1HNWC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnwC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnwC02
1IBLC 4DV6C 4X66C 4LFAC 4LFCC 4GKJC 4JI3C 4X62C 3OTOC 1HH2P 2HJGA 1HNWC 2PN2A 3IEUA 1XNRC 4KHPC 3T1YC 4DUYC 4LF4C 5IWAC 2EGTA 4DR5C 4X65C 4GKKC 2ASBA 5LMUC 2D7VA 1I94C 1VLAA 4LF9C 2F4VC 4DR7C 1N33C 3EERA 2UUCC 2VQFC 1NYEA 3J81D 3R9WA 4YHHC 3AF6A 4DCVA 5BR8C 1XNQC 1HNZC 4DV4C 1IBKC 4JI7C 5A2QD 4DCUA 1FJGC 4DCTA 4B3SC 1ZB9A 3T1HC 1HNXC 2PT7G 4DV7C 2E5LC 2UXDC 3IEVA 4DCSA 3AF5A 4LF8C 4LF7C 1ML8A 1L2FA 1XMQC 1PA4A 2CXCA 3J7AD 1N2FA 2OPLA 4AQYC 3J80D 4B3MC 5IT9D 2XR1A 2UU9C 4DV5C 1K0RA 1WF3A 4MH4A 1N36C 3GKUA 4BSZA 1ZB8A 4JI2C 4LF6C 2BJOA 1QWIA 5LMNC 4B3TC 2YCBA 1LQLA 3CJEA 4XX2A 4DV3C 1N32C 1USPA 3LUSA 2VQEC 4NOZA 4NXNC 1J5EC 4JV5C 3I07A 4X64C 4DR4C 2QL8A 4MTNA 4LFBC 2E8EA 2UXBC 4JI5C 5FLXD 4DR1C 2ONFA 4OX9C 2ATWA 4DR6C 1KKGA 1UKKA 2CY1A 2DYJA 4LF5C 2KZFA 2ZM6C 2HHHC 3JAMD 2E8CA 4JI6C 4DV1C 2E7GA 1EGAA 3R9XA 4B3RC 2JMPA 1IBMC 4DUZC 4DR2C 1USPB 4DR3C 4K0KC 2UUBC 4DV2C 4JI0C 2UUAC 4JI8C 4JI1C 4DV0C 4JI4C 1HR0C 4YY3C 2UXCC 1MKYA 1XMOC 2E8FA 4JYAC 1WH9A 4NXMC 1JOSA 2OPLB 1N34C
chains in the Genus database with same CATH superfamily
1YGTA 4GKJC 3CW8X 3PROC 4PROC 4WS9A 3GR0A 1FLOA 4L7IA 4LF4C 3DLPX 2Z51A 3PESA 3UX2A 2OO4A 4DR7C 4D4IA 3EERA 4DG9A 5BUQA 2VQFC 2P2QA 2ZZNA 5KYVA 5DV9A 3KXWA 5JRHA 4DV4C 3UOWA 2JNVA 5BSTA 4JI7C 1O9TA 1FJGC 1M6XC 4B3SC 5LCIA 2YWBA 1MDFA 3C5EA 1T5DX 5AE1A 5BUSA 3AF5A 3NYRA 4LF7C 1XMQC 1PA4A 4JM1A 2NCLA 2OPLA 4AQYC 2P02A 5H9UA 4DV5C 1K0RA 5BSMA 1N36C 2QW0X 4OYCA 2P2BA 4JI2C 2BJOA 2QVZX 4ZLPA 3NI2A 1XDXA 5ADZA 1N32C 3L95X 1V25A 4L2ZA 1J5EC 1PU1A 3TR3A 2KZ0A 3I07A 4X64C 2QL8A 2ZTBA 1NY8A 4K0BA 1O90A 3CQ3A 4G37A 4DR1C 4OX9C 2PROA 5KYTA 1KKGA 2P20A 2KZFA 3JAMD 4JI6C 4DV1C 2E7GA 4PUIA 3R9XA 4B3RC 2BH1X 1IBMC 4RMNA 1QM4A 2Y4NA 4DR2C 4DR3C 4DV0C 5BSVA 4JI4C 2E8FA 2QVYX 4X66C 4PHTA 4JI3C 2M5HA 3L8CA 1HH2P 2MMAB 1HNWC 5CZXA 1XNRC 5AE3A 2Y4OA 4GXQA 4X65C 1RY2A 1XRBA 5LMUC 2F4VC 1I94C 4PUGA 4RVNA 3J81D 1O93A 3DAYA 4YHHC 5BR8C 5A1IA 4WV3A 2QVXX 5A19A 4RVOA 2PT7G 4DV7C 2UXDC 2YWCA 1ML8A 1XRCA 2CXCA 3A26A 1N2FA 3IMLA 4B3MC 4BCAA 4I9GA 3A9UA 4G1IA 4RM2A 2DPLA 5IT9D 1TH5A 4RLQA 3TUFA 2VSQA 1ZB8A 4D56A 1QWIA 4PZPA 5LMNC 1V60A 2MM9A 4DV3C 3FM7A 1USPA 1MD9A 3VNRA 4G36A 3H2TA 4JV5C 4ISBA 4MTNA 2D1TA 4BC7A 2UXBC 3FCCA 1XS3A 3E7WA 2ATWA 4DR6C 1UWDA 5E7QA 4I9FA 3LAXA 1UKKA 5GTDA 3GPCA 2ZM6C 2HHHC 3GR1A 3RV2A 2VZEA 3B7WA 4BC9A 1M6XA 2YX1A 1USPB 3K6RA 3LNVA 2UUBC 4JI0C 4JI1C 4YY3C 3EQ6A 1MKYA 1XMOC 2AYAA 4ODJA 1MXAA 1WH9A 4JYAC 1ULTA 1JOSA 2OPLB 4NDNA 1IBLC 4DV6C 5AE2A 3SO4A 3OTOC 1O92A 2HJGA 3G7SA 3IEUA 4KHPC 3T1YC 2D1QA 4L4QA 2EGTA 2ASBA 2P2FA 1N33C 5CZVA 1PG4A 1BA3A 2D28C 1XNQC 4OXIA 4IZ6A 1IBKC 4FUQA 5A2QD 4R0MA 4DCTA 1ZB9A 1MXCA 3UX3A 1P4EC 1P7LA 4GS5A 2E5LC 4D57A 3IEVA 4DCSA 4LF8C 1T5HX 1PG3A 4HPVA 2DHMA 3J7AD 3J80D 3S82A 5BSUA 2WD9A 3NYQA 2XR1A 2UU9C 1WF3A 3FCEA 1RG9A 3GKUA 3LNOA 1XHJA 4BSZA 3NPDA 4LF6C 3R44A 4R1LA 2YCBA 1LQLA 2CU6A 3CJEA 3LUSA 4NXNC 1WCJA 3ETOA 4LFBC 1FUGA 2E8EA 5FLXD 1GPMA 3I08A 5BSWA 2ONFA 3LGXA 3IPLA 1VEHA 1MDBA 2P2MA 3N2QA 2CY1A 2DYJA 5K8FA 2E8CA 3UZ0A 3TDEA 1EGAA 2JMPA 4ZJZA 4DUZC 4K0KC 4RLFA 2ZZMA 3PBKA 4BBYA 4RM3A 4U5YD 2UXCC 1V26A 4NXMC 1N34C 4LFAC 4LFCC 1YJ7A 4X62C 5KEIA 3AY0A 2PN2A 4DUYC 2D27A 5IWAC 1AMUA 2OBVA 4DR5C 4GKKC 5IFIA 2D7VA 4LF9C 1VLAA 4FUTA 1LCIA 2UUCC 2V7BA 1NYEA 3R9WA 3E7XA 3AF6A 3A25A 4DCVA 2D1RA 5BURA 1HNZC 2MCQA 5BSRA 2WP0C 4DCUA 4FTFA 3N54B 4PUHA 3T1HC 4R1MA 1HNXC 3VNQA 3UEBA 3CQ2A 3CQ1A 1L2FA 5T8TA 5A1GA 2M5OA 4D4GA 3TQIA 3DHVA 2E0GA 4MH4A 4GXRA 1XRAA 4DG8A 4B3TC 4XX2A 3CW9A 2VQEC 4NOZA 4LE5A 3RG2A 4DR4C 4JI5C 2P2JA 4KTTA 4EATA 1MXBA 3A9VA 4LF5C 2D1SA 2KDNA 3O2EA 4KTVA 3ETCA 4IR7A 5T8SA 2PG1E 1IB8A 5K85A 3A4IA 3VNSA 4DV2C 1P4EA 2UUAC 4JI8C 1HR0C 4TPSB 2Y27A
chains in the Genus database with same CATH topology
4GKJC 3CW8X 3PROC 4PROC 4WS9A 3GR0A 4L7IA 4LF4C 3DLPX 3PESA 2OO4A 4DR7C 4D4IA 3EERA 4DG9A 5BUQA 2VQFC 2P2QA 5KYVA 5DV9A 3KXWA 5JRHA 4DV4C 3UOWA 5BSTA 4JI7C 1O9TA 1FJGC 4B3SC 2YWBA 1MDFA 3C5EA 1T5DX 5AE1A 5BUSA 3AF5A 3NYRA 4LF7C 1XMQC 1PA4A 4JM1A 2OPLA 4AQYC 2P02A 5H9UA 4DV5C 1K0RA 5BSMA 1N36C 2QW0X 4OYCA 2P2BA 4JI2C 2BJOA 2QVZX 4ZLPA 3NI2A 5ADZA 1N32C 3L95X 1V25A 4L2ZA 1J5EC 3I07A 4X64C 2QL8A 4K0BA 1O90A 4G37A 4DR1C 4OX9C 2PROA 5KYTA 1KKGA 2P20A 2KZFA 3JAMD 4JI6C 4DV1C 2E7GA 3R9XA 4B3RC 2BH1X 1IBMC 4RMNA 1QM4A 2Y4NA 4DR2C 4DR3C 4DV0C 5BSVA 4JI4C 2E8FA 2QVYX 4X66C 4PHTA 4JI3C 3L8CA 1HH2P 1HNWC 5CZXA 1XNRC 5AE3A 2Y4OA 4GXQA 4X65C 1RY2A 1XRBA 5LMUC 2F4VC 1I94C 4RVNA 3J81D 1O93A 3DAYA 4YHHC 5BR8C 5A1IA 4WV3A 2QVXX 5A19A 4RVOA 2PT7G 4DV7C 2UXDC 2YWCA 1ML8A 1XRCA 2CXCA 1N2FA 3IMLA 4B3MC 4BCAA 4I9GA 3A9UA 4G1IA 4RM2A 2DPLA 5IT9D 4RLQA 3TUFA 2VSQA 1ZB8A 4D56A 1QWIA 4PZPA 5LMNC 4DV3C 1USPA 1MD9A 3VNRA 4G36A 3H2TA 4JV5C 4ISBA 4MTNA 2D1TA 4BC7A 2UXBC 3FCCA 3E7WA 2ATWA 4DR6C 5E7QA 4I9FA 3LAXA 1UKKA 5GTDA 3GPCA 2ZM6C 2HHHC 3GR1A 3RV2A 2VZEA 3B7WA 4BC9A 1USPB 3LNVA 2UUBC 4JI0C 4JI1C 4YY3C 3EQ6A 1MKYA 1XMOC 2AYAA 4ODJA 1MXAA 1WH9A 4JYAC 1ULTA 1JOSA 2OPLB 4NDNA 1IBLC 4DV6C 5AE2A 3SO4A 3OTOC 1O92A 2HJGA 3G7SA 3IEUA 4KHPC 3T1YC 2D1QA 4L4QA 2EGTA 2ASBA 2P2FA 1N33C 5CZVA 1PG4A 1BA3A 2D28C 1XNQC 4OXIA 4IZ6A 1IBKC 4FUQA 5A2QD 4R0MA 4DCTA 1ZB9A 1MXCA 1P7LA 4GS5A 2E5LC 4D57A 3IEVA 4DCSA 4LF8C 1T5HX 1PG3A 4HPVA 3J7AD 3J80D 3S82A 5BSUA 2WD9A 3NYQA 2XR1A 2UU9C 1WF3A 3FCEA 1RG9A 3GKUA 4BSZA 3NPDA 4LF6C 3R44A 4R1LA 2YCBA 1LQLA 3CJEA 3LUSA 4NXNC 3ETOA 4LFBC 1FUGA 2E8EA 5FLXD 1GPMA 3I08A 5BSWA 2ONFA 3LGXA 3IPLA 1MDBA 2P2MA 3N2QA 2CY1A 2DYJA 5K8FA 2E8CA 3UZ0A 3TDEA 1EGAA 2JMPA 4ZJZA 4DUZC 4K0KC 4RLFA 3PBKA 4BBYA 4RM3A 4U5YD 2UXCC 1V26A 4NXMC 1N34C 4LFAC 4LFCC 1YJ7A 4X62C 5KEIA 2PN2A 4DUYC 2D27A 5IWAC 1AMUA 2OBVA 4DR5C 4GKKC 5IFIA 2D7VA 4LF9C 1VLAA 4FUTA 1LCIA 2UUCC 2V7BA 1NYEA 3R9WA 3E7XA 3AF6A 4DCVA 2D1RA 5BURA 1HNZC 5BSRA 2WP0C 4DCUA 4FTFA 3N54B 3T1HC 4R1MA 1HNXC 3VNQA 1L2FA 5T8TA 5A1GA 4D4GA 3TQIA 3DHVA 2E0GA 4MH4A 4GXRA 1XRAA 4DG8A 4B3TC 4XX2A 3CW9A 2VQEC 4NOZA 4LE5A 3RG2A 4DR4C 4JI5C 2P2JA 4KTTA 4EATA 1MXBA 3A9VA 4LF5C 2D1SA 4KTVA 3ETCA 4IR7A 5T8SA 5K85A 3A4IA 3VNSA 4DV2C 2UUAC 4JI8C 1HR0C 4TPSB 2Y27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL C;  4DV6 C;  4X66 C;  4LFA C;  4LFC C;  4GKJ C;  4JI3 C;  4X62 C;  3OTO C;  1HH2 P;  2HJG A;  1HNW C;  2PN2 A;  3IEU A;  1XNR C;  4KHP C;  3T1Y C;  4DUY C;  4LF4 C;  5IWA C;  2EGT A;  4DR5 C;  4X65 C;  4GKK C;  2ASB A;  5LMU C;  2D7V A;  1I94 C;  1VLA A;  4LF9 C;  2F4V C;  4DR7 C;  1N33 C;  3EER A;  2UUC C;  2VQF C;  1NYE A;  3J81 D;  3R9W A;  4YHH C;  3AF6 A;  4DCV A;  5BR8 C;  1XNQ C;  1HNZ C;  4DV4 C;  1IBK C;  4JI7 C;  5A2Q D;  4DCU A;  1FJG C;  4DCT A;  4B3S C;  1ZB9 A;  3T1H C;  1HNX C;  2PT7 G;  4DV7 C;  2E5L C;  2UXD C;  3IEV A;  4DCS A;  3AF5 A;  4LF8 C;  4LF7 C;  1ML8 A;  1L2F A;  1XMQ C;  1PA4 A;  2CXC A;  3J7A D;  1N2F A;  2OPL A;  4AQY C;  3J80 D;  4B3M C;  5IT9 D;  2XR1 A;  2UU9 C;  4DV5 C;  1K0R A;  1WF3 A;  4MH4 A;  1N36 C;  3GKU A;  4BSZ A;  1ZB8 A;  4JI2 C;  4LF6 C;  2BJO A;  1QWI A;  5LMN C;  4B3T C;  2YCB A;  1LQL A;  3CJE A;  4XX2 A;  4DV3 C;  1N32 C;  1USP A;  3LUS A;  2VQE C;  4NOZ A;  4NXN C;  1J5E C;  4JV5 C;  3I07 A;  4X64 C;  4DR4 C;  2QL8 A;  4MTN A;  4LFB C;  2E8E A;  2UXB C;  4JI5 C;  5FLX D;  4DR1 C;  2ONF A;  4OX9 C;  2ATW A;  4DR6 C;  1KKG A;  1UKK A;  2CY1 A;  2DYJ A;  4LF5 C;  2KZF A;  2ZM6 C;  2HHH C;  3JAM D;  2E8C A;  4JI6 C;  4DV1 C;  2E7G A;  1EGA A;  3R9X A;  4B3R C;  2JMP A;  1IBM C;  4DUZ C;  4DR2 C;  1USP B;  4DR3 C;  4K0K C;  2UUB C;  4DV2 C;  4JI0 C;  2UUA C;  4JI8 C;  4JI1 C;  4DV0 C;  4JI4 C;  1HR0 C;  4YY3 C;  2UXC C;  1MKY A;  1XMO C;  2E8F A;  4JYA C;  1WH9 A;  4NXM C;  1JOS A;  2OPL B;  1N34 C; 
#chains in the Genus database with same CATH topology
 1YGT A;  4GKJ C;  3CW8 X;  3PRO C;  4PRO C;  4WS9 A;  3GR0 A;  1FLO A;  4L7I A;  4LF4 C;  3DLP X;  2Z51 A;  3PES A;  3UX2 A;  2OO4 A;  4DR7 C;  4D4I A;  3EER A;  4DG9 A;  5BUQ A;  2VQF C;  2P2Q A;  2ZZN A;  5KYV A;  5DV9 A;  3KXW A;  5JRH A;  4DV4 C;  3UOW A;  2JNV A;  5BST A;  4JI7 C;  1O9T A;  1FJG C;  1M6X C;  4B3S C;  5LCI A;  2YWB A;  1MDF A;  3C5E A;  1T5D X;  5AE1 A;  5BUS A;  3AF5 A;  3NYR A;  4LF7 C;  1XMQ C;  1PA4 A;  4JM1 A;  2NCL A;  2OPL A;  4AQY C;  2P02 A;  5H9U A;  4DV5 C;  1K0R A;  5BSM A;  1N36 C;  2QW0 X;  4OYC A;  2P2B A;  4JI2 C;  2BJO A;  2QVZ X;  4ZLP A;  3NI2 A;  1XDX A;  5ADZ A;  1N32 C;  3L95 X;  1V25 A;  4L2Z A;  1J5E C;  1PU1 A;  3TR3 A;  2KZ0 A;  3I07 A;  4X64 C;  2QL8 A;  2ZTB A;  1NY8 A;  4K0B A;  1O90 A;  3CQ3 A;  4G37 A;  4DR1 C;  4OX9 C;  2PRO A;  5KYT A;  1KKG A;  2P20 A;  2KZF A;  3JAM D;  4JI6 C;  4DV1 C;  2E7G A;  4PUI A;  3R9X A;  4B3R C;  2BH1 X;  1IBM C;  4RMN A;  1QM4 A;  2Y4N A;  4DR2 C;  4DR3 C;  4DV0 C;  5BSV A;  4JI4 C;  2E8F A;  2QVY X;  4X66 C;  4PHT A;  4JI3 C;  2M5H A;  3L8C A;  1HH2 P;  2MMA B;  1HNW C;  5CZX A;  1XNR C;  5AE3 A;  2Y4O A;  4GXQ A;  4X65 C;  1RY2 A;  1XRB A;  5LMU C;  2F4V C;  1I94 C;  4PUG A;  4RVN A;  3J81 D;  1O93 A;  3DAY A;  4YHH C;  5BR8 C;  5A1I A;  4WV3 A;  2QVX X;  5A19 A;  4RVO A;  2PT7 G;  4DV7 C;  2UXD C;  2YWC A;  1ML8 A;  1XRC A;  2CXC A;  3A26 A;  1N2F A;  3IML A;  4B3M C;  4BCA A;  4I9G A;  3A9U A;  4G1I A;  4RM2 A;  2DPL A;  5IT9 D;  1TH5 A;  4RLQ A;  3TUF A;  2VSQ A;  1ZB8 A;  4D56 A;  1QWI A;  4PZP A;  5LMN C;  1V60 A;  2MM9 A;  4DV3 C;  3FM7 A;  1USP A;  1MD9 A;  3VNR A;  4G36 A;  3H2T A;  4JV5 C;  4ISB A;  4MTN A;  2D1T A;  4BC7 A;  2UXB C;  3FCC A;  1XS3 A;  3E7W A;  2ATW A;  4DR6 C;  1UWD A;  5E7Q A;  4I9F A;  3LAX A;  1UKK A;  5GTD A;  3GPC A;  2ZM6 C;  2HHH C;  3GR1 A;  3RV2 A;  2VZE A;  3B7W A;  4BC9 A;  1M6X A;  2YX1 A;  1USP B;  3K6R A;  3LNV A;  2UUB C;  4JI0 C;  4JI1 C;  4YY3 C;  3EQ6 A;  1MKY A;  1XMO C;  2AYA A;  4ODJ A;  1MXA A;  1WH9 A;  4JYA C;  1ULT A;  1JOS A;  2OPL B;  4NDN A;  1IBL C;  4DV6 C;  5AE2 A;  3SO4 A;  3OTO C;  1O92 A;  2HJG A;  3G7S A;  3IEU A;  4KHP C;  3T1Y C;  2D1Q A;  4L4Q A;  2EGT A;  2ASB A;  2P2F A;  1N33 C;  5CZV A;  1PG4 A;  1BA3 A;  2D28 C;  1XNQ C;  4OXI A;  4IZ6 A;  1IBK C;  4FUQ A;  5A2Q D;  4R0M A;  4DCT A;  1ZB9 A;  1MXC A;  3UX3 A;  1P4E C;  1P7L A;  4GS5 A;  2E5L C;  4D57 A;  3IEV A;  4DCS A;  4LF8 C;  1T5H X;  1PG3 A;  4HPV A;  2DHM A;  3J7A D;  3J80 D;  3S82 A;  5BSU A;  2WD9 A;  3NYQ A;  2XR1 A;  2UU9 C;  1WF3 A;  3FCE A;  1RG9 A;  3GKU A;  3LNO A;  1XHJ A;  4BSZ A;  3NPD A;  4LF6 C;  3R44 A;  4R1L A;  2YCB A;  1LQL A;  2CU6 A;  3CJE A;  3LUS A;  4NXN C;  1WCJ A;  3ETO A;  4LFB C;  1FUG A;  2E8E A;  5FLX D;  1GPM A;  3I08 A;  5BSW A;  2ONF A;  3LGX A;  3IPL A;  1VEH A;  1MDB A;  2P2M A;  3N2Q A;  2CY1 A;  2DYJ A;  5K8F A;  2E8C A;  3UZ0 A;  3TDE A;  1EGA A;  2JMP A;  4ZJZ A;  4DUZ C;  4K0K C;  4RLF A;  2ZZM A;  3PBK A;  4BBY A;  4RM3 A;  4U5Y D;  2UXC C;  1V26 A;  4NXM C;  1N34 C;  4LFA C;  4LFC C;  1YJ7 A;  4X62 C;  5KEI A;  3AY0 A;  2PN2 A;  4DUY C;  2D27 A;  5IWA C;  1AMU A;  2OBV A;  4DR5 C;  4GKK C;  5IFI A;  2D7V A;  4LF9 C;  1VLA A;  4FUT A;  1LCI A;  2UUC C;  2V7B A;  1NYE A;  3R9W A;  3E7X A;  3AF6 A;  3A25 A;  4DCV A;  2D1R A;  5BUR A;  1HNZ C;  2MCQ A;  5BSR A;  2WP0 C;  4DCU A;  4FTF A;  3N54 B;  4PUH A;  3T1H C;  4R1M A;  1HNX C;  3VNQ A;  3UEB A;  3CQ2 A;  3CQ1 A;  1L2F A;  5T8T A;  5A1G A;  2M5O A;  4D4G A;  3TQI A;  3DHV A;  2E0G A;  4MH4 A;  4GXR A;  1XRA A;  4DG8 A;  4B3T C;  4XX2 A;  3CW9 A;  2VQE C;  4NOZ A;  4LE5 A;  3RG2 A;  4DR4 C;  4JI5 C;  2P2J A;  4KTT A;  4EAT A;  1MXB A;  3A9V A;  4LF5 C;  2D1S A;  2KDN A;  3O2E A;  4KTV A;  3ETC A;  4IR7 A;  5T8S A;  2PG1 E;  1IB8 A;  5K85 A;  3A4I A;  3VNS A;  4DV2 C;  1P4E A;  2UUA C;  4JI8 C;  1HR0 C;  4TPS B;  2Y27 A; 
#chains in the Genus database with same CATH homology
 4GKJ C;  3CW8 X;  3PRO C;  4PRO C;  4WS9 A;  3GR0 A;  4L7I A;  4LF4 C;  3DLP X;  3PES A;  2OO4 A;  4DR7 C;  4D4I A;  3EER A;  4DG9 A;  5BUQ A;  2VQF C;  2P2Q A;  5KYV A;  5DV9 A;  3KXW A;  5JRH A;  4DV4 C;  3UOW A;  5BST A;  4JI7 C;  1O9T A;  1FJG C;  4B3S C;  2YWB A;  1MDF A;  3C5E A;  1T5D X;  5AE1 A;  5BUS A;  3AF5 A;  3NYR A;  4LF7 C;  1XMQ C;  1PA4 A;  4JM1 A;  2OPL A;  4AQY C;  2P02 A;  5H9U A;  4DV5 C;  1K0R A;  5BSM A;  1N36 C;  2QW0 X;  4OYC A;  2P2B A;  4JI2 C;  2BJO A;  2QVZ X;  4ZLP A;  3NI2 A;  5ADZ A;  1N32 C;  3L95 X;  1V25 A;  4L2Z A;  1J5E C;  3I07 A;  4X64 C;  2QL8 A;  4K0B A;  1O90 A;  4G37 A;  4DR1 C;  4OX9 C;  2PRO A;  5KYT A;  1KKG A;  2P20 A;  2KZF A;  3JAM D;  4JI6 C;  4DV1 C;  2E7G A;  3R9X A;  4B3R C;  2BH1 X;  1IBM C;  4RMN A;  1QM4 A;  2Y4N A;  4DR2 C;  4DR3 C;  4DV0 C;  5BSV A;  4JI4 C;  2E8F A;  2QVY X;  4X66 C;  4PHT A;  4JI3 C;  3L8C A;  1HH2 P;  1HNW C;  5CZX A;  1XNR C;  5AE3 A;  2Y4O A;  4GXQ A;  4X65 C;  1RY2 A;  1XRB A;  5LMU C;  2F4V C;  1I94 C;  4RVN A;  3J81 D;  1O93 A;  3DAY A;  4YHH C;  5BR8 C;  5A1I A;  4WV3 A;  2QVX X;  5A19 A;  4RVO A;  2PT7 G;  4DV7 C;  2UXD C;  2YWC A;  1ML8 A;  1XRC A;  2CXC A;  1N2F A;  3IML A;  4B3M C;  4BCA A;  4I9G A;  3A9U A;  4G1I A;  4RM2 A;  2DPL A;  5IT9 D;  4RLQ A;  3TUF A;  2VSQ A;  1ZB8 A;  4D56 A;  1QWI A;  4PZP A;  5LMN C;  4DV3 C;  1USP A;  1MD9 A;  3VNR A;  4G36 A;  3H2T A;  4JV5 C;  4ISB A;  4MTN A;  2D1T A;  4BC7 A;  2UXB C;  3FCC A;  3E7W A;  2ATW A;  4DR6 C;  5E7Q A;  4I9F A;  3LAX A;  1UKK A;  5GTD A;  3GPC A;  2ZM6 C;  2HHH C;  3GR1 A;  3RV2 A;  2VZE A;  3B7W A;  4BC9 A;  1USP B;  3LNV A;  2UUB C;  4JI0 C;  4JI1 C;  4YY3 C;  3EQ6 A;  1MKY A;  1XMO C;  2AYA A;  4ODJ A;  1MXA A;  1WH9 A;  4JYA C;  1ULT A;  1JOS A;  2OPL B;  4NDN A;  1IBL C;  4DV6 C;  5AE2 A;  3SO4 A;  3OTO C;  1O92 A;  2HJG A;  3G7S A;  3IEU A;  4KHP C;  3T1Y C;  2D1Q A;  4L4Q A;  2EGT A;  2ASB A;  2P2F A;  1N33 C;  5CZV A;  1PG4 A;  1BA3 A;  2D28 C;  1XNQ C;  4OXI A;  4IZ6 A;  1IBK C;  4FUQ A;  5A2Q D;  4R0M A;  4DCT A;  1ZB9 A;  1MXC A;  1P7L A;  4GS5 A;  2E5L C;  4D57 A;  3IEV A;  4DCS A;  4LF8 C;  1T5H X;  1PG3 A;  4HPV A;  3J7A D;  3J80 D;  3S82 A;  5BSU A;  2WD9 A;  3NYQ A;  2XR1 A;  2UU9 C;  1WF3 A;  3FCE A;  1RG9 A;  3GKU A;  4BSZ A;  3NPD A;  4LF6 C;  3R44 A;  4R1L A;  2YCB A;  1LQL A;  3CJE A;  3LUS A;  4NXN C;  3ETO A;  4LFB C;  1FUG A;  2E8E A;  5FLX D;  1GPM A;  3I08 A;  5BSW A;  2ONF A;  3LGX A;  3IPL A;  1MDB A;  2P2M A;  3N2Q A;  2CY1 A;  2DYJ A;  5K8F A;  2E8C A;  3UZ0 A;  3TDE A;  1EGA A;  2JMP A;  4ZJZ A;  4DUZ C;  4K0K C;  4RLF A;  3PBK A;  4BBY A;  4RM3 A;  4U5Y D;  2UXC C;  1V26 A;  4NXM C;  1N34 C;  4LFA C;  4LFC C;  1YJ7 A;  4X62 C;  5KEI A;  2PN2 A;  4DUY C;  2D27 A;  5IWA C;  1AMU A;  2OBV A;  4DR5 C;  4GKK C;  5IFI A;  2D7V A;  4LF9 C;  1VLA A;  4FUT A;  1LCI A;  2UUC C;  2V7B A;  1NYE A;  3R9W A;  3E7X A;  3AF6 A;  4DCV A;  2D1R A;  5BUR A;  1HNZ C;  5BSR A;  2WP0 C;  4DCU A;  4FTF A;  3N54 B;  3T1H C;  4R1M A;  1HNX C;  3VNQ A;  1L2F A;  5T8T A;  5A1G A;  4D4G A;  3TQI A;  3DHV A;  2E0G A;  4MH4 A;  4GXR A;  1XRA A;  4DG8 A;  4B3T C;  4XX2 A;  3CW9 A;  2VQE C;  4NOZ A;  4LE5 A;  3RG2 A;  4DR4 C;  4JI5 C;  2P2J A;  4KTT A;  4EAT A;  1MXB A;  3A9V A;  4LF5 C;  2D1S A;  4KTV A;  3ETC A;  4IR7 A;  5T8S A;  5K85 A;  3A4I A;  3VNS A;  4DV2 C;  2UUA C;  4JI8 C;  1HR0 C;  4TPS B;  2Y27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...