1I94C

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1i94C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1i94C02
1UKKA 1XMOC 1N36C 4DR7C 2HJGA 4DR3C 3JAMD 4GKKC 4DV3C 2UUCC 5IWAC 4X62C 4DR5C 4MTNA 1KKGA 4DCTA 4JI0C 2UXDC 4OX9C 2QL8A 1XMQC 4DCUA 4LF7C 2ATWA 4XX2A 3IEUA 1N34C 1HNXC 4KHPC 4JYAC 1QWIA 2PT7G 4K0KC 1L2FA 2DYJA 3J81D 5A2QD 4NXMC 2VQFC 2JMPA 3IEVA 4DV4C 1I94C 2E8FA 1IBKC 4JI4C 5FLXD 1HR0C 4LFCC 3J7AD 1WH9A 1FJGC 1PA4A 4DCSA 4JI5C 1NYEA 5IT9D 1HH2P 3LUSA 4AQYC 1J5EC 2VQEC 4JI1C 4DV7C 1MKYA 1XNRC 1USPB 1JOSA 4DV0C 4LFBC 5LMUC 2YCBA 4B3SC 1IBLC 4GKJC 2OPLB 4DV6C 1N32C 2XR1A 1XNQC 4DR4C 4LF4C 2UXBC 4YHHC 3GKUA 1EGAA 5BR8C 1N2FA 1ZB9A 2UU9C 2F4VC 2KZFA 4DV2C 2HHHC 2PN2A 2BJOA 5LMNC 2UUBC 1ZB8A 4LF8C 4MH4A 4YY3C 4B3RC 2E8EA 2CY1A 4X66C 3OTOC 3AF6A 1N33C 2ZM6C 2ONFA 4JI6C 4NOZA 4DV5C 4LF6C 4JI3C 3R9XA 4DR6C 1HNZC 2CXCA 4JV5C 2UXCC 4LF9C 1HNWC 4DR1C 4B3MC 4DCVA 4DV1C 2E5LC 2UUAC 3T1HC 4NXNC 3R9WA 2D7VA 2EGTA 4DUYC 4JI7C 4JI2C 1IBMC 4X65C 2ASBA 4B3TC 4LFAC 1K0RA 1USPA 3EERA 4BSZA 4X64C 1WF3A 1VLAA 1ML8A 3T1YC 3J80D 4DUZC 2OPLA 4LF5C 3CJEA 4DR2C 2E7GA 3AF5A 2E8CA 1LQLA 4JI8C 3I07A
chains in the Genus database with same CATH superfamily
1UKKA 2M5HA 1MXAA 2HJGA 4DR3C 3JAMD 3E7XA 4GKKC 4I9FA 5BSRA 4DV3C 2ZZNA 5BURA 4OX9C 3TR3A 2QL8A 4LF7C 2OBVA 4FTFA 4XX2A 2D27A 1N34C 3PROC 4JYAC 4PUGA 1YJ7A 1V25A 3CW8X 4RM2A 4NXMC 2JMPA 4R0MA 3IEVA 2QVZX 1I94C 5BSUA 2E8FA 4BC7A 4LFCC 3FM7A 5KEIA 1WH9A 2VSQA 2D1SA 1XHJA 3LNVA 1VEHA 4JI1C 1XNRC 1JOSA 4GKJC 2YCBA 1IB8A 1N32C 2Y4NA 4DR4C 1FUGA 4R1LA 5AE1A 1EGAA 5H9UA 5T8SA 5KYVA 4BCAA 3NPDA 4RVOA 2Y27A 4PHTA 4B3RC 1PU1A 4LE5A 3OTOC 4X66C 4PZPA 4JI6C 4NOZA 4BBYA 4DR6C 1HNZC 2CXCA 2UXCC 4DR1C 3R44A 4DCVA 4DV1C 1BA3A 3T1HC 5AE3A 4NXNC 3CQ3A 3CW9A 2ASBA 4PUHA 4BSZA 1NY8A 1WF3A 1ML8A 1MXCA 3T1YC 4L2ZA 2E7GA 3FCCA 3CQ2A 5ADZA 1T5DX 2VZEA 4FUTA 4D57A 4DR7C 2OO4A 4K0BA 4JI0C 1XDXA 4OYCA 3DLPX 4DCUA 1YGTA 1RY2A 3GR1A 2NCLA 4GS5A 2P2JA 3IEUA 2P2FA 3L95X 2PT7G 2DYJA 5A1IA 5K85A 3J81D 3AY0A 2VQFC 2BH1X 4DV4C 1IBKC 3UZ0A 3A9UA 2KZ0A 1O92A 4NDNA 3UEBA 2KDNA 5KYTA 1M6XC 4I9GA 3RG2A 1NYEA 3PESA 3K6RA 4AQYC 2VQEC 2P2BA 1WCJA 1USPB 4G37A 4DV0C 4LFBC 4DV6C 2WD9A 5CZXA 5IFIA 1M6XA 2AYAA 4YHHC 5BR8C 3TQIA 1N2FA 1P4EA 5AE2A 3LAXA 5DV9A 2HHHC 3KXWA 2MCQA 5LMNC 4D4GA 3AF6A 2D28C 2ONFA 5E7QA 5BSVA 3VNRA 4DV5C 1ULTA 4LF6C 3UX3A 4WV3A 4JV5C 2CU6A 1HNWC 4KTVA 2YX1A 2E5LC 2EGTA 2YWBA 4JI7C 1XRBA 3RV2A 4LFAC 1USPA 3ETOA 1PG3A 4X64C 3LGXA 4RLFA 4ODJA 4DUZC 1MDFA 3CJEA 1XS3A 4RMNA 3AF5A 3GR0A 2PG1E 3E7WA 4JI8C 1MXBA 2YWCA 3TDEA 3G7SA 5BUQA 4RM3A 4TPSB 2D1QA 1MDBA 4L4QA 2D1RA 2UUCC 5CZVA 5IWAC 4X62C 1T5HX 4MTNA 4DR5C 4ZLPA 5A1GA 1KKGA 1LCIA 1FLOA 4RLQA 1MD9A 3C5EA 2ATWA 2P02A 4KHPC 3NI2A 4GXQA 3UX2A 1L2FA 2P2MA 4WS9A 5A2QD 2WP0C 2ZTBA 4G1IA 5BSWA 4JI4C 4JM1A 5FLXD 1PA4A 4DCSA 4JI5C 4L7IA 2ZZMA 1HH2P 4DG8A 3NYQA 1UWDA 1RG9A 2MM9A 4PROC 4DV7C 4OXIA 3A25A 5LMUC 1O9TA 1O93A 3LNOA 2OPLB 3IMLA 1IBLC 1O90A 2V7BA 1V60A 2UU9C 3IPLA 2BJOA 1ZB8A 4LF8C 4YY3C 2E8EA 1P4EC 1N33C 2ZM6C 5BSMA 3TUFA 4D56A 2QVXX 4JI3C 3VNSA 4KTTA 2PROA 4DG9A 2DHMA 4LF9C 4B3MC 4IZ6A 3DAYA 3R9WA 2D7VA 5T8TA 4DUYC 4JI2C 1IBMC 4X65C 5GTDA 1K0RA 3EERA 3NYRA 2QW0X 4FUQA 4HPVA 2OPLA 4DR2C 3I07A 3DHVA 2UXBC 4G36A 1TH5A 1XMOC 5A19A 1N36C 3I08A 2Y4OA 3O2EA 4DCTA 2UXDC 5K8FA 4D4IA 1AMUA 1XMQC 5BUSA 4U5YD 1HNXC 3A4IA 3B7WA 1QWIA 4K0KC 3GPCA 4IR7A 5LCIA 4PUIA 1HR0C 3J7AD 4R1MA 5JRHA 1FJGC 3H2TA 1PG4A 5IT9D 3LUSA 1J5EC 3ETCA 4RVNA 1MKYA 2Z51A 2D1TA 1V26A 2P20A 4B3SC 2QVYX 2M5OA 1XRCA 2XR1A 1XNQC 4LF4C 1XRAA 3GKUA 3EQ6A 1ZB9A 3CQ1A 2F4VC 2KZFA 3FCEA 4DV2C 3A26A 4ISBA 2PN2A 2UUBC 2P2QA 4MH4A 2CY1A 1GPMA 5BSTA 3VNQA 3R9XA 2MMAB 2E0GA 2JNVA 2UUAC 1P7LA 2DPLA 4BC9A 1QM4A 4B3TC 3N54B 4GXRA 1VLAA 4ZJZA 3UOWA 3J80D 4LF5C 3N2QA 3S82A 2E8CA 1LQLA 4EATA 3SO4A 3A9VA 3PBKA 3L8CA
chains in the Genus database with same CATH topology
1UKKA 1MXAA 2HJGA 4DR3C 3JAMD 3E7XA 4GKKC 4I9FA 5BSRA 4DV3C 5BURA 4OX9C 2QL8A 4LF7C 2OBVA 4FTFA 4XX2A 2D27A 1N34C 3PROC 4JYAC 1YJ7A 1V25A 3CW8X 4RM2A 4NXMC 2JMPA 4R0MA 3IEVA 2QVZX 1I94C 5BSUA 2E8FA 4BC7A 4LFCC 5KEIA 1WH9A 2VSQA 2D1SA 3LNVA 4JI1C 1XNRC 1JOSA 4GKJC 2YCBA 1N32C 2Y4NA 4DR4C 1FUGA 4R1LA 5AE1A 1EGAA 5H9UA 5T8SA 5KYVA 4BCAA 3NPDA 4RVOA 2Y27A 4PHTA 4B3RC 4LE5A 3OTOC 4X66C 4PZPA 4JI6C 4NOZA 4BBYA 4DR6C 1HNZC 2CXCA 2UXCC 4DR1C 3R44A 4DCVA 4DV1C 1BA3A 3T1HC 5AE3A 4NXNC 3CW9A 2ASBA 4BSZA 1WF3A 3T1YC 1ML8A 1MXCA 4L2ZA 2E7GA 3FCCA 5ADZA 1T5DX 2VZEA 4FUTA 4D57A 4DR7C 2OO4A 4K0BA 4JI0C 4OYCA 3DLPX 4DCUA 1RY2A 3GR1A 4GS5A 2P2JA 3IEUA 2P2FA 3L95X 2PT7G 2DYJA 5A1IA 5K85A 3J81D 2VQFC 2BH1X 4DV4C 1IBKC 3UZ0A 3A9UA 1O92A 4NDNA 5KYTA 4I9GA 3RG2A 1NYEA 3PESA 4AQYC 2VQEC 2P2BA 1USPB 4G37A 4DV0C 4LFBC 4DV6C 2WD9A 5CZXA 5IFIA 2AYAA 4YHHC 5BR8C 3TQIA 1N2FA 5AE2A 3LAXA 5DV9A 2HHHC 3KXWA 5LMNC 4D4GA 3AF6A 2D28C 2ONFA 5E7QA 5BSVA 3VNRA 4DV5C 1ULTA 4LF6C 4WV3A 4JV5C 1HNWC 4KTVA 2E5LC 2EGTA 2YWBA 4JI7C 1XRBA 3RV2A 4LFAC 1USPA 3ETOA 1PG3A 4X64C 3LGXA 4RLFA 4ODJA 4DUZC 1MDFA 3CJEA 4RMNA 3AF5A 3GR0A 3E7WA 4JI8C 1MXBA 2YWCA 3TDEA 3G7SA 5BUQA 4RM3A 4TPSB 2D1QA 1MDBA 4L4QA 2D1RA 2UUCC 5CZVA 5IWAC 4X62C 1T5HX 4MTNA 4DR5C 4ZLPA 5A1GA 1KKGA 1LCIA 4RLQA 1MD9A 3C5EA 2ATWA 2P02A 4KHPC 3NI2A 4GXQA 1L2FA 2P2MA 4WS9A 5A2QD 2WP0C 4G1IA 5BSWA 4JI4C 4JM1A 5FLXD 1PA4A 4DCSA 4JI5C 4L7IA 1HH2P 4DG8A 3NYQA 1RG9A 4PROC 4DV7C 4OXIA 5LMUC 1O9TA 1O93A 1IBLC 2OPLB 3IMLA 1O90A 2V7BA 2UU9C 3IPLA 2BJOA 1ZB8A 4LF8C 4YY3C 2E8EA 1N33C 2ZM6C 5BSMA 3TUFA 4D56A 2QVXX 4JI3C 3VNSA 4KTTA 2PROA 4DG9A 4LF9C 4B3MC 4IZ6A 3DAYA 3R9WA 2D7VA 5T8TA 4DUYC 4JI2C 1IBMC 4X65C 5GTDA 1K0RA 3EERA 3NYRA 2QW0X 4FUQA 4HPVA 2OPLA 4DR2C 3I07A 3DHVA 2UXBC 4G36A 1XMOC 5A19A 1N36C 3I08A 2Y4OA 4DCTA 2UXDC 5K8FA 4D4IA 1AMUA 1XMQC 5BUSA 4U5YD 1HNXC 3A4IA 3B7WA 1QWIA 4K0KC 3GPCA 4IR7A 1HR0C 3J7AD 4R1MA 5JRHA 1FJGC 3H2TA 1PG4A 5IT9D 3LUSA 1J5EC 3ETCA 4RVNA 1MKYA 2D1TA 1V26A 2P20A 4B3SC 2QVYX 1XRCA 2XR1A 1XNQC 4LF4C 1XRAA 3GKUA 3EQ6A 1ZB9A 2F4VC 2KZFA 3FCEA 4DV2C 4ISBA 2PN2A 2UUBC 2P2QA 4MH4A 2CY1A 1GPMA 5BSTA 3VNQA 3R9XA 2E0GA 2UUAC 1P7LA 2DPLA 4BC9A 1QM4A 4B3TC 3N54B 4GXRA 1VLAA 4ZJZA 3UOWA 3J80D 4LF5C 3N2QA 3S82A 2E8CA 1LQLA 4EATA 3SO4A 3A9VA 3PBKA 3L8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKK A;  1XMO C;  1N36 C;  4DR7 C;  2HJG A;  4DR3 C;  3JAM D;  4GKK C;  4DV3 C;  2UUC C;  5IWA C;  4X62 C;  4DR5 C;  4MTN A;  1KKG A;  4DCT A;  4JI0 C;  2UXD C;  4OX9 C;  2QL8 A;  1XMQ C;  4DCU A;  4LF7 C;  2ATW A;  4XX2 A;  3IEU A;  1N34 C;  1HNX C;  4KHP C;  4JYA C;  1QWI A;  2PT7 G;  4K0K C;  1L2F A;  2DYJ A;  3J81 D;  5A2Q D;  4NXM C;  2VQF C;  2JMP A;  3IEV A;  4DV4 C;  1I94 C;  2E8F A;  1IBK C;  4JI4 C;  5FLX D;  1HR0 C;  4LFC C;  3J7A D;  1WH9 A;  1FJG C;  1PA4 A;  4DCS A;  4JI5 C;  1NYE A;  5IT9 D;  1HH2 P;  3LUS A;  4AQY C;  1J5E C;  2VQE C;  4JI1 C;  4DV7 C;  1MKY A;  1XNR C;  1USP B;  1JOS A;  4DV0 C;  4LFB C;  5LMU C;  2YCB A;  4B3S C;  1IBL C;  4GKJ C;  2OPL B;  4DV6 C;  1N32 C;  2XR1 A;  1XNQ C;  4DR4 C;  4LF4 C;  2UXB C;  4YHH C;  3GKU A;  1EGA A;  5BR8 C;  1N2F A;  1ZB9 A;  2UU9 C;  2F4V C;  2KZF A;  4DV2 C;  2HHH C;  2PN2 A;  2BJO A;  5LMN C;  2UUB C;  1ZB8 A;  4LF8 C;  4MH4 A;  4YY3 C;  4B3R C;  2E8E A;  2CY1 A;  4X66 C;  3OTO C;  3AF6 A;  1N33 C;  2ZM6 C;  2ONF A;  4JI6 C;  4NOZ A;  4DV5 C;  4LF6 C;  4JI3 C;  3R9X A;  4DR6 C;  1HNZ C;  2CXC A;  4JV5 C;  2UXC C;  4LF9 C;  1HNW C;  4DR1 C;  4B3M C;  4DCV A;  4DV1 C;  2E5L C;  2UUA C;  3T1H C;  4NXN C;  3R9W A;  2D7V A;  2EGT A;  4DUY C;  4JI7 C;  4JI2 C;  1IBM C;  4X65 C;  2ASB A;  4B3T C;  4LFA C;  1K0R A;  1USP A;  3EER A;  4BSZ A;  4X64 C;  1WF3 A;  1VLA A;  1ML8 A;  3T1Y C;  3J80 D;  4DUZ C;  2OPL A;  4LF5 C;  3CJE A;  4DR2 C;  2E7G A;  3AF5 A;  2E8C A;  1LQL A;  4JI8 C;  3I07 A; 
#chains in the Genus database with same CATH topology
 1UKK A;  2M5H A;  1MXA A;  2HJG A;  4DR3 C;  3JAM D;  3E7X A;  4GKK C;  4I9F A;  5BSR A;  4DV3 C;  2ZZN A;  5BUR A;  4OX9 C;  3TR3 A;  2QL8 A;  4LF7 C;  2OBV A;  4FTF A;  4XX2 A;  2D27 A;  1N34 C;  3PRO C;  4JYA C;  4PUG A;  1YJ7 A;  1V25 A;  3CW8 X;  4RM2 A;  4NXM C;  2JMP A;  4R0M A;  3IEV A;  2QVZ X;  1I94 C;  5BSU A;  2E8F A;  4BC7 A;  4LFC C;  3FM7 A;  5KEI A;  1WH9 A;  2VSQ A;  2D1S A;  1XHJ A;  3LNV A;  1VEH A;  4JI1 C;  1XNR C;  1JOS A;  4GKJ C;  2YCB A;  1IB8 A;  1N32 C;  2Y4N A;  4DR4 C;  1FUG A;  4R1L A;  5AE1 A;  1EGA A;  5H9U A;  5T8S A;  5KYV A;  4BCA A;  3NPD A;  4RVO A;  2Y27 A;  4PHT A;  4B3R C;  1PU1 A;  4LE5 A;  3OTO C;  4X66 C;  4PZP A;  4JI6 C;  4NOZ A;  4BBY A;  4DR6 C;  1HNZ C;  2CXC A;  2UXC C;  4DR1 C;  3R44 A;  4DCV A;  4DV1 C;  1BA3 A;  3T1H C;  5AE3 A;  4NXN C;  3CQ3 A;  3CW9 A;  2ASB A;  4PUH A;  4BSZ A;  1NY8 A;  1WF3 A;  1ML8 A;  1MXC A;  3T1Y C;  4L2Z A;  2E7G A;  3FCC A;  3CQ2 A;  5ADZ A;  1T5D X;  2VZE A;  4FUT A;  4D57 A;  4DR7 C;  2OO4 A;  4K0B A;  4JI0 C;  1XDX A;  4OYC A;  3DLP X;  4DCU A;  1YGT A;  1RY2 A;  3GR1 A;  2NCL A;  4GS5 A;  2P2J A;  3IEU A;  2P2F A;  3L95 X;  2PT7 G;  2DYJ A;  5A1I A;  5K85 A;  3J81 D;  3AY0 A;  2VQF C;  2BH1 X;  4DV4 C;  1IBK C;  3UZ0 A;  3A9U A;  2KZ0 A;  1O92 A;  4NDN A;  3UEB A;  2KDN A;  5KYT A;  1M6X C;  4I9G A;  3RG2 A;  1NYE A;  3PES A;  3K6R A;  4AQY C;  2VQE C;  2P2B A;  1WCJ A;  1USP B;  4G37 A;  4DV0 C;  4LFB C;  4DV6 C;  2WD9 A;  5CZX A;  5IFI A;  1M6X A;  2AYA A;  4YHH C;  5BR8 C;  3TQI A;  1N2F A;  1P4E A;  5AE2 A;  3LAX A;  5DV9 A;  2HHH C;  3KXW A;  2MCQ A;  5LMN C;  4D4G A;  3AF6 A;  2D28 C;  2ONF A;  5E7Q A;  5BSV A;  3VNR A;  4DV5 C;  1ULT A;  4LF6 C;  3UX3 A;  4WV3 A;  4JV5 C;  2CU6 A;  1HNW C;  4KTV A;  2YX1 A;  2E5L C;  2EGT A;  2YWB A;  4JI7 C;  1XRB A;  3RV2 A;  4LFA C;  1USP A;  3ETO A;  1PG3 A;  4X64 C;  3LGX A;  4RLF A;  4ODJ A;  4DUZ C;  1MDF A;  3CJE A;  1XS3 A;  4RMN A;  3AF5 A;  3GR0 A;  2PG1 E;  3E7W A;  4JI8 C;  1MXB A;  2YWC A;  3TDE A;  3G7S A;  5BUQ A;  4RM3 A;  4TPS B;  2D1Q A;  1MDB A;  4L4Q A;  2D1R A;  2UUC C;  5CZV A;  5IWA C;  4X62 C;  1T5H X;  4MTN A;  4DR5 C;  4ZLP A;  5A1G A;  1KKG A;  1LCI A;  1FLO A;  4RLQ A;  1MD9 A;  3C5E A;  2ATW A;  2P02 A;  4KHP C;  3NI2 A;  4GXQ A;  3UX2 A;  1L2F A;  2P2M A;  4WS9 A;  5A2Q D;  2WP0 C;  2ZTB A;  4G1I A;  5BSW A;  4JI4 C;  4JM1 A;  5FLX D;  1PA4 A;  4DCS A;  4JI5 C;  4L7I A;  2ZZM A;  1HH2 P;  4DG8 A;  3NYQ A;  1UWD A;  1RG9 A;  2MM9 A;  4PRO C;  4DV7 C;  4OXI A;  3A25 A;  5LMU C;  1O9T A;  1O93 A;  3LNO A;  2OPL B;  3IML A;  1IBL C;  1O90 A;  2V7B A;  1V60 A;  2UU9 C;  3IPL A;  2BJO A;  1ZB8 A;  4LF8 C;  4YY3 C;  2E8E A;  1P4E C;  1N33 C;  2ZM6 C;  5BSM A;  3TUF A;  4D56 A;  2QVX X;  4JI3 C;  3VNS A;  4KTT A;  2PRO A;  4DG9 A;  2DHM A;  4LF9 C;  4B3M C;  4IZ6 A;  3DAY A;  3R9W A;  2D7V A;  5T8T A;  4DUY C;  4JI2 C;  1IBM C;  4X65 C;  5GTD A;  1K0R A;  3EER A;  3NYR A;  2QW0 X;  4FUQ A;  4HPV A;  2OPL A;  4DR2 C;  3I07 A;  3DHV A;  2UXB C;  4G36 A;  1TH5 A;  1XMO C;  5A19 A;  1N36 C;  3I08 A;  2Y4O A;  3O2E A;  4DCT A;  2UXD C;  5K8F A;  4D4I A;  1AMU A;  1XMQ C;  5BUS A;  4U5Y D;  1HNX C;  3A4I A;  3B7W A;  1QWI A;  4K0K C;  3GPC A;  4IR7 A;  5LCI A;  4PUI A;  1HR0 C;  3J7A D;  4R1M A;  5JRH A;  1FJG C;  3H2T A;  1PG4 A;  5IT9 D;  3LUS A;  1J5E C;  3ETC A;  4RVN A;  1MKY A;  2Z51 A;  2D1T A;  1V26 A;  2P20 A;  4B3S C;  2QVY X;  2M5O A;  1XRC A;  2XR1 A;  1XNQ C;  4LF4 C;  1XRA A;  3GKU A;  3EQ6 A;  1ZB9 A;  3CQ1 A;  2F4V C;  2KZF A;  3FCE A;  4DV2 C;  3A26 A;  4ISB A;  2PN2 A;  2UUB C;  2P2Q A;  4MH4 A;  2CY1 A;  1GPM A;  5BST A;  3VNQ A;  3R9X A;  2MMA B;  2E0G A;  2JNV A;  2UUA C;  1P7L A;  2DPL A;  4BC9 A;  1QM4 A;  4B3T C;  3N54 B;  4GXR A;  1VLA A;  4ZJZ A;  3UOW A;  3J80 D;  4LF5 C;  3N2Q A;  3S82 A;  2E8C A;  1LQL A;  4EAT A;  3SO4 A;  3A9V A;  3PBK A;  3L8C A; 
#chains in the Genus database with same CATH homology
 1UKK A;  1MXA A;  2HJG A;  4DR3 C;  3JAM D;  3E7X A;  4GKK C;  4I9F A;  5BSR A;  4DV3 C;  5BUR A;  4OX9 C;  2QL8 A;  4LF7 C;  2OBV A;  4FTF A;  4XX2 A;  2D27 A;  1N34 C;  3PRO C;  4JYA C;  1YJ7 A;  1V25 A;  3CW8 X;  4RM2 A;  4NXM C;  2JMP A;  4R0M A;  3IEV A;  2QVZ X;  1I94 C;  5BSU A;  2E8F A;  4BC7 A;  4LFC C;  5KEI A;  1WH9 A;  2VSQ A;  2D1S A;  3LNV A;  4JI1 C;  1XNR C;  1JOS A;  4GKJ C;  2YCB A;  1N32 C;  2Y4N A;  4DR4 C;  1FUG A;  4R1L A;  5AE1 A;  1EGA A;  5H9U A;  5T8S A;  5KYV A;  4BCA A;  3NPD A;  4RVO A;  2Y27 A;  4PHT A;  4B3R C;  4LE5 A;  3OTO C;  4X66 C;  4PZP A;  4JI6 C;  4NOZ A;  4BBY A;  4DR6 C;  1HNZ C;  2CXC A;  2UXC C;  4DR1 C;  3R44 A;  4DCV A;  4DV1 C;  1BA3 A;  3T1H C;  5AE3 A;  4NXN C;  3CW9 A;  2ASB A;  4BSZ A;  1WF3 A;  3T1Y C;  1ML8 A;  1MXC A;  4L2Z A;  2E7G A;  3FCC A;  5ADZ A;  1T5D X;  2VZE A;  4FUT A;  4D57 A;  4DR7 C;  2OO4 A;  4K0B A;  4JI0 C;  4OYC A;  3DLP X;  4DCU A;  1RY2 A;  3GR1 A;  4GS5 A;  2P2J A;  3IEU A;  2P2F A;  3L95 X;  2PT7 G;  2DYJ A;  5A1I A;  5K85 A;  3J81 D;  2VQF C;  2BH1 X;  4DV4 C;  1IBK C;  3UZ0 A;  3A9U A;  1O92 A;  4NDN A;  5KYT A;  4I9G A;  3RG2 A;  1NYE A;  3PES A;  4AQY C;  2VQE C;  2P2B A;  1USP B;  4G37 A;  4DV0 C;  4LFB C;  4DV6 C;  2WD9 A;  5CZX A;  5IFI A;  2AYA A;  4YHH C;  5BR8 C;  3TQI A;  1N2F A;  5AE2 A;  3LAX A;  5DV9 A;  2HHH C;  3KXW A;  5LMN C;  4D4G A;  3AF6 A;  2D28 C;  2ONF A;  5E7Q A;  5BSV A;  3VNR A;  4DV5 C;  1ULT A;  4LF6 C;  4WV3 A;  4JV5 C;  1HNW C;  4KTV A;  2E5L C;  2EGT A;  2YWB A;  4JI7 C;  1XRB A;  3RV2 A;  4LFA C;  1USP A;  3ETO A;  1PG3 A;  4X64 C;  3LGX A;  4RLF A;  4ODJ A;  4DUZ C;  1MDF A;  3CJE A;  4RMN A;  3AF5 A;  3GR0 A;  3E7W A;  4JI8 C;  1MXB A;  2YWC A;  3TDE A;  3G7S A;  5BUQ A;  4RM3 A;  4TPS B;  2D1Q A;  1MDB A;  4L4Q A;  2D1R A;  2UUC C;  5CZV A;  5IWA C;  4X62 C;  1T5H X;  4MTN A;  4DR5 C;  4ZLP A;  5A1G A;  1KKG A;  1LCI A;  4RLQ A;  1MD9 A;  3C5E A;  2ATW A;  2P02 A;  4KHP C;  3NI2 A;  4GXQ A;  1L2F A;  2P2M A;  4WS9 A;  5A2Q D;  2WP0 C;  4G1I A;  5BSW A;  4JI4 C;  4JM1 A;  5FLX D;  1PA4 A;  4DCS A;  4JI5 C;  4L7I A;  1HH2 P;  4DG8 A;  3NYQ A;  1RG9 A;  4PRO C;  4DV7 C;  4OXI A;  5LMU C;  1O9T A;  1O93 A;  1IBL C;  2OPL B;  3IML A;  1O90 A;  2V7B A;  2UU9 C;  3IPL A;  2BJO A;  1ZB8 A;  4LF8 C;  4YY3 C;  2E8E A;  1N33 C;  2ZM6 C;  5BSM A;  3TUF A;  4D56 A;  2QVX X;  4JI3 C;  3VNS A;  4KTT A;  2PRO A;  4DG9 A;  4LF9 C;  4B3M C;  4IZ6 A;  3DAY A;  3R9W A;  2D7V A;  5T8T A;  4DUY C;  4JI2 C;  1IBM C;  4X65 C;  5GTD A;  1K0R A;  3EER A;  3NYR A;  2QW0 X;  4FUQ A;  4HPV A;  2OPL A;  4DR2 C;  3I07 A;  3DHV A;  2UXB C;  4G36 A;  1XMO C;  5A19 A;  1N36 C;  3I08 A;  2Y4O A;  4DCT A;  2UXD C;  5K8F A;  4D4I A;  1AMU A;  1XMQ C;  5BUS A;  4U5Y D;  1HNX C;  3A4I A;  3B7W A;  1QWI A;  4K0K C;  3GPC A;  4IR7 A;  1HR0 C;  3J7A D;  4R1M A;  5JRH A;  1FJG C;  3H2T A;  1PG4 A;  5IT9 D;  3LUS A;  1J5E C;  3ETC A;  4RVN A;  1MKY A;  2D1T A;  1V26 A;  2P20 A;  4B3S C;  2QVY X;  1XRC A;  2XR1 A;  1XNQ C;  4LF4 C;  1XRA A;  3GKU A;  3EQ6 A;  1ZB9 A;  2F4V C;  2KZF A;  3FCE A;  4DV2 C;  4ISB A;  2PN2 A;  2UUB C;  2P2Q A;  4MH4 A;  2CY1 A;  1GPM A;  5BST A;  3VNQ A;  3R9X A;  2E0G A;  2UUA C;  1P7L A;  2DPL A;  4BC9 A;  1QM4 A;  4B3T C;  3N54 B;  4GXR A;  1VLA A;  4ZJZ A;  3UOW A;  3J80 D;  4LF5 C;  3N2Q A;  3S82 A;  2E8C A;  1LQL A;  4EAT A;  3SO4 A;  3A9V A;  3PBK A;  3L8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...