1HNWC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnwC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnwC02
3GKUA 2JMPA 2E8EA 4DV7C 4GKKC 4K0KC 4DV1C 2ASBA 2E8CA 4DV0C 1XMOC 3AF6A 4X66C 3AF5A 5LMNC 4DR1C 4KHPC 4DV2C 5LMUC 4DR2C 1IBKC 4NXNC 1ML8A 1N34C 4DV6C 1FJGC 1J5EC 3CJEA 3J80D 4AQYC 4JI8C 4JV5C 1N32C 2XR1A 4NXMC 2YCBA 1IBLC 4DCVA 1HNXC 1XNQC 4X62C 1IBMC 3IEUA 2E8FA 2UXBC 4DCSA 4OX9C 4LF7C 1N33C 4DUYC 4DCUA 4LFAC 1USPB 4B3TC 1L2FA 2EGTA 2HJGA 3EERA 2VQEC 1N2FA 1HH2P 4JI3C 4DV4C 1NYEA 1USPA 4XX2A 1QWIA 1WH9A 2UU9C 2KZFA 2UUAC 5BR8C 2BJOA 4DR6C 4B3RC 4LFBC 1N36C 2F4VC 1ZB9A 3LUSA 4X64C 1XMQC 1LQLA 2QL8A 4YY3C 1HR0C 3J81D 2OPLB 4JI4C 2ATWA 1KKGA 4JI0C 3JAMD 2DYJA 2UUBC 4NOZA 4DR4C 3J7AD 4JYAC 1K0RA 2UUCC 4LF5C 4JI2C 4JI6C 4DR3C 4YHHC 2OPLA 5A2QD 2ZM6C 4DV5C 1XNRC 4DR7C 1HNZC 4GKJC 5FLXD 4LF6C 4BSZA 1UKKA 4LF9C 2CXCA 2UXDC 5IT9D 2E5LC 1I94C 2HHHC 4MTNA 4B3MC 3R9WA 3IEVA 1WF3A 4JI1C 1ZB8A 4DUZC 5IWAC 2E7GA 4DV3C 3T1HC 3I07A 2VQFC 4LFCC 2UXCC 4JI7C 1VLAA 1EGAA 1MKYA 3OTOC 3R9XA 4LF8C 2PT7G 2ONFA 1HNWC 4B3SC 4MH4A 2D7VA 4DCTA 1PA4A 4LF4C 1JOSA 2CY1A 4DR5C 4X65C 2PN2A 4JI5C 3T1YC
chains in the Genus database with same CATH superfamily
5JRHA 2JNVA 3LAXA 1O9TA 2P20A 2D27A 5BSMA 3CQ3A 4D4GA 3AF6A 3VNSA 4KHPC 4PUIA 4DV2C 3CQ2A 2MCQA 1FJGC 2QW0X 1IB8A 1VEHA 1T5HX 4L7IA 1J5EC 3TDEA 2WD9A 3ETOA 1N32C 2XR1A 2YCBA 2E8FA 4OX9C 4DCUA 4LFAC 3CW8X 2E0GA 1XDXA 2BH1X 3IPLA 4IZ6A 3S82A 3UX2A 1P4EA 5K8FA 2AYAA 1WH9A 1FUGA 2OO4A 5AE1A 2UUAC 4RMNA 5BR8C 2BJOA 4DR6C 4B3RC 1UWDA 1N36C 4I9FA 1XMQC 1LQLA 2ATWA 1RY2A 5DV9A 5BURA 2UUBC 5T8TA 1FLOA 3E7XA 2NCLA 2D1SA 2ZM6C 4DR7C 1HNZC 1RG9A 4LF6C 4BC7A 4DG8A 2HHHC 4MTNA 3IEVA 1WF3A 3N54B 2P2QA 5IWAC 3R9XA 5A19A 4ZLPA 5BSTA 2CU6A 5BSWA 3RV2A 1PA4A 1JOSA 2CY1A 4X65C 3KXWA 5KEIA 3VNQA 1M6XC 4PUHA 4G37A 2P2MA 4LE5A 4DV0C 1XRBA 5LMNC 2Y4NA 3GR0A 2ZZNA 3FM7A 4I9GA 1IBKC 3NPDA 4RM2A 1QM4A 2D1RA 3PESA 3CJEA 4AQYC 4DG9A 4JI8C 5BUSA 4DCVA 5AE2A 2ZZMA 4X62C 1IBMC 1PG4A 2VZEA 1MDFA 4DUYC 4B3TC 3G7SA 3UOWA 2VQEC 1HH2P 2P02A 4JI3C 4DV4C 1NYEA 5A1GA 1USPA 1V26A 5ADZA 3CW9A 2V7BA 2QVYX 1YJ7A 4G1IA 2KZFA 3TUFA 3DLPX 4R1LA 5T8SA 2F4VC 4RVNA 1AMUA 1V25A 1T5DX 2QL8A 5BSUA 2Y4OA 4JI4C 4JI0C 3R44A 3CQ1A 5BSVA 4WV3A 4PZPA 3N2QA 4JI6C 4DR3C 3IMLA 4GS5A 4LF9C 5LCIA 2E5LC 4OXIA 3LNVA 1PG3A 4JI1C 2M5OA 1ZB8A 2KDNA 4BBYA 3NI2A 1LCIA 4LFCC 1VLAA 2VSQA 1MKYA 4LF8C 2PT7G 1YGTA 2MM9A 4OYCA 3DAYA 1TH5A 4L4QA 1HNWC 3SO4A 2PN2A 1P4EC 3T1YC 1MXCA 3E7WA 3GKUA 4BCAA 4DV7C 4RLFA 4PROC 5AE3A 2ASBA 2E8CA 1XMOC 4ODJA 4RVOA 3TR3A 3AF5A 4NDNA 4DV6C 1MD9A 2YX1A 3L8CA 4JM1A 4NXMC 2PROA 4FTFA 3PBKA 3O2EA 1XNQC 2UXBC 4DCSA 4EATA 4GXQA 4FUTA 1USPB 1L2FA 5CZVA 2EGTA 2DPLA 2P2FA 2M5HA 3GR1A 5GTDA 1N2FA 3EQ6A 4XX2A 2P2JA 1QWIA 4U5YD 3L95X 3UEBA 3RG2A 1ZB9A 3C5EA 3LUSA 3UZ0A 4X64C 4YY3C 1HR0C 3TQIA 1KKGA 3JAMD 2DYJA 4DR4C 3A4IA 2D1QA 2PG1E 4HPVA 1K0RA 2UUCC 4LF5C 4JI2C 4G36A 4YHHC 2OPLA 3A9VA 5A2QD 4DV5C 5FLXD 4BSZA 1ULTA 2CXCA 3H2TA 5A1IA 2UXDC 5IT9D 1I94C 3DHVA 4B3MC 3R9WA 2E7GA 4DV3C 3T1HC 5E7QA 2P2BA 3I07A 2UXCC 4FUQA 1XS3A 4JI7C 5K85A 2ONFA 1MDBA 3FCEA 4B3SC 4DCTA 4IR7A 4R1MA 4TPSB 4JI5C 3VNRA 3I08A 2JMPA 2E8EA 3NYRA 3LGXA 2D28C 3A9UA 4RM3A 4GKKC 5KYVA 4K0KC 4DV1C 4X66C 4L2ZA 4DR1C 1NY8A 5LMUC 1O90A 3ETCA 4DR2C 4NXNC 1ML8A 1N34C 2D1TA 3K6RA 1XHJA 5IFIA 3J80D 1O92A 5CZXA 4JV5C 1IBLC 1HNXC 3A26A 3IEUA 3UX3A 4LF7C 1XRCA 1PU1A 1N33C 4ZJZA 1WCJA 2HJGA 1O93A 3EERA 2Y27A 4D56A 2Z51A 4KTVA 4KTTA 1M6XA 2UU9C 1MXBA 4ISBA 4LFBC 2MMAB 2QVZX 4RLQA 4PHTA 3J81D 2OPLB 5H9UA 3PROC 3B7WA 3FCCA 4NOZA 4BC9A 3J7AD 4JYAC 2OBVA 1V60A 2YWCA 3AY0A 4R0MA 4D57A 2YWBA 2KZ0A 1XNRC 4GKJC 1XRAA 5BSRA 1UKKA 1P7LA 5BUQA 4K0BA 5KYTA 2WP0C 4D4IA 2QVXX 4DUZC 2VQFC 1MXAA 4PUGA 1EGAA 3OTOC 3GPCA 4MH4A 2D7VA 4LF4C 1BA3A 3NYQA 2DHMA 4DR5C 4GXRA 3LNOA 4WS9A 2ZTBA 1GPMA 3A25A
chains in the Genus database with same CATH topology
5JRHA 3LAXA 1O9TA 2P20A 2D27A 5BSMA 4D4GA 3AF6A 3VNSA 4KHPC 4DV2C 1FJGC 2QW0X 1T5HX 4L7IA 1J5EC 3TDEA 2WD9A 3ETOA 1N32C 2XR1A 2YCBA 2E8FA 4OX9C 4DCUA 4LFAC 3CW8X 2E0GA 2BH1X 3IPLA 4IZ6A 3S82A 5K8FA 2AYAA 1WH9A 1FUGA 2OO4A 5AE1A 2UUAC 4RMNA 5BR8C 2BJOA 4DR6C 4B3RC 1N36C 4I9FA 1XMQC 1LQLA 2ATWA 1RY2A 5DV9A 5BURA 2UUBC 5T8TA 3E7XA 2D1SA 2ZM6C 4DR7C 1HNZC 1RG9A 4LF6C 4BC7A 4DG8A 2HHHC 4MTNA 3IEVA 1WF3A 3N54B 2P2QA 5IWAC 3R9XA 5A19A 4ZLPA 5BSTA 5BSWA 3RV2A 1PA4A 1JOSA 2CY1A 4X65C 3KXWA 5KEIA 3VNQA 4G37A 2P2MA 4LE5A 4DV0C 1XRBA 5LMNC 2Y4NA 3GR0A 4I9GA 1IBKC 3NPDA 4RM2A 1QM4A 2D1RA 3PESA 3CJEA 4AQYC 4DG9A 4JI8C 5BUSA 4DCVA 5AE2A 4X62C 1IBMC 1PG4A 2VZEA 1MDFA 4DUYC 4B3TC 3G7SA 3UOWA 2VQEC 1HH2P 2P02A 4JI3C 4DV4C 1NYEA 5A1GA 1USPA 1V26A 5ADZA 3CW9A 2V7BA 2QVYX 1YJ7A 4G1IA 2KZFA 3TUFA 3DLPX 4R1LA 5T8SA 2F4VC 4RVNA 1AMUA 1V25A 1T5DX 2QL8A 5BSUA 2Y4OA 4JI4C 4JI0C 3R44A 5BSVA 4WV3A 4PZPA 3N2QA 4JI6C 4DR3C 3IMLA 4GS5A 4LF9C 2E5LC 4OXIA 3LNVA 1PG3A 4JI1C 1ZB8A 4BBYA 3NI2A 1LCIA 4LFCC 1VLAA 2VSQA 1MKYA 4LF8C 2PT7G 4OYCA 3DAYA 1HNWC 4L4QA 3SO4A 2PN2A 3T1YC 1MXCA 3E7WA 3GKUA 4BCAA 4DV7C 4RLFA 4PROC 5AE3A 2ASBA 2E8CA 1XMOC 4ODJA 4RVOA 3AF5A 4NDNA 4DV6C 1MD9A 3L8CA 4JM1A 4NXMC 2PROA 4FTFA 3PBKA 1XNQC 2UXBC 4DCSA 4EATA 4GXQA 4FUTA 1USPB 1L2FA 5CZVA 2EGTA 2DPLA 2P2FA 3GR1A 5GTDA 1N2FA 3EQ6A 4XX2A 2P2JA 1QWIA 4U5YD 3L95X 3RG2A 1ZB9A 3C5EA 3LUSA 3UZ0A 4X64C 4YY3C 1HR0C 3TQIA 1KKGA 3JAMD 2DYJA 4DR4C 3A4IA 2D1QA 4HPVA 1K0RA 2UUCC 4LF5C 4JI2C 4G36A 4DV5C 2OPLA 3A9VA 5A2QD 4YHHC 5FLXD 4BSZA 1ULTA 2CXCA 3H2TA 5A1IA 2UXDC 5IT9D 1I94C 3DHVA 4B3MC 3R9WA 2E7GA 4DV3C 3T1HC 5E7QA 2P2BA 3I07A 2UXCC 4FUQA 4JI7C 5K85A 2ONFA 1MDBA 3FCEA 4B3SC 4DCTA 4IR7A 4R1MA 4TPSB 4JI5C 3VNRA 3I08A 2JMPA 2E8EA 3NYRA 3LGXA 2D28C 3A9UA 4RM3A 4GKKC 5KYVA 4K0KC 4DV1C 4X66C 4L2ZA 4DR1C 5LMUC 1O90A 3ETCA 4DR2C 4NXNC 1ML8A 1N34C 2D1TA 5IFIA 3J80D 1O92A 5CZXA 4JV5C 1IBLC 1HNXC 3IEUA 4LF7C 1XRCA 1N33C 4ZJZA 2HJGA 1O93A 3EERA 2Y27A 4D56A 4KTVA 4KTTA 2UU9C 1MXBA 4ISBA 4LFBC 2QVZX 4RLQA 4PHTA 3J81D 2OPLB 5H9UA 3PROC 3B7WA 3FCCA 4NOZA 4BC9A 3J7AD 4JYAC 2OBVA 2YWCA 4R0MA 4D57A 2YWBA 1XNRC 4GKJC 1XRAA 5BSRA 1UKKA 1P7LA 5BUQA 4K0BA 5KYTA 2WP0C 4D4IA 2QVXX 4DUZC 2VQFC 1MXAA 1EGAA 3OTOC 3GPCA 4MH4A 2D7VA 4LF4C 1BA3A 3NYQA 4DR5C 4GXRA 4WS9A 1GPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKU A;  2JMP A;  2E8E A;  4DV7 C;  4GKK C;  4K0K C;  4DV1 C;  2ASB A;  2E8C A;  4DV0 C;  1XMO C;  3AF6 A;  4X66 C;  3AF5 A;  5LMN C;  4DR1 C;  4KHP C;  4DV2 C;  5LMU C;  4DR2 C;  1IBK C;  4NXN C;  1ML8 A;  1N34 C;  4DV6 C;  1FJG C;  1J5E C;  3CJE A;  3J80 D;  4AQY C;  4JI8 C;  4JV5 C;  1N32 C;  2XR1 A;  4NXM C;  2YCB A;  1IBL C;  4DCV A;  1HNX C;  1XNQ C;  4X62 C;  1IBM C;  3IEU A;  2E8F A;  2UXB C;  4DCS A;  4OX9 C;  4LF7 C;  1N33 C;  4DUY C;  4DCU A;  4LFA C;  1USP B;  4B3T C;  1L2F A;  2EGT A;  2HJG A;  3EER A;  2VQE C;  1N2F A;  1HH2 P;  4JI3 C;  4DV4 C;  1NYE A;  1USP A;  4XX2 A;  1QWI A;  1WH9 A;  2UU9 C;  2KZF A;  2UUA C;  5BR8 C;  2BJO A;  4DR6 C;  4B3R C;  4LFB C;  1N36 C;  2F4V C;  1ZB9 A;  3LUS A;  4X64 C;  1XMQ C;  1LQL A;  2QL8 A;  4YY3 C;  1HR0 C;  3J81 D;  2OPL B;  4JI4 C;  2ATW A;  1KKG A;  4JI0 C;  3JAM D;  2DYJ A;  2UUB C;  4NOZ A;  4DR4 C;  3J7A D;  4JYA C;  1K0R A;  2UUC C;  4LF5 C;  4JI2 C;  4JI6 C;  4DR3 C;  4YHH C;  2OPL A;  5A2Q D;  2ZM6 C;  4DV5 C;  1XNR C;  4DR7 C;  1HNZ C;  4GKJ C;  5FLX D;  4LF6 C;  4BSZ A;  1UKK A;  4LF9 C;  2CXC A;  2UXD C;  5IT9 D;  2E5L C;  1I94 C;  2HHH C;  4MTN A;  4B3M C;  3R9W A;  3IEV A;  1WF3 A;  4JI1 C;  1ZB8 A;  4DUZ C;  5IWA C;  2E7G A;  4DV3 C;  3T1H C;  3I07 A;  2VQF C;  4LFC C;  2UXC C;  4JI7 C;  1VLA A;  1EGA A;  1MKY A;  3OTO C;  3R9X A;  4LF8 C;  2PT7 G;  2ONF A;  1HNW C;  4B3S C;  4MH4 A;  2D7V A;  4DCT A;  1PA4 A;  4LF4 C;  1JOS A;  2CY1 A;  4DR5 C;  4X65 C;  2PN2 A;  4JI5 C;  3T1Y C; 
#chains in the Genus database with same CATH topology
 5JRH A;  2JNV A;  3LAX A;  1O9T A;  2P20 A;  2D27 A;  5BSM A;  3CQ3 A;  4D4G A;  3AF6 A;  3VNS A;  4KHP C;  4PUI A;  4DV2 C;  3CQ2 A;  2MCQ A;  1FJG C;  2QW0 X;  1IB8 A;  1VEH A;  1T5H X;  4L7I A;  1J5E C;  3TDE A;  2WD9 A;  3ETO A;  1N32 C;  2XR1 A;  2YCB A;  2E8F A;  4OX9 C;  4DCU A;  4LFA C;  3CW8 X;  2E0G A;  1XDX A;  2BH1 X;  3IPL A;  4IZ6 A;  3S82 A;  3UX2 A;  1P4E A;  5K8F A;  2AYA A;  1WH9 A;  1FUG A;  2OO4 A;  5AE1 A;  2UUA C;  4RMN A;  5BR8 C;  2BJO A;  4DR6 C;  4B3R C;  1UWD A;  1N36 C;  4I9F A;  1XMQ C;  1LQL A;  2ATW A;  1RY2 A;  5DV9 A;  5BUR A;  2UUB C;  5T8T A;  1FLO A;  3E7X A;  2NCL A;  2D1S A;  2ZM6 C;  4DR7 C;  1HNZ C;  1RG9 A;  4LF6 C;  4BC7 A;  4DG8 A;  2HHH C;  4MTN A;  3IEV A;  1WF3 A;  3N54 B;  2P2Q A;  5IWA C;  3R9X A;  5A19 A;  4ZLP A;  5BST A;  2CU6 A;  5BSW A;  3RV2 A;  1PA4 A;  1JOS A;  2CY1 A;  4X65 C;  3KXW A;  5KEI A;  3VNQ A;  1M6X C;  4PUH A;  4G37 A;  2P2M A;  4LE5 A;  4DV0 C;  1XRB A;  5LMN C;  2Y4N A;  3GR0 A;  2ZZN A;  3FM7 A;  4I9G A;  1IBK C;  3NPD A;  4RM2 A;  1QM4 A;  2D1R A;  3PES A;  3CJE A;  4AQY C;  4DG9 A;  4JI8 C;  5BUS A;  4DCV A;  5AE2 A;  2ZZM A;  4X62 C;  1IBM C;  1PG4 A;  2VZE A;  1MDF A;  4DUY C;  4B3T C;  3G7S A;  3UOW A;  2VQE C;  1HH2 P;  2P02 A;  4JI3 C;  4DV4 C;  1NYE A;  5A1G A;  1USP A;  1V26 A;  5ADZ A;  3CW9 A;  2V7B A;  2QVY X;  1YJ7 A;  4G1I A;  2KZF A;  3TUF A;  3DLP X;  4R1L A;  5T8S A;  2F4V C;  4RVN A;  1AMU A;  1V25 A;  1T5D X;  2QL8 A;  5BSU A;  2Y4O A;  4JI4 C;  4JI0 C;  3R44 A;  3CQ1 A;  5BSV A;  4WV3 A;  4PZP A;  3N2Q A;  4JI6 C;  4DR3 C;  3IML A;  4GS5 A;  4LF9 C;  5LCI A;  2E5L C;  4OXI A;  3LNV A;  1PG3 A;  4JI1 C;  2M5O A;  1ZB8 A;  2KDN A;  4BBY A;  3NI2 A;  1LCI A;  4LFC C;  1VLA A;  2VSQ A;  1MKY A;  4LF8 C;  2PT7 G;  1YGT A;  2MM9 A;  4OYC A;  3DAY A;  1TH5 A;  4L4Q A;  1HNW C;  3SO4 A;  2PN2 A;  1P4E C;  3T1Y C;  1MXC A;  3E7W A;  3GKU A;  4BCA A;  4DV7 C;  4RLF A;  4PRO C;  5AE3 A;  2ASB A;  2E8C A;  1XMO C;  4ODJ A;  4RVO A;  3TR3 A;  3AF5 A;  4NDN A;  4DV6 C;  1MD9 A;  2YX1 A;  3L8C A;  4JM1 A;  4NXM C;  2PRO A;  4FTF A;  3PBK A;  3O2E A;  1XNQ C;  2UXB C;  4DCS A;  4EAT A;  4GXQ A;  4FUT A;  1USP B;  1L2F A;  5CZV A;  2EGT A;  2DPL A;  2P2F A;  2M5H A;  3GR1 A;  5GTD A;  1N2F A;  3EQ6 A;  4XX2 A;  2P2J A;  1QWI A;  4U5Y D;  3L95 X;  3UEB A;  3RG2 A;  1ZB9 A;  3C5E A;  3LUS A;  3UZ0 A;  4X64 C;  4YY3 C;  1HR0 C;  3TQI A;  1KKG A;  3JAM D;  2DYJ A;  4DR4 C;  3A4I A;  2D1Q A;  2PG1 E;  4HPV A;  1K0R A;  2UUC C;  4LF5 C;  4JI2 C;  4G36 A;  4YHH C;  2OPL A;  3A9V A;  5A2Q D;  4DV5 C;  5FLX D;  4BSZ A;  1ULT A;  2CXC A;  3H2T A;  5A1I A;  2UXD C;  5IT9 D;  1I94 C;  3DHV A;  4B3M C;  3R9W A;  2E7G A;  4DV3 C;  3T1H C;  5E7Q A;  2P2B A;  3I07 A;  2UXC C;  4FUQ A;  1XS3 A;  4JI7 C;  5K85 A;  2ONF A;  1MDB A;  3FCE A;  4B3S C;  4DCT A;  4IR7 A;  4R1M A;  4TPS B;  4JI5 C;  3VNR A;  3I08 A;  2JMP A;  2E8E A;  3NYR A;  3LGX A;  2D28 C;  3A9U A;  4RM3 A;  4GKK C;  5KYV A;  4K0K C;  4DV1 C;  4X66 C;  4L2Z A;  4DR1 C;  1NY8 A;  5LMU C;  1O90 A;  3ETC A;  4DR2 C;  4NXN C;  1ML8 A;  1N34 C;  2D1T A;  3K6R A;  1XHJ A;  5IFI A;  3J80 D;  1O92 A;  5CZX A;  4JV5 C;  1IBL C;  1HNX C;  3A26 A;  3IEU A;  3UX3 A;  4LF7 C;  1XRC A;  1PU1 A;  1N33 C;  4ZJZ A;  1WCJ A;  2HJG A;  1O93 A;  3EER A;  2Y27 A;  4D56 A;  2Z51 A;  4KTV A;  4KTT A;  1M6X A;  2UU9 C;  1MXB A;  4ISB A;  4LFB C;  2MMA B;  2QVZ X;  4RLQ A;  4PHT A;  3J81 D;  2OPL B;  5H9U A;  3PRO C;  3B7W A;  3FCC A;  4NOZ A;  4BC9 A;  3J7A D;  4JYA C;  2OBV A;  1V60 A;  2YWC A;  3AY0 A;  4R0M A;  4D57 A;  2YWB A;  2KZ0 A;  1XNR C;  4GKJ C;  1XRA A;  5BSR A;  1UKK A;  1P7L A;  5BUQ A;  4K0B A;  5KYT A;  2WP0 C;  4D4I A;  2QVX X;  4DUZ C;  2VQF C;  1MXA A;  4PUG A;  1EGA A;  3OTO C;  3GPC A;  4MH4 A;  2D7V A;  4LF4 C;  1BA3 A;  3NYQ A;  2DHM A;  4DR5 C;  4GXR A;  3LNO A;  4WS9 A;  2ZTB A;  1GPM A;  3A25 A; 
#chains in the Genus database with same CATH homology
 5JRH A;  3LAX A;  1O9T A;  2P20 A;  2D27 A;  5BSM A;  4D4G A;  3AF6 A;  3VNS A;  4KHP C;  4DV2 C;  1FJG C;  2QW0 X;  1T5H X;  4L7I A;  1J5E C;  3TDE A;  2WD9 A;  3ETO A;  1N32 C;  2XR1 A;  2YCB A;  2E8F A;  4OX9 C;  4DCU A;  4LFA C;  3CW8 X;  2E0G A;  2BH1 X;  3IPL A;  4IZ6 A;  3S82 A;  5K8F A;  2AYA A;  1WH9 A;  1FUG A;  2OO4 A;  5AE1 A;  2UUA C;  4RMN A;  5BR8 C;  2BJO A;  4DR6 C;  4B3R C;  1N36 C;  4I9F A;  1XMQ C;  1LQL A;  2ATW A;  1RY2 A;  5DV9 A;  5BUR A;  2UUB C;  5T8T A;  3E7X A;  2D1S A;  2ZM6 C;  4DR7 C;  1HNZ C;  1RG9 A;  4LF6 C;  4BC7 A;  4DG8 A;  2HHH C;  4MTN A;  3IEV A;  1WF3 A;  3N54 B;  2P2Q A;  5IWA C;  3R9X A;  5A19 A;  4ZLP A;  5BST A;  5BSW A;  3RV2 A;  1PA4 A;  1JOS A;  2CY1 A;  4X65 C;  3KXW A;  5KEI A;  3VNQ A;  4G37 A;  2P2M A;  4LE5 A;  4DV0 C;  1XRB A;  5LMN C;  2Y4N A;  3GR0 A;  4I9G A;  1IBK C;  3NPD A;  4RM2 A;  1QM4 A;  2D1R A;  3PES A;  3CJE A;  4AQY C;  4DG9 A;  4JI8 C;  5BUS A;  4DCV A;  5AE2 A;  4X62 C;  1IBM C;  1PG4 A;  2VZE A;  1MDF A;  4DUY C;  4B3T C;  3G7S A;  3UOW A;  2VQE C;  1HH2 P;  2P02 A;  4JI3 C;  4DV4 C;  1NYE A;  5A1G A;  1USP A;  1V26 A;  5ADZ A;  3CW9 A;  2V7B A;  2QVY X;  1YJ7 A;  4G1I A;  2KZF A;  3TUF A;  3DLP X;  4R1L A;  5T8S A;  2F4V C;  4RVN A;  1AMU A;  1V25 A;  1T5D X;  2QL8 A;  5BSU A;  2Y4O A;  4JI4 C;  4JI0 C;  3R44 A;  5BSV A;  4WV3 A;  4PZP A;  3N2Q A;  4JI6 C;  4DR3 C;  3IML A;  4GS5 A;  4LF9 C;  2E5L C;  4OXI A;  3LNV A;  1PG3 A;  4JI1 C;  1ZB8 A;  4BBY A;  3NI2 A;  1LCI A;  4LFC C;  1VLA A;  2VSQ A;  1MKY A;  4LF8 C;  2PT7 G;  4OYC A;  3DAY A;  1HNW C;  4L4Q A;  3SO4 A;  2PN2 A;  3T1Y C;  1MXC A;  3E7W A;  3GKU A;  4BCA A;  4DV7 C;  4RLF A;  4PRO C;  5AE3 A;  2ASB A;  2E8C A;  1XMO C;  4ODJ A;  4RVO A;  3AF5 A;  4NDN A;  4DV6 C;  1MD9 A;  3L8C A;  4JM1 A;  4NXM C;  2PRO A;  4FTF A;  3PBK A;  1XNQ C;  2UXB C;  4DCS A;  4EAT A;  4GXQ A;  4FUT A;  1USP B;  1L2F A;  5CZV A;  2EGT A;  2DPL A;  2P2F A;  3GR1 A;  5GTD A;  1N2F A;  3EQ6 A;  4XX2 A;  2P2J A;  1QWI A;  4U5Y D;  3L95 X;  3RG2 A;  1ZB9 A;  3C5E A;  3LUS A;  3UZ0 A;  4X64 C;  4YY3 C;  1HR0 C;  3TQI A;  1KKG A;  3JAM D;  2DYJ A;  4DR4 C;  3A4I A;  2D1Q A;  4HPV A;  1K0R A;  2UUC C;  4LF5 C;  4JI2 C;  4G36 A;  4DV5 C;  2OPL A;  3A9V A;  5A2Q D;  4YHH C;  5FLX D;  4BSZ A;  1ULT A;  2CXC A;  3H2T A;  5A1I A;  2UXD C;  5IT9 D;  1I94 C;  3DHV A;  4B3M C;  3R9W A;  2E7G A;  4DV3 C;  3T1H C;  5E7Q A;  2P2B A;  3I07 A;  2UXC C;  4FUQ A;  4JI7 C;  5K85 A;  2ONF A;  1MDB A;  3FCE A;  4B3S C;  4DCT A;  4IR7 A;  4R1M A;  4TPS B;  4JI5 C;  3VNR A;  3I08 A;  2JMP A;  2E8E A;  3NYR A;  3LGX A;  2D28 C;  3A9U A;  4RM3 A;  4GKK C;  5KYV A;  4K0K C;  4DV1 C;  4X66 C;  4L2Z A;  4DR1 C;  5LMU C;  1O90 A;  3ETC A;  4DR2 C;  4NXN C;  1ML8 A;  1N34 C;  2D1T A;  5IFI A;  3J80 D;  1O92 A;  5CZX A;  4JV5 C;  1IBL C;  1HNX C;  3IEU A;  4LF7 C;  1XRC A;  1N33 C;  4ZJZ A;  2HJG A;  1O93 A;  3EER A;  2Y27 A;  4D56 A;  4KTV A;  4KTT A;  2UU9 C;  1MXB A;  4ISB A;  4LFB C;  2QVZ X;  4RLQ A;  4PHT A;  3J81 D;  2OPL B;  5H9U A;  3PRO C;  3B7W A;  3FCC A;  4NOZ A;  4BC9 A;  3J7A D;  4JYA C;  2OBV A;  2YWC A;  4R0M A;  4D57 A;  2YWB A;  1XNR C;  4GKJ C;  1XRA A;  5BSR A;  1UKK A;  1P7L A;  5BUQ A;  4K0B A;  5KYT A;  2WP0 C;  4D4I A;  2QVX X;  4DUZ C;  2VQF C;  1MXA A;  1EGA A;  3OTO C;  3GPC A;  4MH4 A;  2D7V A;  4LF4 C;  1BA3 A;  3NYQ A;  4DR5 C;  4GXR A;  4WS9 A;  1GPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...