2E7G A;  1HNZ C;  2DPL A;  1IBK C;  5KYT A;  1UKK A;  4LF9 C;  2E0G A;  5BUS A;  3ETO A;  4DG9 A;  4L7I A;  4JI6 C;  5IWA C;  4LE5 A;  3TUF A;  5ADZ A;  4LFC C;  2ASB A;  1HH2 P;  4DV6 C;  1BA3 A;  3NYQ A;  1XNQ C;  4IR7 A;  3G7S A;  2HJG A;  4BC9 A;  4LF6 C;  3LGX A;  4DR4 C;  4RM2 A;  1O92 A;  4JM1 A;  4U5Y D;  1ML8 A;  3E7W A;  5BUQ A;  3EQ6 A;  1HNW C;  3L8C A;  3FCC A;  3RG2 A;  4DUZ C;  1PG4 A;  1T5H X;  4DG8 A;  3IML A;  5CZX A;  2ONF A;  4K0B A;  2KZF A;  1MD9 A;  4GS5 A;  2QVX X;  5BST A;  2E8E A;  1I94 C;  4JI2 C;  2QL8 A;  3CW8 X;  3UZ0 A;  2P2F A;  4D4G A;  2OBV A;  4X64 C;  4DUY C;  4FUT A;  4DV2 C;  4DCU A;  4JI5 C;  1FUG A;  4D56 A;  4X66 C;  2YWB A;  4DV5 C;  3UOW A;  4NXN C;  2UUB C;  1MXA A;  3AF6 A;  3VNS A;  1T5D X;  2D1S A;  4G36 A;  4OXI A;  4JI7 C;  1V25 A;  3NYR A;  4KHP C;  1ZB8 A;  2DYJ A;  1USP A;  1P7L A;  1N33 C;  2QVZ X;  4R1L A;  3IEU A;  2OPL A;  3PRO C;  4YHH C;  3GR1 A;  4MTN A;  4GKK C;  4LFB C;  5AE3 A;  4JI0 C;  3A9U A;  4DR1 C;  2D28 C;  2PN2 A;  3E7X A;  4PHT A;  1XRC A;  3R9X A;  2V7B A;  2QVY X;  5BUR A;  1QM4 A;  4R1M A;  2ZM6 C;  1MDF A;  4PZP A;  5BSW A;  1JOS A;  5KEI A;  4PRO C;  3N54 B;  4LF8 C;  3SO4 A;  1O93 A;  4JYA C;  2VZE A;  1HR0 C;  3JAM D;  3I08 A;  3N2Q A;  3KXW A;  4GKJ C;  3CW9 A;  3H2T A;  5BSV A;  1N34 C;  1NYE A;  1ZB9 A;  3C5E A;  4BC7 A;  4BBY A;  3J7A D;  1XMQ C;  4D4I A;  4JI4 C;  2D1Q A;  1MXC A;  1HNX C;  4LF7 C;  1K0R A;  4LFA C;  5T8S A;  2P2M A;  5LMN C;  4DCT A;  5BSR A;  2Y27 A;  1N2F A;  1WH9 A;  2CXC A;  4ZJZ A;  4I9G A;  2JMP A;  4YY3 C;  5IFI A;  4EAT A;  4DCS A;  3J81 D;  3A9V A;  2PRO A;  4MH4 A;  1FJG C;  3TQI A;  4WV3 A;  5A19 A;  2P20 A;  3TDE A;  2UU9 C;  1RY2 A;  5IT9 D;  4G1I A;  2E5L C;  4NDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...