1HNWC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnwC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnwC02
1VLAA 4YHHC 3J81D 4K0KC 3AF5A 3OTOC 1N2FA 4B3MC 2CXCA 4DR7C 4B3TC 1UKKA 4JI8C 4JI6C 2ZM6C 1N34C 4B3RC 1IBKC 5BR8C 2UXBC 4JYAC 1USPA 1HR0C 2ONFA 1XNRC 4GKKC 4GKJC 4LF7C 4DCUA 2E8FA 5LMNC 3R9XA 3AF6A 4DCTA 2VQEC 4KHPC 2E8EA 1N33C 4NXNC 1LQLA 1L2FA 1WF3A 4JI0C 5LMUC 1JOSA 4OX9C 4NXMC 3T1YC 4LF6C 4DV1C 4DR3C 4JI7C 3T1HC 1J5EC 4DR4C 4DR2C 4DUYC 1IBMC 2UU9C 1XNQC 5FLXD 4DV2C 2KZFA 4DV7C 4JI1C 2PT7G 4NOZA 1ZB9A 1K0RA 4DCVA 4LF4C 1EGAA 4X62C 3JAMD 4DR5C 2UUBC 3J7AD 4LFCC 3J80D 2QL8A 3LUSA 5A2QD 4X65C 1USPB 2PN2A 4DV5C 1HNZC 1ML8A 2EGTA 4YY3C 2BJOA 4DV4C 4BSZA 4DV6C 1I94C 2HJGA 4LFAC 2UXDC 3I07A 4DR6C 4X64C 2JMPA 4JI2C 2YCBA 2HHHC 4JV5C 1IBLC 4DV0C 4DR1C 2UUAC 1NYEA 1FJGC 4JI5C 2F4VC 4JI4C 4LF9C 1XMOC 4B3SC 2UUCC 2CY1A 2OPLA 1HNXC 2E8CA 1QWIA 4LFBC 5IT9D 1N36C 1HNWC 1PA4A 2XR1A 1KKGA 4LF5C 4DCSA 1MKYA 5IWAC 3IEUA 2VQFC 4DUZC 4X66C 2UXCC 4LF8C 4JI3C 2E5LC 2ATWA 1HH2P 2DYJA 2OPLB 3CJEA 3EERA 3GKUA 4MTNA 2E7GA 2D7VA 1XMQC 3IEVA 1ZB8A 4AQYC 1N32C 1WH9A 4XX2A 3R9WA 4DV3C 2ASBA 4MH4A
chains in the Genus database with same CATH superfamily
4PHTA 4RVNA 4YHHC 2PROA 1N2FA 2VSQA 4B3TC 1UKKA 4BC9A 1HR0C 2ONFA 4GKKC 4GKJC 5AE2A 4DCUA 1YJ7A 3ETCA 3AF6A 2PG1E 5DV9A 1N33C 5T8SA 4IZ6A 1WF3A 3L95X 1MXBA 2P2JA 2Z51A 4OX9C 5BSVA 1IB8A 2YX1A 1XDXA 5BSMA 3B7WA 4DV1C 4R1LA 1LCIA 1J5EC 4PUGA 4DR2C 2UU9C 4G1IA 3DAYA 2KZFA 1WCJA 5AE3A 4LF4C 5A1IA 4LFCC 3J80D 3CW9A 4X65C 3LGXA 1USPB 5BSUA 5KEIA 3RV2A 2ZTBA 1V25A 2Y4NA 2V7BA 2EGTA 2BJOA 4DV6C 1I94C 2HJGA 2JMPA 4JV5C 4WS9A 2MMAB 4BBYA 1FJGC 4JI5C 3E7XA 2F4VC 4KTTA 3UOWA 4B3SC 3FM7A 2UUCC 2CY1A 1O92A 2OPLA 5IT9D 4RVOA 4DCSA 1MKYA 2DHMA 2UXCC 4X66C 2DYJA 1T5HX 3CJEA 3EERA 4D4GA 2D27A 4PUHA 5K85A 1XMQC 1ZB8A 4XX2A 4DV3C 3N54B 2AYAA 1NY8A 3R44A 4GS5A 3N2QA 4OXIA 4D56A 5GTDA 3CQ2A 2CXCA 4DR7C 4JI6C 2VZEA 1PU1A 4BCAA 1IBKC 4JYAC 3FCCA 1MDFA 4JM1A 1XNRC 4LF7C 4EATA 3VNQA 4RLFA 2E8FA 3CQ1A 4PUIA 1XRCA 4BC7A 2VQEC 2E8EA 1O9TA 3NPDA 1MXAA 4FTFA 1MD9A 4R1MA 4TPSB 1JOSA 4NXMC 5KYTA 2YWBA 4I9FA 4JI7C 4DR4C 4DUYC 1IBMC 1RG9A 5FLXD 4DV2C 4DV7C 4JI1C 4ODJA 4RLQA 1ZB9A 4IR7A 1K0RA 4DCVA 1T5DX 4RMNA 1VEHA 5ADZA 1ULTA 2P2FA 3LUSA 3EQ6A 4DV5C 3IMLA 1XS3A 2D1QA 3A9VA 4YY3C 1YGTA 1O93A 2YWCA 2UXDC 3I07A 4DR6C 4JI2C 1V26A 2HHHC 1IBLC 1UWDA 2OO4A 1O90A 5A19A 1XRAA 3DLPX 1HNXC 2E8CA 4LFBC 3TQIA 1N36C 1MDBA 1PG4A 3IEUA 3L8CA 2E5LC 1HH2P 2D28C 3A26A 4GXRA 4LE5A 4R0MA 4MTNA 2QW0X 2E7GA 4K0BA 3GR0A 5K8FA 3UX2A 1WH9A 4G36A 3R9WA 1TH5A 1P4EA 3E7WA 5AE1A 4K0KC 5T8TA 2KDNA 3TR3A 4DG8A 2ZM6C 1N34C 4B3RC 3H2TA 4L7IA 1USPA 2M5HA 4D57A 4FUQA 2JNVA 2D1TA 2WP0C 2MCQA 4KHPC 2Y27A 3UZ0A 4NXNC 1GPMA 4RM2A 3G7SA 4JI0C 2OBVA 3T1YC 2M5OA 3S82A 4DR3C 3PROC 3T1HC 2BH1X 5KYVA 2PT7G 2DPLA 4ZLPA 3VNRA 5CZXA 5CZVA 4DG9A 4PZPA 1EGAA 3GR1A 4X62C 4DR5C 2UUBC 2QL8A 5A2QD 3NI2A 1P7LA 4L2ZA 5JRHA 4KTVA 5LCIA 1PG3A 2QVXX 4LFAC 5BSRA 2P02A 1P4EC 2YCBA 3I08A 4DV0C 4DR1C 1BA3A 2UUAC 4RM3A 1NYEA 4ISBA 4JI4C 4LF9C 2KZ0A 2NCLA 3NYQA 4FUTA 4D4IA 1QWIA 1HNWC 3NYRA 1KKGA 4I9GA 1XRBA 4LF5C 4ZJZA 2VQFC 4JI3C 1M6XA 3GKUA 5BSWA 3GPCA 1MXCA 4L4QA 1VLAA 3J81D 3AF5A 3OTOC 2E0GA 4B3MC 3DHVA 3LNVA 4JI8C 1FLOA 5BR8C 2UXBC 3O2EA 3LAXA 2QVZX 5H9UA 2Y4OA 3CQ3A 2P20A 5A1GA 5LMNC 3R9XA 2P2QA 4DCTA 4HPVA 3PBKA 1LQLA 1L2FA 3CW8X 1RY2A 5LMUC 3VNSA 1V60A 1FUGA 3A4IA 4LF6C 3FCEA 1XNQC 3UX3A 4U5YD 3C5EA 5BURA 2WD9A 3LNOA 4G37A 4NOZA 4PROC 3UEBA 3AY0A 3SO4A 5BSTA 5IFIA 5E7QA 3RG2A 3JAMD 4GXQA 3J7AD 3IPLA 2ZZNA 2PN2A 1M6XC 1HNZC 2CU6A 3TUFA 1XHJA 1QM4A 1ML8A 2MM9A 3TDEA 4DV4C 4BSZA 4X64C 2D1RA 3ETOA 2P2BA 4WV3A 1XMOC 3A25A 1AMUA 1PA4A 2XR1A 3A9UA 5BUSA 5IWAC 4DUZC 3K6RA 4LF8C 2D1SA 4OYCA 2ATWA 2OPLB 2P2MA 2D7VA 2ZZMA 4AQYC 3IEVA 5BUQA 1N32C 4NDNA 3PESA 2ASBA 4MH4A 2QVYX 3KXWA
chains in the Genus database with same CATH topology
4PHTA 4RVNA 4YHHC 2PROA 1N2FA 2VSQA 4B3TC 1UKKA 4BC9A 1HR0C 2ONFA 4GKKC 4GKJC 5AE2A 4DCUA 1YJ7A 3ETCA 3AF6A 5DV9A 1N33C 5T8SA 4IZ6A 1WF3A 3L95X 1MXBA 2P2JA 4OX9C 5BSVA 5BSMA 3B7WA 4DV1C 4R1LA 1LCIA 1J5EC 4DR2C 2UU9C 4G1IA 3DAYA 2KZFA 5AE3A 4LF4C 5A1IA 4LFCC 3J80D 3CW9A 4X65C 3LGXA 1USPB 5BSUA 5KEIA 3RV2A 1V25A 2Y4NA 2V7BA 2EGTA 2BJOA 4DV6C 1I94C 2HJGA 2JMPA 4JV5C 4WS9A 4BBYA 1FJGC 4JI5C 3E7XA 2F4VC 4KTTA 3UOWA 4B3SC 2UUCC 2CY1A 1O92A 2OPLA 5IT9D 4RVOA 4DCSA 1MKYA 2UXCC 4X66C 2DYJA 1T5HX 3CJEA 3EERA 4D4GA 2D27A 5K85A 1XMQC 1ZB8A 4XX2A 4DV3C 3N54B 2AYAA 3R44A 4GS5A 3N2QA 4OXIA 4D56A 5GTDA 2CXCA 4DR7C 4JI6C 2VZEA 4BCAA 1IBKC 4JYAC 3FCCA 1MDFA 4JM1A 1XNRC 4LF7C 4EATA 3VNQA 4RLFA 2E8FA 1XRCA 4BC7A 2VQEC 2E8EA 1O9TA 3NPDA 1MXAA 4FTFA 1MD9A 4R1MA 4TPSB 1JOSA 4NXMC 5KYTA 2YWBA 4I9FA 4JI7C 4DR4C 4DUYC 1IBMC 1RG9A 5FLXD 4DV2C 4DV7C 4JI1C 4ODJA 4RLQA 1ZB9A 4IR7A 1K0RA 4DCVA 1T5DX 4RMNA 5ADZA 1ULTA 2P2FA 3LUSA 3EQ6A 4DV5C 3IMLA 2D1QA 3A9VA 4YY3C 1O93A 2YWCA 2UXDC 3I07A 4DR6C 4JI2C 1V26A 2HHHC 1IBLC 2OO4A 1O90A 5A19A 1XRAA 3DLPX 1HNXC 2E8CA 4LFBC 3TQIA 1N36C 1MDBA 1PG4A 3IEUA 3L8CA 2E5LC 1HH2P 2D28C 4GXRA 4LE5A 4R0MA 4MTNA 2QW0X 2E7GA 4K0BA 3GR0A 5K8FA 1WH9A 4G36A 3R9WA 3E7WA 5AE1A 4K0KC 5T8TA 4DG8A 2ZM6C 1N34C 4B3RC 3H2TA 4L7IA 1USPA 4D57A 4FUQA 2D1TA 2WP0C 4KHPC 2Y27A 3UZ0A 4NXNC 1GPMA 4RM2A 3G7SA 4JI0C 2OBVA 3T1YC 3S82A 4DR3C 3PROC 3T1HC 2BH1X 5KYVA 2PT7G 2DPLA 3VNRA 4ZLPA 5CZXA 5CZVA 4DG9A 4PZPA 1EGAA 3GR1A 4X62C 4DR5C 2UUBC 2QL8A 5A2QD 3NI2A 1P7LA 4L2ZA 5JRHA 4KTVA 1PG3A 2QVXX 4LFAC 5BSRA 2P02A 2YCBA 3I08A 4DV0C 4DR1C 1BA3A 2UUAC 4RM3A 1NYEA 4ISBA 4JI4C 4LF9C 4FUTA 3NYQA 4D4IA 1QWIA 1HNWC 3NYRA 1KKGA 4I9GA 1XRBA 4LF5C 4ZJZA 2VQFC 4JI3C 3GKUA 5BSWA 3GPCA 1MXCA 4L4QA 1VLAA 3J81D 3AF5A 3OTOC 2E0GA 4B3MC 3DHVA 3LNVA 4JI8C 5BR8C 2UXBC 3LAXA 2QVZX 5H9UA 2Y4OA 2P20A 5A1GA 5LMNC 3R9XA 2P2QA 4DCTA 4HPVA 3PBKA 1LQLA 1L2FA 3CW8X 1RY2A 5LMUC 3VNSA 1FUGA 3A4IA 4LF6C 3FCEA 1XNQC 4U5YD 3C5EA 5BURA 2WD9A 4G37A 4NOZA 4PROC 3SO4A 5BSTA 5IFIA 5E7QA 3RG2A 3JAMD 4GXQA 3J7AD 3IPLA 2PN2A 1HNZC 3TUFA 1QM4A 1ML8A 3TDEA 4DV4C 4BSZA 4X64C 2D1RA 3ETOA 2P2BA 4WV3A 1XMOC 1AMUA 1PA4A 2XR1A 3A9UA 5BUSA 5IWAC 4DUZC 4LF8C 2D1SA 4OYCA 2ATWA 2OPLB 2P2MA 2D7VA 3IEVA 4AQYC 5BUQA 1N32C 4NDNA 3PESA 2ASBA 4MH4A 2QVYX 3KXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  4YHH C;  3J81 D;  4K0K C;  3AF5 A;  3OTO C;  1N2F A;  4B3M C;  2CXC A;  4DR7 C;  4B3T C;  1UKK A;  4JI8 C;  4JI6 C;  2ZM6 C;  1N34 C;  4B3R C;  1IBK C;  5BR8 C;  2UXB C;  4JYA C;  1USP A;  1HR0 C;  2ONF A;  1XNR C;  4GKK C;  4GKJ C;  4LF7 C;  4DCU A;  2E8F A;  5LMN C;  3R9X A;  3AF6 A;  4DCT A;  2VQE C;  4KHP C;  2E8E A;  1N33 C;  4NXN C;  1LQL A;  1L2F A;  1WF3 A;  4JI0 C;  5LMU C;  1JOS A;  4OX9 C;  4NXM C;  3T1Y C;  4LF6 C;  4DV1 C;  4DR3 C;  4JI7 C;  3T1H C;  1J5E C;  4DR4 C;  4DR2 C;  4DUY C;  1IBM C;  2UU9 C;  1XNQ C;  5FLX D;  4DV2 C;  2KZF A;  4DV7 C;  4JI1 C;  2PT7 G;  4NOZ A;  1ZB9 A;  1K0R A;  4DCV A;  4LF4 C;  1EGA A;  4X62 C;  3JAM D;  4DR5 C;  2UUB C;  3J7A D;  4LFC C;  3J80 D;  2QL8 A;  3LUS A;  5A2Q D;  4X65 C;  1USP B;  2PN2 A;  4DV5 C;  1HNZ C;  1ML8 A;  2EGT A;  4YY3 C;  2BJO A;  4DV4 C;  4BSZ A;  4DV6 C;  1I94 C;  2HJG A;  4LFA C;  2UXD C;  3I07 A;  4DR6 C;  4X64 C;  2JMP A;  4JI2 C;  2YCB A;  2HHH C;  4JV5 C;  1IBL C;  4DV0 C;  4DR1 C;  2UUA C;  1NYE A;  1FJG C;  4JI5 C;  2F4V C;  4JI4 C;  4LF9 C;  1XMO C;  4B3S C;  2UUC C;  2CY1 A;  2OPL A;  1HNX C;  2E8C A;  1QWI A;  4LFB C;  5IT9 D;  1N36 C;  1HNW C;  1PA4 A;  2XR1 A;  1KKG A;  4LF5 C;  4DCS A;  1MKY A;  5IWA C;  3IEU A;  2VQF C;  4DUZ C;  4X66 C;  2UXC C;  4LF8 C;  4JI3 C;  2E5L C;  2ATW A;  1HH2 P;  2DYJ A;  2OPL B;  3CJE A;  3EER A;  3GKU A;  4MTN A;  2E7G A;  2D7V A;  1XMQ C;  3IEV A;  1ZB8 A;  4AQY C;  1N32 C;  1WH9 A;  4XX2 A;  3R9W A;  4DV3 C;  2ASB A;  4MH4 A; 
#chains in the Genus database with same CATH topology
 4PHT A;  4RVN A;  4YHH C;  2PRO A;  1N2F A;  2VSQ A;  4B3T C;  1UKK A;  4BC9 A;  1HR0 C;  2ONF A;  4GKK C;  4GKJ C;  5AE2 A;  4DCU A;  1YJ7 A;  3ETC A;  3AF6 A;  2PG1 E;  5DV9 A;  1N33 C;  5T8S A;  4IZ6 A;  1WF3 A;  3L95 X;  1MXB A;  2P2J A;  2Z51 A;  4OX9 C;  5BSV A;  1IB8 A;  2YX1 A;  1XDX A;  5BSM A;  3B7W A;  4DV1 C;  4R1L A;  1LCI A;  1J5E C;  4PUG A;  4DR2 C;  2UU9 C;  4G1I A;  3DAY A;  2KZF A;  1WCJ A;  5AE3 A;  4LF4 C;  5A1I A;  4LFC C;  3J80 D;  3CW9 A;  4X65 C;  3LGX A;  1USP B;  5BSU A;  5KEI A;  3RV2 A;  2ZTB A;  1V25 A;  2Y4N A;  2V7B A;  2EGT A;  2BJO A;  4DV6 C;  1I94 C;  2HJG A;  2JMP A;  4JV5 C;  4WS9 A;  2MMA B;  4BBY A;  1FJG C;  4JI5 C;  3E7X A;  2F4V C;  4KTT A;  3UOW A;  4B3S C;  3FM7 A;  2UUC C;  2CY1 A;  1O92 A;  2OPL A;  5IT9 D;  4RVO A;  4DCS A;  1MKY A;  2DHM A;  2UXC C;  4X66 C;  2DYJ A;  1T5H X;  3CJE A;  3EER A;  4D4G A;  2D27 A;  4PUH A;  5K85 A;  1XMQ C;  1ZB8 A;  4XX2 A;  4DV3 C;  3N54 B;  2AYA A;  1NY8 A;  3R44 A;  4GS5 A;  3N2Q A;  4OXI A;  4D56 A;  5GTD A;  3CQ2 A;  2CXC A;  4DR7 C;  4JI6 C;  2VZE A;  1PU1 A;  4BCA A;  1IBK C;  4JYA C;  3FCC A;  1MDF A;  4JM1 A;  1XNR C;  4LF7 C;  4EAT A;  3VNQ A;  4RLF A;  2E8F A;  3CQ1 A;  4PUI A;  1XRC A;  4BC7 A;  2VQE C;  2E8E A;  1O9T A;  3NPD A;  1MXA A;  4FTF A;  1MD9 A;  4R1M A;  4TPS B;  1JOS A;  4NXM C;  5KYT A;  2YWB A;  4I9F A;  4JI7 C;  4DR4 C;  4DUY C;  1IBM C;  1RG9 A;  5FLX D;  4DV2 C;  4DV7 C;  4JI1 C;  4ODJ A;  4RLQ A;  1ZB9 A;  4IR7 A;  1K0R A;  4DCV A;  1T5D X;  4RMN A;  1VEH A;  5ADZ A;  1ULT A;  2P2F A;  3LUS A;  3EQ6 A;  4DV5 C;  3IML A;  1XS3 A;  2D1Q A;  3A9V A;  4YY3 C;  1YGT A;  1O93 A;  2YWC A;  2UXD C;  3I07 A;  4DR6 C;  4JI2 C;  1V26 A;  2HHH C;  1IBL C;  1UWD A;  2OO4 A;  1O90 A;  5A19 A;  1XRA A;  3DLP X;  1HNX C;  2E8C A;  4LFB C;  3TQI A;  1N36 C;  1MDB A;  1PG4 A;  3IEU A;  3L8C A;  2E5L C;  1HH2 P;  2D28 C;  3A26 A;  4GXR A;  4LE5 A;  4R0M A;  4MTN A;  2QW0 X;  2E7G A;  4K0B A;  3GR0 A;  5K8F A;  3UX2 A;  1WH9 A;  4G36 A;  3R9W A;  1TH5 A;  1P4E A;  3E7W A;  5AE1 A;  4K0K C;  5T8T A;  2KDN A;  3TR3 A;  4DG8 A;  2ZM6 C;  1N34 C;  4B3R C;  3H2T A;  4L7I A;  1USP A;  2M5H A;  4D57 A;  4FUQ A;  2JNV A;  2D1T A;  2WP0 C;  2MCQ A;  4KHP C;  2Y27 A;  3UZ0 A;  4NXN C;  1GPM A;  4RM2 A;  3G7S A;  4JI0 C;  2OBV A;  3T1Y C;  2M5O A;  3S82 A;  4DR3 C;  3PRO C;  3T1H C;  2BH1 X;  5KYV A;  2PT7 G;  2DPL A;  4ZLP A;  3VNR A;  5CZX A;  5CZV A;  4DG9 A;  4PZP A;  1EGA A;  3GR1 A;  4X62 C;  4DR5 C;  2UUB C;  2QL8 A;  5A2Q D;  3NI2 A;  1P7L A;  4L2Z A;  5JRH A;  4KTV A;  5LCI A;  1PG3 A;  2QVX X;  4LFA C;  5BSR A;  2P02 A;  1P4E C;  2YCB A;  3I08 A;  4DV0 C;  4DR1 C;  1BA3 A;  2UUA C;  4RM3 A;  1NYE A;  4ISB A;  4JI4 C;  4LF9 C;  2KZ0 A;  2NCL A;  3NYQ A;  4FUT A;  4D4I A;  1QWI A;  1HNW C;  3NYR A;  1KKG A;  4I9G A;  1XRB A;  4LF5 C;  4ZJZ A;  2VQF C;  4JI3 C;  1M6X A;  3GKU A;  5BSW A;  3GPC A;  1MXC A;  4L4Q A;  1VLA A;  3J81 D;  3AF5 A;  3OTO C;  2E0G A;  4B3M C;  3DHV A;  3LNV A;  4JI8 C;  1FLO A;  5BR8 C;  2UXB C;  3O2E A;  3LAX A;  2QVZ X;  5H9U A;  2Y4O A;  3CQ3 A;  2P20 A;  5A1G A;  5LMN C;  3R9X A;  2P2Q A;  4DCT A;  4HPV A;  3PBK A;  1LQL A;  1L2F A;  3CW8 X;  1RY2 A;  5LMU C;  3VNS A;  1V60 A;  1FUG A;  3A4I A;  4LF6 C;  3FCE A;  1XNQ C;  3UX3 A;  4U5Y D;  3C5E A;  5BUR A;  2WD9 A;  3LNO A;  4G37 A;  4NOZ A;  4PRO C;  3UEB A;  3AY0 A;  3SO4 A;  5BST A;  5IFI A;  5E7Q A;  3RG2 A;  3JAM D;  4GXQ A;  3J7A D;  3IPL A;  2ZZN A;  2PN2 A;  1M6X C;  1HNZ C;  2CU6 A;  3TUF A;  1XHJ A;  1QM4 A;  1ML8 A;  2MM9 A;  3TDE A;  4DV4 C;  4BSZ A;  4X64 C;  2D1R A;  3ETO A;  2P2B A;  4WV3 A;  1XMO C;  3A25 A;  1AMU A;  1PA4 A;  2XR1 A;  3A9U A;  5BUS A;  5IWA C;  4DUZ C;  3K6R A;  4LF8 C;  2D1S A;  4OYC A;  2ATW A;  2OPL B;  2P2M A;  2D7V A;  2ZZM A;  4AQY C;  3IEV A;  5BUQ A;  1N32 C;  4NDN A;  3PES A;  2ASB A;  4MH4 A;  2QVY X;  3KXW A; 
#chains in the Genus database with same CATH homology
 4PHT A;  4RVN A;  4YHH C;  2PRO A;  1N2F A;  2VSQ A;  4B3T C;  1UKK A;  4BC9 A;  1HR0 C;  2ONF A;  4GKK C;  4GKJ C;  5AE2 A;  4DCU A;  1YJ7 A;  3ETC A;  3AF6 A;  5DV9 A;  1N33 C;  5T8S A;  4IZ6 A;  1WF3 A;  3L95 X;  1MXB A;  2P2J A;  4OX9 C;  5BSV A;  5BSM A;  3B7W A;  4DV1 C;  4R1L A;  1LCI A;  1J5E C;  4DR2 C;  2UU9 C;  4G1I A;  3DAY A;  2KZF A;  5AE3 A;  4LF4 C;  5A1I A;  4LFC C;  3J80 D;  3CW9 A;  4X65 C;  3LGX A;  1USP B;  5BSU A;  5KEI A;  3RV2 A;  1V25 A;  2Y4N A;  2V7B A;  2EGT A;  2BJO A;  4DV6 C;  1I94 C;  2HJG A;  2JMP A;  4JV5 C;  4WS9 A;  4BBY A;  1FJG C;  4JI5 C;  3E7X A;  2F4V C;  4KTT A;  3UOW A;  4B3S C;  2UUC C;  2CY1 A;  1O92 A;  2OPL A;  5IT9 D;  4RVO A;  4DCS A;  1MKY A;  2UXC C;  4X66 C;  2DYJ A;  1T5H X;  3CJE A;  3EER A;  4D4G A;  2D27 A;  5K85 A;  1XMQ C;  1ZB8 A;  4XX2 A;  4DV3 C;  3N54 B;  2AYA A;  3R44 A;  4GS5 A;  3N2Q A;  4OXI A;  4D56 A;  5GTD A;  2CXC A;  4DR7 C;  4JI6 C;  2VZE A;  4BCA A;  1IBK C;  4JYA C;  3FCC A;  1MDF A;  4JM1 A;  1XNR C;  4LF7 C;  4EAT A;  3VNQ A;  4RLF A;  2E8F A;  1XRC A;  4BC7 A;  2VQE C;  2E8E A;  1O9T A;  3NPD A;  1MXA A;  4FTF A;  1MD9 A;  4R1M A;  4TPS B;  1JOS A;  4NXM C;  5KYT A;  2YWB A;  4I9F A;  4JI7 C;  4DR4 C;  4DUY C;  1IBM C;  1RG9 A;  5FLX D;  4DV2 C;  4DV7 C;  4JI1 C;  4ODJ A;  4RLQ A;  1ZB9 A;  4IR7 A;  1K0R A;  4DCV A;  1T5D X;  4RMN A;  5ADZ A;  1ULT A;  2P2F A;  3LUS A;  3EQ6 A;  4DV5 C;  3IML A;  2D1Q A;  3A9V A;  4YY3 C;  1O93 A;  2YWC A;  2UXD C;  3I07 A;  4DR6 C;  4JI2 C;  1V26 A;  2HHH C;  1IBL C;  2OO4 A;  1O90 A;  5A19 A;  1XRA A;  3DLP X;  1HNX C;  2E8C A;  4LFB C;  3TQI A;  1N36 C;  1MDB A;  1PG4 A;  3IEU A;  3L8C A;  2E5L C;  1HH2 P;  2D28 C;  4GXR A;  4LE5 A;  4R0M A;  4MTN A;  2QW0 X;  2E7G A;  4K0B A;  3GR0 A;  5K8F A;  1WH9 A;  4G36 A;  3R9W A;  3E7W A;  5AE1 A;  4K0K C;  5T8T A;  4DG8 A;  2ZM6 C;  1N34 C;  4B3R C;  3H2T A;  4L7I A;  1USP A;  4D57 A;  4FUQ A;  2D1T A;  2WP0 C;  4KHP C;  2Y27 A;  3UZ0 A;  4NXN C;  1GPM A;  4RM2 A;  3G7S A;  4JI0 C;  2OBV A;  3T1Y C;  3S82 A;  4DR3 C;  3PRO C;  3T1H C;  2BH1 X;  5KYV A;  2PT7 G;  2DPL A;  3VNR A;  4ZLP A;  5CZX A;  5CZV A;  4DG9 A;  4PZP A;  1EGA A;  3GR1 A;  4X62 C;  4DR5 C;  2UUB C;  2QL8 A;  5A2Q D;  3NI2 A;  1P7L A;  4L2Z A;  5JRH A;  4KTV A;  1PG3 A;  2QVX X;  4LFA C;  5BSR A;  2P02 A;  2YCB A;  3I08 A;  4DV0 C;  4DR1 C;  1BA3 A;  2UUA C;  4RM3 A;  1NYE A;  4ISB A;  4JI4 C;  4LF9 C;  4FUT A;  3NYQ A;  4D4I A;  1QWI A;  1HNW C;  3NYR A;  1KKG A;  4I9G A;  1XRB A;  4LF5 C;  4ZJZ A;  2VQF C;  4JI3 C;  3GKU A;  5BSW A;  3GPC A;  1MXC A;  4L4Q A;  1VLA A;  3J81 D;  3AF5 A;  3OTO C;  2E0G A;  4B3M C;  3DHV A;  3LNV A;  4JI8 C;  5BR8 C;  2UXB C;  3LAX A;  2QVZ X;  5H9U A;  2Y4O A;  2P20 A;  5A1G A;  5LMN C;  3R9X A;  2P2Q A;  4DCT A;  4HPV A;  3PBK A;  1LQL A;  1L2F A;  3CW8 X;  1RY2 A;  5LMU C;  3VNS A;  1FUG A;  3A4I A;  4LF6 C;  3FCE A;  1XNQ C;  4U5Y D;  3C5E A;  5BUR A;  2WD9 A;  4G37 A;  4NOZ A;  4PRO C;  3SO4 A;  5BST A;  5IFI A;  5E7Q A;  3RG2 A;  3JAM D;  4GXQ A;  3J7A D;  3IPL A;  2PN2 A;  1HNZ C;  3TUF A;  1QM4 A;  1ML8 A;  3TDE A;  4DV4 C;  4BSZ A;  4X64 C;  2D1R A;  3ETO A;  2P2B A;  4WV3 A;  1XMO C;  1AMU A;  1PA4 A;  2XR1 A;  3A9U A;  5BUS A;  5IWA C;  4DUZ C;  4LF8 C;  2D1S A;  4OYC A;  2ATW A;  2OPL B;  2P2M A;  2D7V A;  3IEV A;  4AQY C;  5BUQ A;  1N32 C;  4NDN A;  3PES A;  2ASB A;  4MH4 A;  2QVY X;  3KXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...