1I94C

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1i94C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1i94C02
2E7GA 4JI7C 4LFAC 4LF8C 4X64C 2EGTA 4DR3C 4JI1C 2VQEC 4LF7C 2HHHC 1USPA 4JI0C 4JI5C 2ONFA 4X62C 5LMUC 2F4VC 2DYJA 4DR1C 1J5EC 3T1HC 4DV4C 4AQYC 4JI4C 4JI2C 1QWIA 4DCSA 5LMNC 4JYAC 2UXCC 4YY3C 3IEUA 2CXCA 4DCTA 4B3RC 1XNRC 4DR5C 1JOSA 4DV5C 3J7AD 1IBKC 1LQLA 2HJGA 4B3MC 4LF9C 5IT9D 2OPLA 4XX2A 3J80D 4DR2C 2UUBC 1PA4A 4DV3C 5A2QD 3EERA 3CJEA 2UUCC 1USPB 1WH9A 4DV6C 3AF6A 1EGAA 5FLXD 2ASBA 1N2FA 4DV0C 4DR4C 2E5LC 3R9XA 4JI6C 1N36C 4OX9C 2KZFA 4DR7C 4DCVA 4B3SC 2BJOA 2PT7G 4LFBC 1HNXC 2PN2A 1NYEA 2QL8A 3J81D 1I94C 2ATWA 2E8EA 4JI8C 3OTOC 1ML8A 1IBLC 2UUAC 3LUSA 4LF6C 1HR0C 1ZB8A 2E8CA 4BSZA 5BR8C 4JV5C 4LF5C 1HH2P 4DUZC 2UXDC 4LF4C 4GKKC 4DV1C 5IWAC 2OPLB 1VLAA 1IBMC 1N32C 4K0KC 2VQFC 4MTNA 2CY1A 3T1YC 2ZM6C 4B3TC 1FJGC 1UKKA 1HNZC 1HNWC 1WF3A 4JI3C 1N34C 4MH4A 2YCBA 2UXBC 3JAMD 4DV7C 4LFCC 1ZB9A 2D7VA 4YHHC 2XR1A 4X65C 3R9WA 1XMOC 1N33C 4DV2C 1KKGA 4NXMC 4DCUA 3I07A 4KHPC 1K0RA 4DUYC 2E8FA 4X66C 4NXNC 1MKYA 2UU9C 4DR6C 1L2FA 1XMQC 3GKUA 1XNQC 3IEVA 4NOZA 4GKJC 3AF5A 2JMPA
chains in the Genus database with same CATH superfamily
3ETOA 4JI1C 2Y27A 3FM7A 4RM3A 3G7SA 3TR3A 4JI0C 4L7IA 4BC7A 5AE2A 4RVNA 1XRBA 1RG9A 1UWDA 2D28C 3J7AD 1IBKC 2BH1X 3A26A 4I9FA 4DV3C 4D57A 4RM2A 5GTDA 3EERA 3EQ6A 3LNVA 1USPB 1WH9A 2ZZNA 3AF6A 1EGAA 5FLXD 2ASBA 2VZEA 4WS9A 3AY0A 4PHTA 1N36C 2P2MA 2D27A 2P2FA 5LCIA 1PU1A 1HNXC 2QL8A 3OTOC 1ML8A 4L4QA 4FUQA 2E8CA 4BSZA 2YWCA 2UXDC 4DV1C 2Y4OA 1IB8A 2OPLB 3VNSA 1P4EC 4K0KC 2VQFC 4MTNA 2CY1A 1HNZC 3FCEA 4KTVA 1T5HX 2YCBA 2UXBC 4DV7C 2PROA 4EATA 4X65C 1XMOC 3K6RA 1KKGA 2E0GA 4R0MA 2E8FA 4IZ6A 2MCQA 1MKYA 3DAYA 1XMQC 4NOZA 3AF5A 1VLAA 5BSVA 1J5EC 3LNOA 2E7GA 3E7WA 4PUGA 2VQEC 3IPLA 3DHVA 1MXAA 4WV3A 1RY2A 2DYJA 4FTFA 5IFIA 2KDNA 4PUHA 1QWIA 4PROC 1P4EA 3R44A 3TQIA 2Z51A 1XRCA 4K0BA 4LE5A 1JOSA 1XS3A 2HJGA 3J80D 4R1LA 1V60A 3PROC 1FUGA 4IR7A 2UUCC 4DV6C 2AYAA 5E7QA 2M5HA 3VNQA 3UOWA 3R9XA 2P02A 1BA3A 3H2TA 4DCVA 2V7BA 1NYEA 1XRAA 5H9UA 2ATWA 4D4GA 4RMNA 4OYCA 4RLFA 5A1GA 4LF6C 4R1MA 1HH2P 4LF4C 4GKKC 1M6XC 1O9TA 3A9VA 2DPLA 3LGXA 2ZM6C 2D1RA 3A25A 5K85A 3PESA 4ZLPA 3JAMD 4LFCC 3CQ2A 3RV2A 3N54B 3DLPX 2WD9A 3R9WA 1N33C 3LAXA 4D4IA 2CU6A 4DCUA 1K0RA 3CQ1A 4NXNC 3UZ0A 4BC9A 2PG1E 1V25A 3GR0A 1XNQC 3IEVA 4RVOA 4BCAA 4G36A 3FCCA 4LF7C 5AE3A 2YWBA 4GS5A 3UX2A 2ONFA 2F4VC 5LMUC 3CW9A 3GR1A 3T1HC 4JI4C 4JI2C 3B7WA 4JYAC 3IEUA 1GPMA 2CXCA 4B3RC 4GXQA 2P2JA 4DR5C 3RG2A 2P2QA 3VNRA 4LF9C 5IT9D 2OPLA 3N2QA 2UUBC 2NCLA 2D1SA 4I9GA 1PA4A 5JRHA 4L2ZA 3ETCA 3NYQA 3CJEA 4BBYA 4U5YD 4G1IA 2MMAB 3CQ3A 1N2FA 4JM1A 1WCJA 1FLOA 3E7XA 2PT7G 4LFBC 3NPDA 5BSWA 4PZPA 3J81D 1I94C 3TUFA 2E8EA 3UX3A 2UUAC 3LUSA 1ZB8A 4ZJZA 4G37A 3A4IA 5BSMA 3L8CA 4JV5C 5BURA 1LCIA 4DUZC 3IMLA 1TH5A 5IWAC 1IBMC 4FUTA 3UEBA 1FJGC 4B3TC 1WF3A 2OBVA 1N34C 2VSQA 1ZB9A 4PUIA 2D7VA 5KYVA 4DV2C 5BUQA 4X66C 3PBKA 4NDNA 2UU9C 1XDXA 4KTTA 3GKUA 2WP0C 4DG8A 4JI7C 4LFAC 4LF8C 4X64C 2EGTA 4DR3C 1M6XA 5ADZA 5CZVA 2HHHC 1USPA 1MD9A 4JI5C 2QVZX 1VEHA 3TDEA 2DHMA 1PG4A 4X62C 4DR1C 1MXBA 2QW0X 2YX1A 2OO4A 4DV4C 4AQYC 4DCSA 5LMNC 2UXCC 4YY3C 5KEIA 5KYTA 4DG9A 5BSTA 4DCTA 1XNRC 1MXCA 4DV5C 2P20A 1LQLA 2QVYX 4B3MC 3KXWA 4TPSB 4XX2A 1T5DX 4DR2C 2Y4NA 1YJ7A 3O2EA 5A2QD 2D1TA 5BSRA 5AE1A 1O92A 3L95X 4DV0C 4DR4C 2E5LC 1YGTA 4JI6C 4OX9C 2KZFA 4DR7C 5BUSA 4B3SC 3A9UA 2BJOA 1QM4A 4RLQA 2P2BA 4ISBA 3NYRA 2PN2A 5T8TA 1MDBA 1ULTA 4JI8C 1IBLC 4D56A 1MDFA 1AMUA 3SO4A 4ODJA 1HR0C 2M5OA 2D1QA 2MM9A 5BR8C 1XHJA 3I08A 4LF5C 4OXIA 2ZZMA 2KZ0A 1N32C 5BSUA 1O93A 3T1YC 1HNWC 1UKKA 3S82A 5A19A 4JI3C 5CZXA 5DV9A 4GXRA 1O90A 4MH4A 5A1IA 1P7LA 4HPVA 3GPCA 2ZTBA 4YHHC 2XR1A 1PG3A 3CW8X 1NY8A 3C5EA 3NI2A 4NXMC 3I07A 1V26A 4KHPC 4DUYC 2JNVA 5K8FA 2QVXX 4DR6C 1L2FA 5T8SA 4GKJC 2JMPA
chains in the Genus database with same CATH topology
3ETOA 4JI1C 2Y27A 4RM3A 3G7SA 4JI0C 4L7IA 4BC7A 5AE2A 4RVNA 1XRBA 1RG9A 2D28C 3J7AD 1IBKC 2BH1X 4I9FA 4DV3C 4D57A 4RM2A 5GTDA 3EERA 3EQ6A 3LNVA 1USPB 1WH9A 3AF6A 1EGAA 5FLXD 2ASBA 2VZEA 4WS9A 4PHTA 1N36C 2P2MA 2D27A 2P2FA 1HNXC 2QL8A 3OTOC 1ML8A 4L4QA 4FUQA 2E8CA 4BSZA 2YWCA 2UXDC 4DV1C 2Y4OA 2OPLB 3VNSA 4K0KC 2VQFC 4MTNA 2CY1A 1HNZC 3FCEA 4KTVA 1T5HX 2YCBA 2UXBC 4DV7C 2PROA 4EATA 4X65C 1XMOC 1KKGA 2E0GA 4R0MA 2E8FA 4IZ6A 1MKYA 3DAYA 1XMQC 4NOZA 3AF5A 1VLAA 5BSVA 1J5EC 2E7GA 3E7WA 2VQEC 3IPLA 3DHVA 1MXAA 4WV3A 1RY2A 2DYJA 4FTFA 5IFIA 1QWIA 4PROC 3R44A 3TQIA 1XRCA 4K0BA 4LE5A 1JOSA 2HJGA 3J80D 4R1LA 3PROC 1FUGA 4IR7A 2UUCC 4DV6C 2AYAA 5E7QA 3VNQA 3UOWA 3R9XA 2P02A 1BA3A 3H2TA 4DCVA 2V7BA 1NYEA 1XRAA 5H9UA 2ATWA 4D4GA 4RMNA 4OYCA 4RLFA 5A1GA 4LF6C 4R1MA 1HH2P 4LF4C 4GKKC 1O9TA 3A9VA 2DPLA 3LGXA 2ZM6C 2D1RA 5K85A 3PESA 4ZLPA 3JAMD 4LFCC 3RV2A 3N54B 3DLPX 2WD9A 3R9WA 1N33C 3LAXA 4D4IA 4DCUA 1K0RA 4NXNC 3UZ0A 4BC9A 1V25A 3GR0A 1XNQC 3IEVA 4RVOA 4BCAA 4G36A 3FCCA 4LF7C 5AE3A 2YWBA 4GS5A 2ONFA 2F4VC 5LMUC 3CW9A 3GR1A 3T1HC 4JI4C 4JI2C 3B7WA 4JYAC 3IEUA 1GPMA 2CXCA 4B3RC 4GXQA 2P2JA 4DR5C 3RG2A 2P2QA 3VNRA 4LF9C 5IT9D 2OPLA 3N2QA 2UUBC 2D1SA 4I9GA 1PA4A 5JRHA 4L2ZA 3ETCA 3NYQA 3CJEA 4BBYA 4U5YD 4G1IA 1N2FA 4JM1A 3E7XA 2PT7G 4LFBC 3NPDA 5BSWA 4PZPA 3J81D 1I94C 3TUFA 2E8EA 2UUAC 3LUSA 1ZB8A 4ZJZA 4G37A 3A4IA 5BSMA 3L8CA 4JV5C 5BURA 1LCIA 4DUZC 3IMLA 5IWAC 1IBMC 4FUTA 1FJGC 4B3TC 1WF3A 2OBVA 1N34C 2VSQA 1ZB9A 2D7VA 5KYVA 4DV2C 5BUQA 4X66C 3PBKA 4NDNA 2UU9C 4KTTA 3GKUA 2WP0C 4DG8A 4JI7C 4LFAC 4LF8C 4X64C 2EGTA 4DR3C 5ADZA 5CZVA 2HHHC 1USPA 1MD9A 4JI5C 2QVZX 3TDEA 4X62C 1PG4A 4DR1C 1MXBA 2QW0X 2OO4A 4DV4C 4AQYC 4DCSA 5LMNC 2UXCC 4YY3C 5KEIA 5KYTA 4DG9A 5BSTA 4DCTA 1XNRC 1MXCA 4DV5C 2P20A 1LQLA 2QVYX 4B3MC 3KXWA 4TPSB 4XX2A 1T5DX 4DR2C 2Y4NA 1YJ7A 5A2QD 2D1TA 5BSRA 5AE1A 1O92A 3L95X 4DV0C 4DR4C 2E5LC 4JI6C 4OX9C 2KZFA 4DR7C 5BUSA 4B3SC 3A9UA 2BJOA 1QM4A 4RLQA 2P2BA 4ISBA 3NYRA 2PN2A 5T8TA 1MDBA 1ULTA 4JI8C 1IBLC 4D56A 1MDFA 1AMUA 3SO4A 4ODJA 1HR0C 2D1QA 5BR8C 3I08A 4LF5C 4OXIA 1N32C 5BSUA 1O93A 3T1YC 1HNWC 1UKKA 3S82A 5A19A 4JI3C 5CZXA 5DV9A 4GXRA 1O90A 4MH4A 5A1IA 1P7LA 4HPVA 3GPCA 4YHHC 2XR1A 1PG3A 3CW8X 3C5EA 3NI2A 4NXMC 3I07A 1V26A 4KHPC 4DUYC 5K8FA 2QVXX 4DR6C 1L2FA 5T8SA 4GKJC 2JMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7G A;  4JI7 C;  4LFA C;  4LF8 C;  4X64 C;  2EGT A;  4DR3 C;  4JI1 C;  2VQE C;  4LF7 C;  2HHH C;  1USP A;  4JI0 C;  4JI5 C;  2ONF A;  4X62 C;  5LMU C;  2F4V C;  2DYJ A;  4DR1 C;  1J5E C;  3T1H C;  4DV4 C;  4AQY C;  4JI4 C;  4JI2 C;  1QWI A;  4DCS A;  5LMN C;  4JYA C;  2UXC C;  4YY3 C;  3IEU A;  2CXC A;  4DCT A;  4B3R C;  1XNR C;  4DR5 C;  1JOS A;  4DV5 C;  3J7A D;  1IBK C;  1LQL A;  2HJG A;  4B3M C;  4LF9 C;  5IT9 D;  2OPL A;  4XX2 A;  3J80 D;  4DR2 C;  2UUB C;  1PA4 A;  4DV3 C;  5A2Q D;  3EER A;  3CJE A;  2UUC C;  1USP B;  1WH9 A;  4DV6 C;  3AF6 A;  1EGA A;  5FLX D;  2ASB A;  1N2F A;  4DV0 C;  4DR4 C;  2E5L C;  3R9X A;  4JI6 C;  1N36 C;  4OX9 C;  2KZF A;  4DR7 C;  4DCV A;  4B3S C;  2BJO A;  2PT7 G;  4LFB C;  1HNX C;  2PN2 A;  1NYE A;  2QL8 A;  3J81 D;  1I94 C;  2ATW A;  2E8E A;  4JI8 C;  3OTO C;  1ML8 A;  1IBL C;  2UUA C;  3LUS A;  4LF6 C;  1HR0 C;  1ZB8 A;  2E8C A;  4BSZ A;  5BR8 C;  4JV5 C;  4LF5 C;  1HH2 P;  4DUZ C;  2UXD C;  4LF4 C;  4GKK C;  4DV1 C;  5IWA C;  2OPL B;  1VLA A;  1IBM C;  1N32 C;  4K0K C;  2VQF C;  4MTN A;  2CY1 A;  3T1Y C;  2ZM6 C;  4B3T C;  1FJG C;  1UKK A;  1HNZ C;  1HNW C;  1WF3 A;  4JI3 C;  1N34 C;  4MH4 A;  2YCB A;  2UXB C;  3JAM D;  4DV7 C;  4LFC C;  1ZB9 A;  2D7V A;  4YHH C;  2XR1 A;  4X65 C;  3R9W A;  1XMO C;  1N33 C;  4DV2 C;  1KKG A;  4NXM C;  4DCU A;  3I07 A;  4KHP C;  1K0R A;  4DUY C;  2E8F A;  4X66 C;  4NXN C;  1MKY A;  2UU9 C;  4DR6 C;  1L2F A;  1XMQ C;  3GKU A;  1XNQ C;  3IEV A;  4NOZ A;  4GKJ C;  3AF5 A;  2JMP A; 
#chains in the Genus database with same CATH topology
 3ETO A;  4JI1 C;  2Y27 A;  3FM7 A;  4RM3 A;  3G7S A;  3TR3 A;  4JI0 C;  4L7I A;  4BC7 A;  5AE2 A;  4RVN A;  1XRB A;  1RG9 A;  1UWD A;  2D28 C;  3J7A D;  1IBK C;  2BH1 X;  3A26 A;  4I9F A;  4DV3 C;  4D57 A;  4RM2 A;  5GTD A;  3EER A;  3EQ6 A;  3LNV A;  1USP B;  1WH9 A;  2ZZN A;  3AF6 A;  1EGA A;  5FLX D;  2ASB A;  2VZE A;  4WS9 A;  3AY0 A;  4PHT A;  1N36 C;  2P2M A;  2D27 A;  2P2F A;  5LCI A;  1PU1 A;  1HNX C;  2QL8 A;  3OTO C;  1ML8 A;  4L4Q A;  4FUQ A;  2E8C A;  4BSZ A;  2YWC A;  2UXD C;  4DV1 C;  2Y4O A;  1IB8 A;  2OPL B;  3VNS A;  1P4E C;  4K0K C;  2VQF C;  4MTN A;  2CY1 A;  1HNZ C;  3FCE A;  4KTV A;  1T5H X;  2YCB A;  2UXB C;  4DV7 C;  2PRO A;  4EAT A;  4X65 C;  1XMO C;  3K6R A;  1KKG A;  2E0G A;  4R0M A;  2E8F A;  4IZ6 A;  2MCQ A;  1MKY A;  3DAY A;  1XMQ C;  4NOZ A;  3AF5 A;  1VLA A;  5BSV A;  1J5E C;  3LNO A;  2E7G A;  3E7W A;  4PUG A;  2VQE C;  3IPL A;  3DHV A;  1MXA A;  4WV3 A;  1RY2 A;  2DYJ A;  4FTF A;  5IFI A;  2KDN A;  4PUH A;  1QWI A;  4PRO C;  1P4E A;  3R44 A;  3TQI A;  2Z51 A;  1XRC A;  4K0B A;  4LE5 A;  1JOS A;  1XS3 A;  2HJG A;  3J80 D;  4R1L A;  1V60 A;  3PRO C;  1FUG A;  4IR7 A;  2UUC C;  4DV6 C;  2AYA A;  5E7Q A;  2M5H A;  3VNQ A;  3UOW A;  3R9X A;  2P02 A;  1BA3 A;  3H2T A;  4DCV A;  2V7B A;  1NYE A;  1XRA A;  5H9U A;  2ATW A;  4D4G A;  4RMN A;  4OYC A;  4RLF A;  5A1G A;  4LF6 C;  4R1M A;  1HH2 P;  4LF4 C;  4GKK C;  1M6X C;  1O9T A;  3A9V A;  2DPL A;  3LGX A;  2ZM6 C;  2D1R A;  3A25 A;  5K85 A;  3PES A;  4ZLP A;  3JAM D;  4LFC C;  3CQ2 A;  3RV2 A;  3N54 B;  3DLP X;  2WD9 A;  3R9W A;  1N33 C;  3LAX A;  4D4I A;  2CU6 A;  4DCU A;  1K0R A;  3CQ1 A;  4NXN C;  3UZ0 A;  4BC9 A;  2PG1 E;  1V25 A;  3GR0 A;  1XNQ C;  3IEV A;  4RVO A;  4BCA A;  4G36 A;  3FCC A;  4LF7 C;  5AE3 A;  2YWB A;  4GS5 A;  3UX2 A;  2ONF A;  2F4V C;  5LMU C;  3CW9 A;  3GR1 A;  3T1H C;  4JI4 C;  4JI2 C;  3B7W A;  4JYA C;  3IEU A;  1GPM A;  2CXC A;  4B3R C;  4GXQ A;  2P2J A;  4DR5 C;  3RG2 A;  2P2Q A;  3VNR A;  4LF9 C;  5IT9 D;  2OPL A;  3N2Q A;  2UUB C;  2NCL A;  2D1S A;  4I9G A;  1PA4 A;  5JRH A;  4L2Z A;  3ETC A;  3NYQ A;  3CJE A;  4BBY A;  4U5Y D;  4G1I A;  2MMA B;  3CQ3 A;  1N2F A;  4JM1 A;  1WCJ A;  1FLO A;  3E7X A;  2PT7 G;  4LFB C;  3NPD A;  5BSW A;  4PZP A;  3J81 D;  1I94 C;  3TUF A;  2E8E A;  3UX3 A;  2UUA C;  3LUS A;  1ZB8 A;  4ZJZ A;  4G37 A;  3A4I A;  5BSM A;  3L8C A;  4JV5 C;  5BUR A;  1LCI A;  4DUZ C;  3IML A;  1TH5 A;  5IWA C;  1IBM C;  4FUT A;  3UEB A;  1FJG C;  4B3T C;  1WF3 A;  2OBV A;  1N34 C;  2VSQ A;  1ZB9 A;  4PUI A;  2D7V A;  5KYV A;  4DV2 C;  5BUQ A;  4X66 C;  3PBK A;  4NDN A;  2UU9 C;  1XDX A;  4KTT A;  3GKU A;  2WP0 C;  4DG8 A;  4JI7 C;  4LFA C;  4LF8 C;  4X64 C;  2EGT A;  4DR3 C;  1M6X A;  5ADZ A;  5CZV A;  2HHH C;  1USP A;  1MD9 A;  4JI5 C;  2QVZ X;  1VEH A;  3TDE A;  2DHM A;  1PG4 A;  4X62 C;  4DR1 C;  1MXB A;  2QW0 X;  2YX1 A;  2OO4 A;  4DV4 C;  4AQY C;  4DCS A;  5LMN C;  2UXC C;  4YY3 C;  5KEI A;  5KYT A;  4DG9 A;  5BST A;  4DCT A;  1XNR C;  1MXC A;  4DV5 C;  2P20 A;  1LQL A;  2QVY X;  4B3M C;  3KXW A;  4TPS B;  4XX2 A;  1T5D X;  4DR2 C;  2Y4N A;  1YJ7 A;  3O2E A;  5A2Q D;  2D1T A;  5BSR A;  5AE1 A;  1O92 A;  3L95 X;  4DV0 C;  4DR4 C;  2E5L C;  1YGT A;  4JI6 C;  4OX9 C;  2KZF A;  4DR7 C;  5BUS A;  4B3S C;  3A9U A;  2BJO A;  1QM4 A;  4RLQ A;  2P2B A;  4ISB A;  3NYR A;  2PN2 A;  5T8T A;  1MDB A;  1ULT A;  4JI8 C;  1IBL C;  4D56 A;  1MDF A;  1AMU A;  3SO4 A;  4ODJ A;  1HR0 C;  2M5O A;  2D1Q A;  2MM9 A;  5BR8 C;  1XHJ A;  3I08 A;  4LF5 C;  4OXI A;  2ZZM A;  2KZ0 A;  1N32 C;  5BSU A;  1O93 A;  3T1Y C;  1HNW C;  1UKK A;  3S82 A;  5A19 A;  4JI3 C;  5CZX A;  5DV9 A;  4GXR A;  1O90 A;  4MH4 A;  5A1I A;  1P7L A;  4HPV A;  3GPC A;  2ZTB A;  4YHH C;  2XR1 A;  1PG3 A;  3CW8 X;  1NY8 A;  3C5E A;  3NI2 A;  4NXM C;  3I07 A;  1V26 A;  4KHP C;  4DUY C;  2JNV A;  5K8F A;  2QVX X;  4DR6 C;  1L2F A;  5T8S A;  4GKJ C;  2JMP A; 
#chains in the Genus database with same CATH homology
 3ETO A;  4JI1 C;  2Y27 A;  4RM3 A;  3G7S A;  4JI0 C;  4L7I A;  4BC7 A;  5AE2 A;  4RVN A;  1XRB A;  1RG9 A;  2D28 C;  3J7A D;  1IBK C;  2BH1 X;  4I9F A;  4DV3 C;  4D57 A;  4RM2 A;  5GTD A;  3EER A;  3EQ6 A;  3LNV A;  1USP B;  1WH9 A;  3AF6 A;  1EGA A;  5FLX D;  2ASB A;  2VZE A;  4WS9 A;  4PHT A;  1N36 C;  2P2M A;  2D27 A;  2P2F A;  1HNX C;  2QL8 A;  3OTO C;  1ML8 A;  4L4Q A;  4FUQ A;  2E8C A;  4BSZ A;  2YWC A;  2UXD C;  4DV1 C;  2Y4O A;  2OPL B;  3VNS A;  4K0K C;  2VQF C;  4MTN A;  2CY1 A;  1HNZ C;  3FCE A;  4KTV A;  1T5H X;  2YCB A;  2UXB C;  4DV7 C;  2PRO A;  4EAT A;  4X65 C;  1XMO C;  1KKG A;  2E0G A;  4R0M A;  2E8F A;  4IZ6 A;  1MKY A;  3DAY A;  1XMQ C;  4NOZ A;  3AF5 A;  1VLA A;  5BSV A;  1J5E C;  2E7G A;  3E7W A;  2VQE C;  3IPL A;  3DHV A;  1MXA A;  4WV3 A;  1RY2 A;  2DYJ A;  4FTF A;  5IFI A;  1QWI A;  4PRO C;  3R44 A;  3TQI A;  1XRC A;  4K0B A;  4LE5 A;  1JOS A;  2HJG A;  3J80 D;  4R1L A;  3PRO C;  1FUG A;  4IR7 A;  2UUC C;  4DV6 C;  2AYA A;  5E7Q A;  3VNQ A;  3UOW A;  3R9X A;  2P02 A;  1BA3 A;  3H2T A;  4DCV A;  2V7B A;  1NYE A;  1XRA A;  5H9U A;  2ATW A;  4D4G A;  4RMN A;  4OYC A;  4RLF A;  5A1G A;  4LF6 C;  4R1M A;  1HH2 P;  4LF4 C;  4GKK C;  1O9T A;  3A9V A;  2DPL A;  3LGX A;  2ZM6 C;  2D1R A;  5K85 A;  3PES A;  4ZLP A;  3JAM D;  4LFC C;  3RV2 A;  3N54 B;  3DLP X;  2WD9 A;  3R9W A;  1N33 C;  3LAX A;  4D4I A;  4DCU A;  1K0R A;  4NXN C;  3UZ0 A;  4BC9 A;  1V25 A;  3GR0 A;  1XNQ C;  3IEV A;  4RVO A;  4BCA A;  4G36 A;  3FCC A;  4LF7 C;  5AE3 A;  2YWB A;  4GS5 A;  2ONF A;  2F4V C;  5LMU C;  3CW9 A;  3GR1 A;  3T1H C;  4JI4 C;  4JI2 C;  3B7W A;  4JYA C;  3IEU A;  1GPM A;  2CXC A;  4B3R C;  4GXQ A;  2P2J A;  4DR5 C;  3RG2 A;  2P2Q A;  3VNR A;  4LF9 C;  5IT9 D;  2OPL A;  3N2Q A;  2UUB C;  2D1S A;  4I9G A;  1PA4 A;  5JRH A;  4L2Z A;  3ETC A;  3NYQ A;  3CJE A;  4BBY A;  4U5Y D;  4G1I A;  1N2F A;  4JM1 A;  3E7X A;  2PT7 G;  4LFB C;  3NPD A;  5BSW A;  4PZP A;  3J81 D;  1I94 C;  3TUF A;  2E8E A;  2UUA C;  3LUS A;  1ZB8 A;  4ZJZ A;  4G37 A;  3A4I A;  5BSM A;  3L8C A;  4JV5 C;  5BUR A;  1LCI A;  4DUZ C;  3IML A;  5IWA C;  1IBM C;  4FUT A;  1FJG C;  4B3T C;  1WF3 A;  2OBV A;  1N34 C;  2VSQ A;  1ZB9 A;  2D7V A;  5KYV A;  4DV2 C;  5BUQ A;  4X66 C;  3PBK A;  4NDN A;  2UU9 C;  4KTT A;  3GKU A;  2WP0 C;  4DG8 A;  4JI7 C;  4LFA C;  4LF8 C;  4X64 C;  2EGT A;  4DR3 C;  5ADZ A;  5CZV A;  2HHH C;  1USP A;  1MD9 A;  4JI5 C;  2QVZ X;  3TDE A;  4X62 C;  1PG4 A;  4DR1 C;  1MXB A;  2QW0 X;  2OO4 A;  4DV4 C;  4AQY C;  4DCS A;  5LMN C;  2UXC C;  4YY3 C;  5KEI A;  5KYT A;  4DG9 A;  5BST A;  4DCT A;  1XNR C;  1MXC A;  4DV5 C;  2P20 A;  1LQL A;  2QVY X;  4B3M C;  3KXW A;  4TPS B;  4XX2 A;  1T5D X;  4DR2 C;  2Y4N A;  1YJ7 A;  5A2Q D;  2D1T A;  5BSR A;  5AE1 A;  1O92 A;  3L95 X;  4DV0 C;  4DR4 C;  2E5L C;  4JI6 C;  4OX9 C;  2KZF A;  4DR7 C;  5BUS A;  4B3S C;  3A9U A;  2BJO A;  1QM4 A;  4RLQ A;  2P2B A;  4ISB A;  3NYR A;  2PN2 A;  5T8T A;  1MDB A;  1ULT A;  4JI8 C;  1IBL C;  4D56 A;  1MDF A;  1AMU A;  3SO4 A;  4ODJ A;  1HR0 C;  2D1Q A;  5BR8 C;  3I08 A;  4LF5 C;  4OXI A;  1N32 C;  5BSU A;  1O93 A;  3T1Y C;  1HNW C;  1UKK A;  3S82 A;  5A19 A;  4JI3 C;  5CZX A;  5DV9 A;  4GXR A;  1O90 A;  4MH4 A;  5A1I A;  1P7L A;  4HPV A;  3GPC A;  4YHH C;  2XR1 A;  1PG3 A;  3CW8 X;  3C5E A;  3NI2 A;  4NXM C;  3I07 A;  1V26 A;  4KHP C;  4DUY C;  5K8F A;  2QVX X;  4DR6 C;  1L2F A;  5T8S A;  4GKJ C;  2JMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...