1I94C

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1i94C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1i94C02
1WF3A 3AF5A 2ZM6C 2UUCC 1HR0C 3IEUA 2ASBA 3JAMD 3IEVA 1UKKA 2HHHC 3AF6A 4DR2C 1N34C 3EERA 2XR1A 4DV4C 5FLXD 4OX9C 4GKKC 2UUBC 1PA4A 4YHHC 2E7GA 4JYAC 4JI0C 4JI6C 4LFCC 4LF6C 2ATWA 3LUSA 2VQEC 4NXMC 4LFAC 2ONFA 1ZB8A 4DUZC 4LF4C 4DCUA 1MKYA 4YY3C 1KKGA 5BR8C 4NXNC 4DV1C 1XNRC 4B3TC 2QL8A 5A2QD 1EGAA 4DR1C 3T1YC 1N32C 4DV5C 2E8CA 2DYJA 4JI8C 4KHPC 4NOZA 1I94C 4B3SC 2KZFA 3R9XA 2UXBC 4MH4A 1WH9A 3CJEA 2BJOA 1HNWC 4DCSA 1N2FA 1USPA 1JOSA 1XMOC 1XNQC 2D7VA 4X65C 1K0RA 4DV2C 2E8FA 4X62C 1ZB9A 2OPLA 4X64C 4JI7C 4B3RC 1IBKC 4DR3C 2UXDC 4JI5C 1XMQC 4LF7C 2E5LC 1HNXC 4JI2C 4DR7C 4MTNA 2PT7G 2HJGA 1LQLA 4LF9C 2CY1A 3GKUA 4JV5C 2E8EA 2VQFC 2EGTA 1IBMC 2UU9C 4B3MC 1N36C 4DV6C 5IWAC 1J5EC 1NYEA 5IT9D 1N33C 2YCBA 4LFBC 4DCVA 4GKJC 3R9WA 1VLAA 3J7AD 4DUYC 4K0KC 1HNZC 2CXCA 4BSZA 4X66C 3J80D 2JMPA 4DR5C 3J81D 1QWIA 4DV0C 2OPLB 4JI1C 4LF8C 4XX2A 2UXCC 2PN2A 4AQYC 5LMNC 2F4VC 4DR4C 1IBLC 1USPB 5LMUC 4DCTA 4DR6C 2UUAC 1HH2P 3I07A 3OTOC 4JI3C 3T1HC 4DV7C 1ML8A 4DV3C 1L2FA 4LF5C 1FJGC 4JI4C
chains in the Genus database with same CATH superfamily
3AF5A 4KTVA 2ZM6C 5K85A 4U5YD 1RY2A 1HR0C 3DHVA 3IEUA 4HPVA 2YX1A 3JAMD 4BBYA 4GS5A 3NYQA 2HHHC 2OO4A 1BA3A 4DV4C 2UUBC 2E7GA 4JI0C 5AE3A 4FTFA 1YGTA 4DG8A 2ATWA 5KYVA 4NXMC 3E7XA 4LFAC 2VSQA 1ZB8A 5CZVA 1MKYA 4DCUA 2QVXX 3GR1A 4YY3C 4R0MA 5AE2A 4B3TC 2QL8A 3IPLA 2P20A 1XRAA 4KHPC 4L7IA 4NOZA 3R9XA 3UX2A 4RVNA 2P2QA 4MH4A 3ETCA 4FUQA 4RM3A 1USPA 3DLPX 1JOSA 2P2BA 4X65C 5BUQA 2E8FA 5E7QA 4JI7C 1LCIA 2D1RA 1T5HX 4DR3C 2UXDC 5BSTA 2P02A 2M5HA 4R1LA 4MTNA 1P4EA 4LF9C 2CY1A 2QVYX 2VQFC 2EGTA 3L8CA 1O92A 1ULTA 3AY0A 1IBMC 3S82A 5BSVA 2Y4OA 4K0BA 3L95X 4B3MC 1N36C 5IWAC 1UWDA 4LFBC 4GKJC 2ZTBA 3DAYA 5BSUA 2M5OA 3A9VA 2JMPA 3SO4A 3FCEA 4LF8C 3RG2A 1PG4A 5DV9A 1IBLC 4WV3A 3OTOC 4JI3C 3NPDA 4DV7C 1ML8A 4DV3C 5KYTA 1QM4A 5CZXA 4RLFA 4NDNA 3A9UA 4FUTA 3VNRA 1MXCA 5A1GA 4D56A 2XR1A 5FLXD 4OX9C 1PA4A 4LFCC 2MM9A 5A19A 4LF6C 3LUSA 2VQEC 2MCQA 1XHJA 3R44A 2ONFA 3CQ2A 3A4IA 2CU6A 5BR8C 4NXNC 4DV1C 1MXBA 3PROC 1P4EC 1EGAA 1MDFA 4DV5C 4BC9A 2E8CA 5JRHA 4JI8C 3A25A 4B3SC 2KZFA 3CQ1A 1HNWC 1XNQC 1XMOC 4I9GA 2Z51A 4ISBA 4X64C 2P2FA 2JNVA 4DR7C 2HJGA 4PUIA 3GKUA 5H9UA 4JV5C 1O93A 1FLOA 1PG3A 3UOWA 3CW8X 3VNQA 3UX3A 4PROC 4G36A 3NYRA 5BSMA 4DV6C 4IZ6A 3PESA 1J5EC 1MXAA 2YCBA 3C5EA 4L4QA 2PROA 1VLAA 3J7AD 2D28C 2PG1E 4K0KC 4ODJA 4RVOA 4X66C 3N54B 4WS9A 4DV0C 2OPLB 5LMNC 5LMUC 3O2EA 3I07A 3N2QA 3T1HC 5T8TA 5BURA 1L2FA 3GR0A 1V25A 4LF5C 1YJ7A 2ZZNA 3E7WA 1VEHA 3UZ0A 2ASBA 2D1SA 1WCJA 4OYCA 2E0GA 1UKKA 4DR2C 1N34C 3EERA 1M6XA 4D4GA 4GKKC 4JI6C 4ZJZA 3CQ3A 1TH5A 1O9TA 3LNOA 1NY8A 1XRCA 1XNRC 2DHMA 1N32C 4DR1C 3T1YC 4PHTA 2DYJA 1MDBA 4D4IA 4KTTA 1XS3A 3CJEA 2BJOA 3LGXA 1V60A 5LCIA 3FCCA 1ZB9A 4B3RC 4PUGA 4RM2A 4BC7A 1AMUA 2P2JA 5BSWA 5GTDA 4LF7C 2E5LC 4JI2C 3GPCA 1XDXA 3RV2A 2PT7G 2BH1X 5K8FA 5AE1A 2NCLA 2P2MA 1FUGA 4TPSB 2QW0X 2V7BA 5IFIA 2ZZMA 2MMAB 2OBVA 2Y27A 5IT9D 4L2ZA 4RMNA 4DCVA 3ETOA 4G37A 4I9FA 4DUYC 5ADZA 4BSZA 4DR5C 3J81D 1M6XC 3LNVA 3VNSA 1USPB 3CW9A 1HH2P 5T8SA 1XRBA 5A1IA 3K6RA 4RLQA 5KEIA 1IB8A 1FJGC 2YWCA 1WF3A 2UUCC 3IEVA 3AF6A 2DPLA 4JYAC 4YHHC 5BUSA 3TDEA 4ZLPA 3G7SA 2D1QA 3UEBA 4OXIA 4DUZC 4LF4C 1KKGA 3IMLA 1V26A 1O90A 5A2QD 3TQIA 2KDNA 1I94C 5BSRA 3PBKA 3TUFA 2UXBC 1WH9A 4DCSA 1N2FA 2D7VA 1K0RA 4DV2C 2D1TA 4X62C 4EATA 2OPLA 4D57A 1IBKC 4JI5C 1XMQC 1HNXC 1MD9A 3EQ6A 3KXWA 1LQLA 1P7LA 2WD9A 2E8EA 4PUHA 2YWBA 4DG9A 3LAXA 4GXRA 2UU9C 2AYAA 1NYEA 4G1IA 2D27A 1N33C 4GXQA 4R1MA 3R9WA 1GPMA 2KZ0A 1HNZC 2CXCA 3H2TA 3J80D 2Y4NA 1RG9A 1QWIA 4IR7A 3I08A 3NI2A 4JI1C 4XX2A 2UXCC 2PN2A 3TR3A 4JM1A 4AQYC 2F4VC 4DR4C 3FM7A 1T5DX 2WP0C 4BCAA 4DCTA 2UUAC 4DR6C 4PZPA 2QVZX 3B7WA 4LE5A 2VZEA 1PU1A 3A26A 4JI4C
chains in the Genus database with same CATH topology
3AF5A 4KTVA 2ZM6C 5K85A 4U5YD 1RY2A 1HR0C 3DHVA 3IEUA 4HPVA 3JAMD 4BBYA 4GS5A 3NYQA 2HHHC 2OO4A 1BA3A 4DV4C 2UUBC 2E7GA 4JI0C 5AE3A 4FTFA 4DG8A 2ATWA 5KYVA 4NXMC 3E7XA 4LFAC 2VSQA 1ZB8A 5CZVA 1MKYA 4DCUA 2QVXX 3GR1A 4YY3C 4R0MA 5AE2A 4B3TC 2QL8A 3IPLA 2P20A 1XRAA 4KHPC 4L7IA 4NOZA 3R9XA 4RVNA 2P2QA 4MH4A 3ETCA 4FUQA 4RM3A 1USPA 3DLPX 1JOSA 2P2BA 4X65C 5BUQA 2E8FA 5E7QA 4JI7C 1LCIA 2D1RA 1T5HX 4DR3C 2UXDC 5BSTA 2P02A 4R1LA 4MTNA 4LF9C 2CY1A 2QVYX 2VQFC 2EGTA 3L8CA 1O92A 1ULTA 1IBMC 3S82A 5BSVA 2Y4OA 4K0BA 3L95X 4B3MC 1N36C 5IWAC 4LFBC 4GKJC 3DAYA 5BSUA 3A9VA 2JMPA 3SO4A 3FCEA 4LF8C 3RG2A 1PG4A 5DV9A 1IBLC 4WV3A 3OTOC 4JI3C 3NPDA 4DV7C 1ML8A 4DV3C 5KYTA 1QM4A 5CZXA 4RLFA 4NDNA 3A9UA 4FUTA 3VNRA 1MXCA 5A1GA 4D56A 2XR1A 5FLXD 4OX9C 1PA4A 4LFCC 5A19A 4LF6C 3LUSA 2VQEC 3R44A 2ONFA 3A4IA 5BR8C 4NXNC 4DV1C 1MXBA 3PROC 1EGAA 1MDFA 4DV5C 4BC9A 2E8CA 5JRHA 4JI8C 4B3SC 2KZFA 1HNWC 1XNQC 1XMOC 4I9GA 4ISBA 4X64C 2P2FA 4DR7C 2HJGA 3GKUA 5H9UA 4JV5C 1O93A 1PG3A 3UOWA 3CW8X 3VNQA 4PROC 4G36A 3NYRA 5BSMA 4DV6C 4IZ6A 3PESA 1J5EC 1MXAA 2YCBA 3C5EA 4L4QA 2PROA 1VLAA 3J7AD 2D28C 4K0KC 4ODJA 4RVOA 4X66C 3N54B 4WS9A 4DV0C 2OPLB 5LMNC 5LMUC 3I07A 3N2QA 3T1HC 5T8TA 5BURA 1L2FA 3GR0A 1V25A 4LF5C 1YJ7A 3E7WA 3UZ0A 2ASBA 2D1SA 4OYCA 2E0GA 1UKKA 4DR2C 1N34C 3EERA 4D4GA 4GKKC 4JI6C 4ZJZA 1O9TA 1XRCA 1XNRC 1N32C 4DR1C 3T1YC 4PHTA 2DYJA 1MDBA 4D4IA 4KTTA 3CJEA 2BJOA 3LGXA 3FCCA 1ZB9A 4B3RC 4RM2A 4BC7A 1AMUA 2P2JA 5BSWA 5GTDA 4LF7C 2E5LC 4JI2C 3GPCA 3RV2A 2PT7G 2BH1X 5K8FA 5AE1A 2P2MA 1FUGA 4TPSB 2QW0X 2V7BA 5IFIA 2OBVA 2Y27A 5IT9D 4L2ZA 4RMNA 4DCVA 3ETOA 4G37A 4I9FA 4DUYC 5ADZA 4BSZA 4DR5C 3J81D 3LNVA 3VNSA 1USPB 3CW9A 1HH2P 5T8SA 1XRBA 5A1IA 4RLQA 5KEIA 1FJGC 2YWCA 1WF3A 2UUCC 3IEVA 3AF6A 2DPLA 4JYAC 4YHHC 5BUSA 3TDEA 4ZLPA 3G7SA 2D1QA 4OXIA 4DUZC 4LF4C 1KKGA 3IMLA 1V26A 1O90A 5A2QD 3TQIA 1I94C 5BSRA 3PBKA 3TUFA 2UXBC 1WH9A 4DCSA 1N2FA 2D7VA 1K0RA 4DV2C 2D1TA 4X62C 4EATA 2OPLA 4D57A 1IBKC 4JI5C 1XMQC 1HNXC 1MD9A 3EQ6A 3KXWA 1LQLA 1P7LA 2WD9A 2E8EA 2YWBA 4DG9A 3LAXA 4GXRA 2UU9C 2AYAA 1NYEA 4G1IA 2D27A 1N33C 4GXQA 4R1MA 3R9WA 1GPMA 1HNZC 2CXCA 3H2TA 3J80D 2Y4NA 1RG9A 1QWIA 4IR7A 3I08A 3NI2A 4JI1C 4XX2A 2UXCC 2PN2A 4AQYC 4JM1A 2F4VC 4DR4C 1T5DX 2WP0C 4BCAA 4DCTA 2UUAC 4DR6C 4PZPA 2QVZX 3B7WA 4LE5A 2VZEA 4JI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF3 A;  3AF5 A;  2ZM6 C;  2UUC C;  1HR0 C;  3IEU A;  2ASB A;  3JAM D;  3IEV A;  1UKK A;  2HHH C;  3AF6 A;  4DR2 C;  1N34 C;  3EER A;  2XR1 A;  4DV4 C;  5FLX D;  4OX9 C;  4GKK C;  2UUB C;  1PA4 A;  4YHH C;  2E7G A;  4JYA C;  4JI0 C;  4JI6 C;  4LFC C;  4LF6 C;  2ATW A;  3LUS A;  2VQE C;  4NXM C;  4LFA C;  2ONF A;  1ZB8 A;  4DUZ C;  4LF4 C;  4DCU A;  1MKY A;  4YY3 C;  1KKG A;  5BR8 C;  4NXN C;  4DV1 C;  1XNR C;  4B3T C;  2QL8 A;  5A2Q D;  1EGA A;  4DR1 C;  3T1Y C;  1N32 C;  4DV5 C;  2E8C A;  2DYJ A;  4JI8 C;  4KHP C;  4NOZ A;  1I94 C;  4B3S C;  2KZF A;  3R9X A;  2UXB C;  4MH4 A;  1WH9 A;  3CJE A;  2BJO A;  1HNW C;  4DCS A;  1N2F A;  1USP A;  1JOS A;  1XMO C;  1XNQ C;  2D7V A;  4X65 C;  1K0R A;  4DV2 C;  2E8F A;  4X62 C;  1ZB9 A;  2OPL A;  4X64 C;  4JI7 C;  4B3R C;  1IBK C;  4DR3 C;  2UXD C;  4JI5 C;  1XMQ C;  4LF7 C;  2E5L C;  1HNX C;  4JI2 C;  4DR7 C;  4MTN A;  2PT7 G;  2HJG A;  1LQL A;  4LF9 C;  2CY1 A;  3GKU A;  4JV5 C;  2E8E A;  2VQF C;  2EGT A;  1IBM C;  2UU9 C;  4B3M C;  1N36 C;  4DV6 C;  5IWA C;  1J5E C;  1NYE A;  5IT9 D;  1N33 C;  2YCB A;  4LFB C;  4DCV A;  4GKJ C;  3R9W A;  1VLA A;  3J7A D;  4DUY C;  4K0K C;  1HNZ C;  2CXC A;  4BSZ A;  4X66 C;  3J80 D;  2JMP A;  4DR5 C;  3J81 D;  1QWI A;  4DV0 C;  2OPL B;  4JI1 C;  4LF8 C;  4XX2 A;  2UXC C;  2PN2 A;  4AQY C;  5LMN C;  2F4V C;  4DR4 C;  1IBL C;  1USP B;  5LMU C;  4DCT A;  4DR6 C;  2UUA C;  1HH2 P;  3I07 A;  3OTO C;  4JI3 C;  3T1H C;  4DV7 C;  1ML8 A;  4DV3 C;  1L2F A;  4LF5 C;  1FJG C;  4JI4 C; 
#chains in the Genus database with same CATH topology
 3AF5 A;  4KTV A;  2ZM6 C;  5K85 A;  4U5Y D;  1RY2 A;  1HR0 C;  3DHV A;  3IEU A;  4HPV A;  2YX1 A;  3JAM D;  4BBY A;  4GS5 A;  3NYQ A;  2HHH C;  2OO4 A;  1BA3 A;  4DV4 C;  2UUB C;  2E7G A;  4JI0 C;  5AE3 A;  4FTF A;  1YGT A;  4DG8 A;  2ATW A;  5KYV A;  4NXM C;  3E7X A;  4LFA C;  2VSQ A;  1ZB8 A;  5CZV A;  1MKY A;  4DCU A;  2QVX X;  3GR1 A;  4YY3 C;  4R0M A;  5AE2 A;  4B3T C;  2QL8 A;  3IPL A;  2P20 A;  1XRA A;  4KHP C;  4L7I A;  4NOZ A;  3R9X A;  3UX2 A;  4RVN A;  2P2Q A;  4MH4 A;  3ETC A;  4FUQ A;  4RM3 A;  1USP A;  3DLP X;  1JOS A;  2P2B A;  4X65 C;  5BUQ A;  2E8F A;  5E7Q A;  4JI7 C;  1LCI A;  2D1R A;  1T5H X;  4DR3 C;  2UXD C;  5BST A;  2P02 A;  2M5H A;  4R1L A;  4MTN A;  1P4E A;  4LF9 C;  2CY1 A;  2QVY X;  2VQF C;  2EGT A;  3L8C A;  1O92 A;  1ULT A;  3AY0 A;  1IBM C;  3S82 A;  5BSV A;  2Y4O A;  4K0B A;  3L95 X;  4B3M C;  1N36 C;  5IWA C;  1UWD A;  4LFB C;  4GKJ C;  2ZTB A;  3DAY A;  5BSU A;  2M5O A;  3A9V A;  2JMP A;  3SO4 A;  3FCE A;  4LF8 C;  3RG2 A;  1PG4 A;  5DV9 A;  1IBL C;  4WV3 A;  3OTO C;  4JI3 C;  3NPD A;  4DV7 C;  1ML8 A;  4DV3 C;  5KYT A;  1QM4 A;  5CZX A;  4RLF A;  4NDN A;  3A9U A;  4FUT A;  3VNR A;  1MXC A;  5A1G A;  4D56 A;  2XR1 A;  5FLX D;  4OX9 C;  1PA4 A;  4LFC C;  2MM9 A;  5A19 A;  4LF6 C;  3LUS A;  2VQE C;  2MCQ A;  1XHJ A;  3R44 A;  2ONF A;  3CQ2 A;  3A4I A;  2CU6 A;  5BR8 C;  4NXN C;  4DV1 C;  1MXB A;  3PRO C;  1P4E C;  1EGA A;  1MDF A;  4DV5 C;  4BC9 A;  2E8C A;  5JRH A;  4JI8 C;  3A25 A;  4B3S C;  2KZF A;  3CQ1 A;  1HNW C;  1XNQ C;  1XMO C;  4I9G A;  2Z51 A;  4ISB A;  4X64 C;  2P2F A;  2JNV A;  4DR7 C;  2HJG A;  4PUI A;  3GKU A;  5H9U A;  4JV5 C;  1O93 A;  1FLO A;  1PG3 A;  3UOW A;  3CW8 X;  3VNQ A;  3UX3 A;  4PRO C;  4G36 A;  3NYR A;  5BSM A;  4DV6 C;  4IZ6 A;  3PES A;  1J5E C;  1MXA A;  2YCB A;  3C5E A;  4L4Q A;  2PRO A;  1VLA A;  3J7A D;  2D28 C;  2PG1 E;  4K0K C;  4ODJ A;  4RVO A;  4X66 C;  3N54 B;  4WS9 A;  4DV0 C;  2OPL B;  5LMN C;  5LMU C;  3O2E A;  3I07 A;  3N2Q A;  3T1H C;  5T8T A;  5BUR A;  1L2F A;  3GR0 A;  1V25 A;  4LF5 C;  1YJ7 A;  2ZZN A;  3E7W A;  1VEH A;  3UZ0 A;  2ASB A;  2D1S A;  1WCJ A;  4OYC A;  2E0G A;  1UKK A;  4DR2 C;  1N34 C;  3EER A;  1M6X A;  4D4G A;  4GKK C;  4JI6 C;  4ZJZ A;  3CQ3 A;  1TH5 A;  1O9T A;  3LNO A;  1NY8 A;  1XRC A;  1XNR C;  2DHM A;  1N32 C;  4DR1 C;  3T1Y C;  4PHT A;  2DYJ A;  1MDB A;  4D4I A;  4KTT A;  1XS3 A;  3CJE A;  2BJO A;  3LGX A;  1V60 A;  5LCI A;  3FCC A;  1ZB9 A;  4B3R C;  4PUG A;  4RM2 A;  4BC7 A;  1AMU A;  2P2J A;  5BSW A;  5GTD A;  4LF7 C;  2E5L C;  4JI2 C;  3GPC A;  1XDX A;  3RV2 A;  2PT7 G;  2BH1 X;  5K8F A;  5AE1 A;  2NCL A;  2P2M A;  1FUG A;  4TPS B;  2QW0 X;  2V7B A;  5IFI A;  2ZZM A;  2MMA B;  2OBV A;  2Y27 A;  5IT9 D;  4L2Z A;  4RMN A;  4DCV A;  3ETO A;  4G37 A;  4I9F A;  4DUY C;  5ADZ A;  4BSZ A;  4DR5 C;  3J81 D;  1M6X C;  3LNV A;  3VNS A;  1USP B;  3CW9 A;  1HH2 P;  5T8S A;  1XRB A;  5A1I A;  3K6R A;  4RLQ A;  5KEI A;  1IB8 A;  1FJG C;  2YWC A;  1WF3 A;  2UUC C;  3IEV A;  3AF6 A;  2DPL A;  4JYA C;  4YHH C;  5BUS A;  3TDE A;  4ZLP A;  3G7S A;  2D1Q A;  3UEB A;  4OXI A;  4DUZ C;  4LF4 C;  1KKG A;  3IML A;  1V26 A;  1O90 A;  5A2Q D;  3TQI A;  2KDN A;  1I94 C;  5BSR A;  3PBK A;  3TUF A;  2UXB C;  1WH9 A;  4DCS A;  1N2F A;  2D7V A;  1K0R A;  4DV2 C;  2D1T A;  4X62 C;  4EAT A;  2OPL A;  4D57 A;  1IBK C;  4JI5 C;  1XMQ C;  1HNX C;  1MD9 A;  3EQ6 A;  3KXW A;  1LQL A;  1P7L A;  2WD9 A;  2E8E A;  4PUH A;  2YWB A;  4DG9 A;  3LAX A;  4GXR A;  2UU9 C;  2AYA A;  1NYE A;  4G1I A;  2D27 A;  1N33 C;  4GXQ A;  4R1M A;  3R9W A;  1GPM A;  2KZ0 A;  1HNZ C;  2CXC A;  3H2T A;  3J80 D;  2Y4N A;  1RG9 A;  1QWI A;  4IR7 A;  3I08 A;  3NI2 A;  4JI1 C;  4XX2 A;  2UXC C;  2PN2 A;  3TR3 A;  4JM1 A;  4AQY C;  2F4V C;  4DR4 C;  3FM7 A;  1T5D X;  2WP0 C;  4BCA A;  4DCT A;  2UUA C;  4DR6 C;  4PZP A;  2QVZ X;  3B7W A;  4LE5 A;  2VZE A;  1PU1 A;  3A26 A;  4JI4 C; 
#chains in the Genus database with same CATH homology
 3AF5 A;  4KTV A;  2ZM6 C;  5K85 A;  4U5Y D;  1RY2 A;  1HR0 C;  3DHV A;  3IEU A;  4HPV A;  3JAM D;  4BBY A;  4GS5 A;  3NYQ A;  2HHH C;  2OO4 A;  1BA3 A;  4DV4 C;  2UUB C;  2E7G A;  4JI0 C;  5AE3 A;  4FTF A;  4DG8 A;  2ATW A;  5KYV A;  4NXM C;  3E7X A;  4LFA C;  2VSQ A;  1ZB8 A;  5CZV A;  1MKY A;  4DCU A;  2QVX X;  3GR1 A;  4YY3 C;  4R0M A;  5AE2 A;  4B3T C;  2QL8 A;  3IPL A;  2P20 A;  1XRA A;  4KHP C;  4L7I A;  4NOZ A;  3R9X A;  4RVN A;  2P2Q A;  4MH4 A;  3ETC A;  4FUQ A;  4RM3 A;  1USP A;  3DLP X;  1JOS A;  2P2B A;  4X65 C;  5BUQ A;  2E8F A;  5E7Q A;  4JI7 C;  1LCI A;  2D1R A;  1T5H X;  4DR3 C;  2UXD C;  5BST A;  2P02 A;  4R1L A;  4MTN A;  4LF9 C;  2CY1 A;  2QVY X;  2VQF C;  2EGT A;  3L8C A;  1O92 A;  1ULT A;  1IBM C;  3S82 A;  5BSV A;  2Y4O A;  4K0B A;  3L95 X;  4B3M C;  1N36 C;  5IWA C;  4LFB C;  4GKJ C;  3DAY A;  5BSU A;  3A9V A;  2JMP A;  3SO4 A;  3FCE A;  4LF8 C;  3RG2 A;  1PG4 A;  5DV9 A;  1IBL C;  4WV3 A;  3OTO C;  4JI3 C;  3NPD A;  4DV7 C;  1ML8 A;  4DV3 C;  5KYT A;  1QM4 A;  5CZX A;  4RLF A;  4NDN A;  3A9U A;  4FUT A;  3VNR A;  1MXC A;  5A1G A;  4D56 A;  2XR1 A;  5FLX D;  4OX9 C;  1PA4 A;  4LFC C;  5A19 A;  4LF6 C;  3LUS A;  2VQE C;  3R44 A;  2ONF A;  3A4I A;  5BR8 C;  4NXN C;  4DV1 C;  1MXB A;  3PRO C;  1EGA A;  1MDF A;  4DV5 C;  4BC9 A;  2E8C A;  5JRH A;  4JI8 C;  4B3S C;  2KZF A;  1HNW C;  1XNQ C;  1XMO C;  4I9G A;  4ISB A;  4X64 C;  2P2F A;  4DR7 C;  2HJG A;  3GKU A;  5H9U A;  4JV5 C;  1O93 A;  1PG3 A;  3UOW A;  3CW8 X;  3VNQ A;  4PRO C;  4G36 A;  3NYR A;  5BSM A;  4DV6 C;  4IZ6 A;  3PES A;  1J5E C;  1MXA A;  2YCB A;  3C5E A;  4L4Q A;  2PRO A;  1VLA A;  3J7A D;  2D28 C;  4K0K C;  4ODJ A;  4RVO A;  4X66 C;  3N54 B;  4WS9 A;  4DV0 C;  2OPL B;  5LMN C;  5LMU C;  3I07 A;  3N2Q A;  3T1H C;  5T8T A;  5BUR A;  1L2F A;  3GR0 A;  1V25 A;  4LF5 C;  1YJ7 A;  3E7W A;  3UZ0 A;  2ASB A;  2D1S A;  4OYC A;  2E0G A;  1UKK A;  4DR2 C;  1N34 C;  3EER A;  4D4G A;  4GKK C;  4JI6 C;  4ZJZ A;  1O9T A;  1XRC A;  1XNR C;  1N32 C;  4DR1 C;  3T1Y C;  4PHT A;  2DYJ A;  1MDB A;  4D4I A;  4KTT A;  3CJE A;  2BJO A;  3LGX A;  3FCC A;  1ZB9 A;  4B3R C;  4RM2 A;  4BC7 A;  1AMU A;  2P2J A;  5BSW A;  5GTD A;  4LF7 C;  2E5L C;  4JI2 C;  3GPC A;  3RV2 A;  2PT7 G;  2BH1 X;  5K8F A;  5AE1 A;  2P2M A;  1FUG A;  4TPS B;  2QW0 X;  2V7B A;  5IFI A;  2OBV A;  2Y27 A;  5IT9 D;  4L2Z A;  4RMN A;  4DCV A;  3ETO A;  4G37 A;  4I9F A;  4DUY C;  5ADZ A;  4BSZ A;  4DR5 C;  3J81 D;  3LNV A;  3VNS A;  1USP B;  3CW9 A;  1HH2 P;  5T8S A;  1XRB A;  5A1I A;  4RLQ A;  5KEI A;  1FJG C;  2YWC A;  1WF3 A;  2UUC C;  3IEV A;  3AF6 A;  2DPL A;  4JYA C;  4YHH C;  5BUS A;  3TDE A;  4ZLP A;  3G7S A;  2D1Q A;  4OXI A;  4DUZ C;  4LF4 C;  1KKG A;  3IML A;  1V26 A;  1O90 A;  5A2Q D;  3TQI A;  1I94 C;  5BSR A;  3PBK A;  3TUF A;  2UXB C;  1WH9 A;  4DCS A;  1N2F A;  2D7V A;  1K0R A;  4DV2 C;  2D1T A;  4X62 C;  4EAT A;  2OPL A;  4D57 A;  1IBK C;  4JI5 C;  1XMQ C;  1HNX C;  1MD9 A;  3EQ6 A;  3KXW A;  1LQL A;  1P7L A;  2WD9 A;  2E8E A;  2YWB A;  4DG9 A;  3LAX A;  4GXR A;  2UU9 C;  2AYA A;  1NYE A;  4G1I A;  2D27 A;  1N33 C;  4GXQ A;  4R1M A;  3R9W A;  1GPM A;  1HNZ C;  2CXC A;  3H2T A;  3J80 D;  2Y4N A;  1RG9 A;  1QWI A;  4IR7 A;  3I08 A;  3NI2 A;  4JI1 C;  4XX2 A;  2UXC C;  2PN2 A;  4AQY C;  4JM1 A;  2F4V C;  4DR4 C;  1T5D X;  2WP0 C;  4BCA A;  4DCT A;  2UUA C;  4DR6 C;  4PZP A;  2QVZ X;  3B7W A;  4LE5 A;  2VZE A;  4JI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...