1HNWC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnwC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnwC02
1XNRC 4DR2C 4X62C 2ASBA 1IBMC 5LMUC 4DR6C 2UXBC 2F4VC 3LUSA 3JAMD 4JI3C 4JI1C 2YCBA 1HNZC 1WF3A 4MH4A 4LF9C 1LQLA 4B3RC 4JI0C 1HR0C 3OTOC 1KKGA 2KZFA 3EERA 4JI2C 1QWIA 1N36C 1XMQC 1ZB9A 2DYJA 2EGTA 1PA4A 2D7VA 2QL8A 3IEVA 4DR3C 2VQFC 3R9XA 2UXCC 2ZM6C 4XX2A 2HHHC 1USPA 2PT7G 4LF8C 2E8EA 3AF5A 1J5EC 2E8CA 4DV7C 1USPB 3R9WA 4B3SC 4DV4C 4DV3C 4B3MC 4K0KC 4X66C 4GKJC 2UUAC 5IT9D 1ML8A 1N32C 1EGAA 1XNQC 2CY1A 4DUYC 1HNXC 3IEUA 4DV2C 4DR5C 3AF6A 2E8FA 4LF7C 1UKKA 1N34C 4GKKC 3J80D 2E7GA 5LMNC 4DV1C 4JI5C 4YY3C 4KHPC 2ONFA 2UU9C 4JI4C 3GKUA 4DV0C 4DR4C 3I07A 4DCVA 4AQYC 1K0RA 2JMPA 2BJOA 4DV5C 4LFCC 4NOZA 4DCSA 4YHHC 5IWAC 4DUZC 1HH2P 2XR1A 1IBKC 2HJGA 1N33C 2UUCC 4DCTA 2VQEC 4DR7C 4LF5C 2UXDC 1JOSA 4JI6C 5A2QD 5BR8C 3J7AD 1N2FA 1WH9A 1I94C 5FLXD 3CJEA 4NXMC 4MTNA 1XMOC 1HNWC 1ZB8A 2ATWA 4LFBC 4LF6C 4JI8C 4X65C 4JV5C 4BSZA 1VLAA 2E5LC 2UUBC 4JI7C 1NYEA 4LFAC 4LF4C 2CXCA 2OPLB 3J81D 4B3TC 1IBLC 4NXNC 3T1YC 4JYAC 4DCUA 4OX9C 2PN2A 4X64C 1MKYA 4DV6C 4DR1C 3T1HC 1FJGC 2OPLA 1L2FA
chains in the Genus database with same CATH superfamily
1MXCA 3DLPX 4X62C 4KTTA 1IBMC 3L8CA 3K6RA 4EATA 5CZVA 1YJ7A 2YCBA 1WF3A 4FUTA 3EERA 2P2MA 1V25A 4BBYA 1XMQC 3GPCA 1T5HX 1PA4A 2QL8A 3CQ1A 4R0MA 4KTVA 5K8FA 2D1RA 2P2BA 2HHHC 4I9GA 4L4QA 4LF8C 2E8EA 3AF5A 1O93A 3N54B 4IZ6A 3TR3A 4B3SC 4DV3C 4K0KC 4DG8A 2KDNA 2M5HA 1V60A 2OBVA 4RM3A 4DUYC 3N2QA 5E7QA 3AF6A 5T8TA 1MD9A 4HPVA 4DV1C 4JI5C 4YY3C 5BSMA 4WV3A 3GKUA 1XRAA 2D1SA 1M6XA 3I07A 5BSVA 1RY2A 5BUSA 2BJOA 4BC9A 3PROC 4D57A 1XRBA 5IWAC 5BURA 2XR1A 3EQ6A 1P4EA 4G37A 2VQEC 3NYQA 4JI6C 1P4EC 5BSRA 5BR8C 1N2FA 3SO4A 3VNRA 2DPLA 2YX1A 3L95X 4LF6C 1O9TA 4JI8C 3TDEA 2P2QA 5BSWA 3AY0A 3LGXA 5CZXA 1PU1A 4NXNC 4JYAC 4NDNA 4DV6C 3T1HC 1FJGC 4PUHA 3NI2A 1XNRC 2ZTBA 4DR6C 2ZZMA 2YWCA 2F4VC 3E7XA 5KYTA 1HR0C 1AMUA 3OTOC 2PROA 1QWIA 3CW9A 1FUGA 4ISBA 3O2EA 3RG2A 2EGTA 2M5OA 4D4IA 5BSTA 5DV9A 3R9XA 5GTDA 4XX2A 3TUFA 2PT7G 3B7WA 1J5EC 4DV7C 1USPB 2WD9A 5AE3A 4DV4C 4B3MC 4X66C 3C5EA 4GKJC 2PG1E 3UZ0A 5IT9D 1XNQC 2QVZX 2JNVA 3FCEA 4RVNA 2E8FA 1V26A 1PG4A 3VNSA 3CQ2A 1O92A 4DV0C 4PZPA 4L2ZA 3IMLA 2QW0X 3UX2A 4DG9A 4DV5C 1RG9A 4FTFA 4GS5A 4DUZC 3FCCA 5H9UA 2KZ0A 3UX3A 2V7BA 4LE5A 4OXIA 4DCTA 2D1QA 4LF5C 3UEBA 5A2QD 1I94C 5KYVA 3CJEA 1XRCA 2P20A 5AE2A 4NXMC 3A9VA 3I08A 1HNWC 1ZB8A 4LFBC 4U5YD 4BSZA 2YWBA 1VLAA 1MDFA 3TQIA 3DAYA 1NYEA 4LFAC 2AYAA 2OPLB 1XHJA 1IBLC 3T1YC 4X64C 4DR1C 4BCAA 1L2FA 4RLFA 3R44A 4PUIA 4JI3C 3G7SA 4JI1C 1WCJA 1HNZC 4MH4A 4LF9C 3A9UA 4B3RC 4RMNA 1M6XC 3H2TA 4JI2C 3UOWA 4R1MA 4G1IA 5BSUA 3PESA 1N36C 1MXAA 3A4IA 2D7VA 2Y4NA 2MCQA 3NYRA 2P02A 3A26A 2ZM6C 4RLQA 5A19A 3NPDA 1XDXA 4D56A 2QVXX 1N32C 1ML8A 5K85A 3IEUA 4RM2A 4G36A 2VZEA 1N34C 2E7GA 4WS9A 3FM7A 5BUQA 2MM9A 2VSQA 2D27A 4DCVA 2MMAB 4AQYC 1K0RA 2JMPA 1UWDA 1ULTA 3GR1A 3E7WA 2UUCC 4GXQA 1BA3A 4GXRA 3PBKA 5T8SA 4ZJZA 2UXDC 2QVYX 3J7AD 1WH9A 5FLXD 3IPLA 1XMOC 2P2FA 4JV5C 4X65C 4RVOA 2E5LC 1YGTA 2NCLA 3KXWA 3J81D 4B3TC 1FLOA 5LCIA 1MKYA 3LNOA 4DR2C 2ASBA 5LMUC 2UXBC 3LUSA 4PHTA 3JAMD 4OYCA 1LQLA 3A25A 2WP0C 4JI0C 1KKGA 2KZFA 1MXBA 4FUQA 1LCIA 3ETCA 1ZB9A 3LAXA 4ZLPA 2DYJA 3IEVA 4DR3C 1IB8A 2VQFC 4R1LA 2UXCC 3LNVA 5IFIA 1USPA 4D4GA 3VNQA 1PG3A 3CW8X 2E8CA 1VEHA 2E0GA 3R9WA 2CU6A 4I9FA 4BC7A 1XS3A 5JRHA 2UUAC 3DHVA 1EGAA 4JM1A 2CY1A 3CQ3A 1HNXC 4DV2C 2D1TA 4DR5C 4L7IA 4LF7C 1UKKA 2ZZNA 4GKKC 3J80D 5LMNC 4KHPC 1T5DX 2ONFA 2UU9C 4JI4C 5A1GA 4DR4C 2OO4A 3GR0A 2P2JA 4LFCC 1O90A 4NOZA 4DCSA 2Y27A 4YHHC 1HH2P 1QM4A 1IBKC 2HJGA 1MDBA 1N33C 2Z51A 5A1IA 4DR7C 1JOSA 2DHMA 4MTNA 1TH5A 2Y4OA 2ATWA 4PROC 4TPSB 1P7LA 4IR7A 2D28C 1GPMA 2UUBC 5ADZA 4ODJA 4JI7C 4LF4C 5AE1A 2BH1X 2CXCA 4DCUA 3RV2A 4OX9C 2PN2A 4K0BA 1NY8A 5KEIA 2OPLA 3ETOA 4PUGA 3S82A
chains in the Genus database with same CATH topology
1MXCA 3DLPX 4X62C 4KTTA 1IBMC 3L8CA 4EATA 5CZVA 1YJ7A 2YCBA 1WF3A 4FUTA 3EERA 2P2MA 1V25A 4BBYA 1XMQC 3GPCA 1T5HX 1PA4A 2QL8A 4R0MA 4KTVA 5K8FA 2D1RA 2P2BA 2HHHC 4I9GA 4L4QA 4LF8C 2E8EA 3AF5A 1O93A 3N54B 4IZ6A 4B3SC 4DV3C 4K0KC 4DG8A 2OBVA 4RM3A 4DUYC 3N2QA 5E7QA 3AF6A 5T8TA 1MD9A 4HPVA 4DV1C 4JI5C 4YY3C 5BSMA 4WV3A 3GKUA 1XRAA 2D1SA 3I07A 5BSVA 1RY2A 5BUSA 2BJOA 4BC9A 3PROC 4D57A 1XRBA 5IWAC 5BURA 2XR1A 3EQ6A 4G37A 2VQEC 3NYQA 4JI6C 5BSRA 5BR8C 1N2FA 3SO4A 3VNRA 2DPLA 3L95X 4LF6C 1O9TA 4JI8C 3TDEA 2P2QA 5BSWA 3LGXA 5CZXA 4NXNC 4JYAC 4NDNA 4DV6C 3T1HC 1FJGC 3NI2A 1XNRC 4DR6C 2YWCA 2F4VC 3E7XA 5KYTA 1HR0C 1AMUA 3OTOC 2PROA 1QWIA 3CW9A 1FUGA 4ISBA 3RG2A 2EGTA 4D4IA 5BSTA 5DV9A 3R9XA 5GTDA 4XX2A 3TUFA 2PT7G 3B7WA 1J5EC 4DV7C 1USPB 2WD9A 5AE3A 4DV4C 4B3MC 4X66C 3C5EA 4GKJC 3UZ0A 5IT9D 1XNQC 2QVZX 3FCEA 4RVNA 2E8FA 1V26A 1PG4A 3VNSA 1O92A 4DV0C 4PZPA 4L2ZA 3IMLA 2QW0X 4DG9A 4DV5C 1RG9A 4FTFA 4GS5A 4DUZC 3FCCA 5H9UA 2V7BA 4LE5A 4OXIA 4DCTA 4LF5C 2D1QA 5A2QD 1I94C 5KYVA 3CJEA 1XRCA 2P20A 5AE2A 4NXMC 3A9VA 3I08A 1HNWC 1ZB8A 4LFBC 4U5YD 4BSZA 2YWBA 1VLAA 1MDFA 3TQIA 3DAYA 1NYEA 4LFAC 2AYAA 2OPLB 1IBLC 3T1YC 4X64C 4DR1C 4BCAA 1L2FA 4RLFA 3R44A 4JI3C 3G7SA 4JI1C 1HNZC 4MH4A 4LF9C 3A9UA 4B3RC 4RMNA 3H2TA 4JI2C 3UOWA 4R1MA 4G1IA 5BSUA 3PESA 1N36C 1MXAA 3A4IA 2D7VA 2Y4NA 3NYRA 2P02A 2ZM6C 4RLQA 5A19A 3NPDA 4D56A 2QVXX 1N32C 1ML8A 5K85A 3IEUA 4RM2A 4G36A 2VZEA 1N34C 2E7GA 4WS9A 5BUQA 2VSQA 2D27A 4DCVA 4AQYC 1K0RA 2JMPA 1ULTA 3GR1A 3E7WA 2UUCC 4GXQA 1BA3A 4GXRA 3PBKA 5T8SA 4ZJZA 2UXDC 2QVYX 3J7AD 1WH9A 5FLXD 3IPLA 1XMOC 2P2FA 4JV5C 4X65C 4RVOA 2E5LC 3KXWA 3J81D 4B3TC 1MKYA 4DR2C 2ASBA 5LMUC 2UXBC 3LUSA 4PHTA 3JAMD 4OYCA 1LQLA 2WP0C 4JI0C 1KKGA 2KZFA 1MXBA 4FUQA 1LCIA 3ETCA 1ZB9A 3LAXA 4ZLPA 2DYJA 3IEVA 4DR3C 2VQFC 4R1LA 2UXCC 3LNVA 5IFIA 1USPA 4D4GA 3VNQA 1PG3A 3CW8X 2E8CA 2E0GA 3R9WA 4I9FA 4BC7A 5JRHA 2UUAC 3DHVA 1EGAA 4JM1A 2CY1A 1HNXC 4DV2C 2D1TA 4DR5C 4L7IA 4LF7C 1UKKA 4GKKC 3J80D 5LMNC 4KHPC 1T5DX 2ONFA 2UU9C 4JI4C 5A1GA 4DR4C 2OO4A 3GR0A 2P2JA 4LFCC 1O90A 4NOZA 4DCSA 2Y27A 4YHHC 1HH2P 1QM4A 1IBKC 1MDBA 2HJGA 1N33C 5A1IA 4DR7C 1JOSA 4MTNA 2Y4OA 2ATWA 4PROC 4TPSB 1P7LA 4IR7A 2D28C 1GPMA 2UUBC 5ADZA 4ODJA 4JI7C 4LF4C 5AE1A 2BH1X 2CXCA 4DCUA 3RV2A 4OX9C 2PN2A 4K0BA 5KEIA 2OPLA 3ETOA 3S82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR C;  4DR2 C;  4X62 C;  2ASB A;  1IBM C;  5LMU C;  4DR6 C;  2UXB C;  2F4V C;  3LUS A;  3JAM D;  4JI3 C;  4JI1 C;  2YCB A;  1HNZ C;  1WF3 A;  4MH4 A;  4LF9 C;  1LQL A;  4B3R C;  4JI0 C;  1HR0 C;  3OTO C;  1KKG A;  2KZF A;  3EER A;  4JI2 C;  1QWI A;  1N36 C;  1XMQ C;  1ZB9 A;  2DYJ A;  2EGT A;  1PA4 A;  2D7V A;  2QL8 A;  3IEV A;  4DR3 C;  2VQF C;  3R9X A;  2UXC C;  2ZM6 C;  4XX2 A;  2HHH C;  1USP A;  2PT7 G;  4LF8 C;  2E8E A;  3AF5 A;  1J5E C;  2E8C A;  4DV7 C;  1USP B;  3R9W A;  4B3S C;  4DV4 C;  4DV3 C;  4B3M C;  4K0K C;  4X66 C;  4GKJ C;  2UUA C;  5IT9 D;  1ML8 A;  1N32 C;  1EGA A;  1XNQ C;  2CY1 A;  4DUY C;  1HNX C;  3IEU A;  4DV2 C;  4DR5 C;  3AF6 A;  2E8F A;  4LF7 C;  1UKK A;  1N34 C;  4GKK C;  3J80 D;  2E7G A;  5LMN C;  4DV1 C;  4JI5 C;  4YY3 C;  4KHP C;  2ONF A;  2UU9 C;  4JI4 C;  3GKU A;  4DV0 C;  4DR4 C;  3I07 A;  4DCV A;  4AQY C;  1K0R A;  2JMP A;  2BJO A;  4DV5 C;  4LFC C;  4NOZ A;  4DCS A;  4YHH C;  5IWA C;  4DUZ C;  1HH2 P;  2XR1 A;  1IBK C;  2HJG A;  1N33 C;  2UUC C;  4DCT A;  2VQE C;  4DR7 C;  4LF5 C;  2UXD C;  1JOS A;  4JI6 C;  5A2Q D;  5BR8 C;  3J7A D;  1N2F A;  1WH9 A;  1I94 C;  5FLX D;  3CJE A;  4NXM C;  4MTN A;  1XMO C;  1HNW C;  1ZB8 A;  2ATW A;  4LFB C;  4LF6 C;  4JI8 C;  4X65 C;  4JV5 C;  4BSZ A;  1VLA A;  2E5L C;  2UUB C;  4JI7 C;  1NYE A;  4LFA C;  4LF4 C;  2CXC A;  2OPL B;  3J81 D;  4B3T C;  1IBL C;  4NXN C;  3T1Y C;  4JYA C;  4DCU A;  4OX9 C;  2PN2 A;  4X64 C;  1MKY A;  4DV6 C;  4DR1 C;  3T1H C;  1FJG C;  2OPL A;  1L2F A; 
#chains in the Genus database with same CATH topology
 1MXC A;  3DLP X;  4X62 C;  4KTT A;  1IBM C;  3L8C A;  3K6R A;  4EAT A;  5CZV A;  1YJ7 A;  2YCB A;  1WF3 A;  4FUT A;  3EER A;  2P2M A;  1V25 A;  4BBY A;  1XMQ C;  3GPC A;  1T5H X;  1PA4 A;  2QL8 A;  3CQ1 A;  4R0M A;  4KTV A;  5K8F A;  2D1R A;  2P2B A;  2HHH C;  4I9G A;  4L4Q A;  4LF8 C;  2E8E A;  3AF5 A;  1O93 A;  3N54 B;  4IZ6 A;  3TR3 A;  4B3S C;  4DV3 C;  4K0K C;  4DG8 A;  2KDN A;  2M5H A;  1V60 A;  2OBV A;  4RM3 A;  4DUY C;  3N2Q A;  5E7Q A;  3AF6 A;  5T8T A;  1MD9 A;  4HPV A;  4DV1 C;  4JI5 C;  4YY3 C;  5BSM A;  4WV3 A;  3GKU A;  1XRA A;  2D1S A;  1M6X A;  3I07 A;  5BSV A;  1RY2 A;  5BUS A;  2BJO A;  4BC9 A;  3PRO C;  4D57 A;  1XRB A;  5IWA C;  5BUR A;  2XR1 A;  3EQ6 A;  1P4E A;  4G37 A;  2VQE C;  3NYQ A;  4JI6 C;  1P4E C;  5BSR A;  5BR8 C;  1N2F A;  3SO4 A;  3VNR A;  2DPL A;  2YX1 A;  3L95 X;  4LF6 C;  1O9T A;  4JI8 C;  3TDE A;  2P2Q A;  5BSW A;  3AY0 A;  3LGX A;  5CZX A;  1PU1 A;  4NXN C;  4JYA C;  4NDN A;  4DV6 C;  3T1H C;  1FJG C;  4PUH A;  3NI2 A;  1XNR C;  2ZTB A;  4DR6 C;  2ZZM A;  2YWC A;  2F4V C;  3E7X A;  5KYT A;  1HR0 C;  1AMU A;  3OTO C;  2PRO A;  1QWI A;  3CW9 A;  1FUG A;  4ISB A;  3O2E A;  3RG2 A;  2EGT A;  2M5O A;  4D4I A;  5BST A;  5DV9 A;  3R9X A;  5GTD A;  4XX2 A;  3TUF A;  2PT7 G;  3B7W A;  1J5E C;  4DV7 C;  1USP B;  2WD9 A;  5AE3 A;  4DV4 C;  4B3M C;  4X66 C;  3C5E A;  4GKJ C;  2PG1 E;  3UZ0 A;  5IT9 D;  1XNQ C;  2QVZ X;  2JNV A;  3FCE A;  4RVN A;  2E8F A;  1V26 A;  1PG4 A;  3VNS A;  3CQ2 A;  1O92 A;  4DV0 C;  4PZP A;  4L2Z A;  3IML A;  2QW0 X;  3UX2 A;  4DG9 A;  4DV5 C;  1RG9 A;  4FTF A;  4GS5 A;  4DUZ C;  3FCC A;  5H9U A;  2KZ0 A;  3UX3 A;  2V7B A;  4LE5 A;  4OXI A;  4DCT A;  2D1Q A;  4LF5 C;  3UEB A;  5A2Q D;  1I94 C;  5KYV A;  3CJE A;  1XRC A;  2P20 A;  5AE2 A;  4NXM C;  3A9V A;  3I08 A;  1HNW C;  1ZB8 A;  4LFB C;  4U5Y D;  4BSZ A;  2YWB A;  1VLA A;  1MDF A;  3TQI A;  3DAY A;  1NYE A;  4LFA C;  2AYA A;  2OPL B;  1XHJ A;  1IBL C;  3T1Y C;  4X64 C;  4DR1 C;  4BCA A;  1L2F A;  4RLF A;  3R44 A;  4PUI A;  4JI3 C;  3G7S A;  4JI1 C;  1WCJ A;  1HNZ C;  4MH4 A;  4LF9 C;  3A9U A;  4B3R C;  4RMN A;  1M6X C;  3H2T A;  4JI2 C;  3UOW A;  4R1M A;  4G1I A;  5BSU A;  3PES A;  1N36 C;  1MXA A;  3A4I A;  2D7V A;  2Y4N A;  2MCQ A;  3NYR A;  2P02 A;  3A26 A;  2ZM6 C;  4RLQ A;  5A19 A;  3NPD A;  1XDX A;  4D56 A;  2QVX X;  1N32 C;  1ML8 A;  5K85 A;  3IEU A;  4RM2 A;  4G36 A;  2VZE A;  1N34 C;  2E7G A;  4WS9 A;  3FM7 A;  5BUQ A;  2MM9 A;  2VSQ A;  2D27 A;  4DCV A;  2MMA B;  4AQY C;  1K0R A;  2JMP A;  1UWD A;  1ULT A;  3GR1 A;  3E7W A;  2UUC C;  4GXQ A;  1BA3 A;  4GXR A;  3PBK A;  5T8S A;  4ZJZ A;  2UXD C;  2QVY X;  3J7A D;  1WH9 A;  5FLX D;  3IPL A;  1XMO C;  2P2F A;  4JV5 C;  4X65 C;  4RVO A;  2E5L C;  1YGT A;  2NCL A;  3KXW A;  3J81 D;  4B3T C;  1FLO A;  5LCI A;  1MKY A;  3LNO A;  4DR2 C;  2ASB A;  5LMU C;  2UXB C;  3LUS A;  4PHT A;  3JAM D;  4OYC A;  1LQL A;  3A25 A;  2WP0 C;  4JI0 C;  1KKG A;  2KZF A;  1MXB A;  4FUQ A;  1LCI A;  3ETC A;  1ZB9 A;  3LAX A;  4ZLP A;  2DYJ A;  3IEV A;  4DR3 C;  1IB8 A;  2VQF C;  4R1L A;  2UXC C;  3LNV A;  5IFI A;  1USP A;  4D4G A;  3VNQ A;  1PG3 A;  3CW8 X;  2E8C A;  1VEH A;  2E0G A;  3R9W A;  2CU6 A;  4I9F A;  4BC7 A;  1XS3 A;  5JRH A;  2UUA C;  3DHV A;  1EGA A;  4JM1 A;  2CY1 A;  3CQ3 A;  1HNX C;  4DV2 C;  2D1T A;  4DR5 C;  4L7I A;  4LF7 C;  1UKK A;  2ZZN A;  4GKK C;  3J80 D;  5LMN C;  4KHP C;  1T5D X;  2ONF A;  2UU9 C;  4JI4 C;  5A1G A;  4DR4 C;  2OO4 A;  3GR0 A;  2P2J A;  4LFC C;  1O90 A;  4NOZ A;  4DCS A;  2Y27 A;  4YHH C;  1HH2 P;  1QM4 A;  1IBK C;  2HJG A;  1MDB A;  1N33 C;  2Z51 A;  5A1I A;  4DR7 C;  1JOS A;  2DHM A;  4MTN A;  1TH5 A;  2Y4O A;  2ATW A;  4PRO C;  4TPS B;  1P7L A;  4IR7 A;  2D28 C;  1GPM A;  2UUB C;  5ADZ A;  4ODJ A;  4JI7 C;  4LF4 C;  5AE1 A;  2BH1 X;  2CXC A;  4DCU A;  3RV2 A;  4OX9 C;  2PN2 A;  4K0B A;  1NY8 A;  5KEI A;  2OPL A;  3ETO A;  4PUG A;  3S82 A; 
#chains in the Genus database with same CATH homology
 1MXC A;  3DLP X;  4X62 C;  4KTT A;  1IBM C;  3L8C A;  4EAT A;  5CZV A;  1YJ7 A;  2YCB A;  1WF3 A;  4FUT A;  3EER A;  2P2M A;  1V25 A;  4BBY A;  1XMQ C;  3GPC A;  1T5H X;  1PA4 A;  2QL8 A;  4R0M A;  4KTV A;  5K8F A;  2D1R A;  2P2B A;  2HHH C;  4I9G A;  4L4Q A;  4LF8 C;  2E8E A;  3AF5 A;  1O93 A;  3N54 B;  4IZ6 A;  4B3S C;  4DV3 C;  4K0K C;  4DG8 A;  2OBV A;  4RM3 A;  4DUY C;  3N2Q A;  5E7Q A;  3AF6 A;  5T8T A;  1MD9 A;  4HPV A;  4DV1 C;  4JI5 C;  4YY3 C;  5BSM A;  4WV3 A;  3GKU A;  1XRA A;  2D1S A;  3I07 A;  5BSV A;  1RY2 A;  5BUS A;  2BJO A;  4BC9 A;  3PRO C;  4D57 A;  1XRB A;  5IWA C;  5BUR A;  2XR1 A;  3EQ6 A;  4G37 A;  2VQE C;  3NYQ A;  4JI6 C;  5BSR A;  5BR8 C;  1N2F A;  3SO4 A;  3VNR A;  2DPL A;  3L95 X;  4LF6 C;  1O9T A;  4JI8 C;  3TDE A;  2P2Q A;  5BSW A;  3LGX A;  5CZX A;  4NXN C;  4JYA C;  4NDN A;  4DV6 C;  3T1H C;  1FJG C;  3NI2 A;  1XNR C;  4DR6 C;  2YWC A;  2F4V C;  3E7X A;  5KYT A;  1HR0 C;  1AMU A;  3OTO C;  2PRO A;  1QWI A;  3CW9 A;  1FUG A;  4ISB A;  3RG2 A;  2EGT A;  4D4I A;  5BST A;  5DV9 A;  3R9X A;  5GTD A;  4XX2 A;  3TUF A;  2PT7 G;  3B7W A;  1J5E C;  4DV7 C;  1USP B;  2WD9 A;  5AE3 A;  4DV4 C;  4B3M C;  4X66 C;  3C5E A;  4GKJ C;  3UZ0 A;  5IT9 D;  1XNQ C;  2QVZ X;  3FCE A;  4RVN A;  2E8F A;  1V26 A;  1PG4 A;  3VNS A;  1O92 A;  4DV0 C;  4PZP A;  4L2Z A;  3IML A;  2QW0 X;  4DG9 A;  4DV5 C;  1RG9 A;  4FTF A;  4GS5 A;  4DUZ C;  3FCC A;  5H9U A;  2V7B A;  4LE5 A;  4OXI A;  4DCT A;  4LF5 C;  2D1Q A;  5A2Q D;  1I94 C;  5KYV A;  3CJE A;  1XRC A;  2P20 A;  5AE2 A;  4NXM C;  3A9V A;  3I08 A;  1HNW C;  1ZB8 A;  4LFB C;  4U5Y D;  4BSZ A;  2YWB A;  1VLA A;  1MDF A;  3TQI A;  3DAY A;  1NYE A;  4LFA C;  2AYA A;  2OPL B;  1IBL C;  3T1Y C;  4X64 C;  4DR1 C;  4BCA A;  1L2F A;  4RLF A;  3R44 A;  4JI3 C;  3G7S A;  4JI1 C;  1HNZ C;  4MH4 A;  4LF9 C;  3A9U A;  4B3R C;  4RMN A;  3H2T A;  4JI2 C;  3UOW A;  4R1M A;  4G1I A;  5BSU A;  3PES A;  1N36 C;  1MXA A;  3A4I A;  2D7V A;  2Y4N A;  3NYR A;  2P02 A;  2ZM6 C;  4RLQ A;  5A19 A;  3NPD A;  4D56 A;  2QVX X;  1N32 C;  1ML8 A;  5K85 A;  3IEU A;  4RM2 A;  4G36 A;  2VZE A;  1N34 C;  2E7G A;  4WS9 A;  5BUQ A;  2VSQ A;  2D27 A;  4DCV A;  4AQY C;  1K0R A;  2JMP A;  1ULT A;  3GR1 A;  3E7W A;  2UUC C;  4GXQ A;  1BA3 A;  4GXR A;  3PBK A;  5T8S A;  4ZJZ A;  2UXD C;  2QVY X;  3J7A D;  1WH9 A;  5FLX D;  3IPL A;  1XMO C;  2P2F A;  4JV5 C;  4X65 C;  4RVO A;  2E5L C;  3KXW A;  3J81 D;  4B3T C;  1MKY A;  4DR2 C;  2ASB A;  5LMU C;  2UXB C;  3LUS A;  4PHT A;  3JAM D;  4OYC A;  1LQL A;  2WP0 C;  4JI0 C;  1KKG A;  2KZF A;  1MXB A;  4FUQ A;  1LCI A;  3ETC A;  1ZB9 A;  3LAX A;  4ZLP A;  2DYJ A;  3IEV A;  4DR3 C;  2VQF C;  4R1L A;  2UXC C;  3LNV A;  5IFI A;  1USP A;  4D4G A;  3VNQ A;  1PG3 A;  3CW8 X;  2E8C A;  2E0G A;  3R9W A;  4I9F A;  4BC7 A;  5JRH A;  2UUA C;  3DHV A;  1EGA A;  4JM1 A;  2CY1 A;  1HNX C;  4DV2 C;  2D1T A;  4DR5 C;  4L7I A;  4LF7 C;  1UKK A;  4GKK C;  3J80 D;  5LMN C;  4KHP C;  1T5D X;  2ONF A;  2UU9 C;  4JI4 C;  5A1G A;  4DR4 C;  2OO4 A;  3GR0 A;  2P2J A;  4LFC C;  1O90 A;  4NOZ A;  4DCS A;  2Y27 A;  4YHH C;  1HH2 P;  1QM4 A;  1IBK C;  1MDB A;  2HJG A;  1N33 C;  5A1I A;  4DR7 C;  1JOS A;  4MTN A;  2Y4O A;  2ATW A;  4PRO C;  4TPS B;  1P7L A;  4IR7 A;  2D28 C;  1GPM A;  2UUB C;  5ADZ A;  4ODJ A;  4JI7 C;  4LF4 C;  5AE1 A;  2BH1 X;  2CXC A;  4DCU A;  3RV2 A;  4OX9 C;  2PN2 A;  4K0B A;  5KEI A;  2OPL A;  3ETO A;  3S82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...