1I94C

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1i94C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1i94C02
1IBMC 1LQLA 1XNRC 4JYAC 4JI3C 4JI5C 4DV4C 4LF4C 2EGTA 4X65C 1MKYA 4JI8C 4LF7C 3IEVA 2E8CA 3I07A 4DV5C 2OPLA 1HNWC 4K0KC 4B3TC 4LFBC 4DCSA 4JI7C 3LUSA 4DR2C 1HH2P 4YHHC 2UXCC 4X64C 2HHHC 4NOZA 1L2FA 1XMQC 5FLXD 2KZFA 1ZB8A 4DUYC 4YY3C 3OTOC 1USPA 4LF6C 4DV3C 1IBLC 1USPB 4B3MC 4DR4C 2UUAC 4DV7C 4LFAC 2CXCA 4XX2A 1ZB9A 1WH9A 2ATWA 4X66C 2F4VC 1WF3A 1HR0C 5A2QD 4B3RC 3JAMD 3R9WA 3J7AD 4LF5C 4DR3C 4LF9C 5BR8C 4JI1C 4LF8C 4OX9C 2UU9C 3GKUA 4GKJC 4MTNA 4DCVA 2BJOA 2E8EA 4X62C 2JMPA 1XNQC 2E8FA 1XMOC 3AF5A 4DR1C 3J81D 2CY1A 4DR6C 2UUCC 4JI6C 2UXDC 2ZM6C 1N36C 2D7VA 3R9XA 4DUZC 1N2FA 2PT7G 2E7GA 5IWAC 2PN2A 1J5EC 1JOSA 5LMUC 1N33C 4MH4A 2YCBA 2VQEC 1N34C 4BSZA 4DV6C 1NYEA 4DR5C 4LFCC 1K0RA 4AQYC 1PA4A 1FJGC 4DV1C 4DR7C 5LMNC 1VLAA 4DCTA 3CJEA 2E5LC 4DV0C 4JI0C 2QL8A 3T1HC 1HNXC 4JI2C 4B3SC 1EGAA 2HJGA 4JV5C 2ONFA 2ASBA 1KKGA 2VQFC 2XR1A 1ML8A 3J80D 3EERA 2DYJA 4JI4C 2OPLB 3T1YC 4DV2C 4NXNC 3AF6A 1QWIA 1I94C 4NXMC 5IT9D 4GKKC 4DCUA 1HNZC 3IEUA 1N32C 1UKKA 1IBKC 2UXBC 4KHPC 2UUBC
chains in the Genus database with same CATH superfamily
1AMUA 1XNRC 2P2FA 4JYAC 3ETOA 4JI5C 4DV4C 1P7LA 4ZJZA 4JI8C 2JNVA 4JI7C 3KXWA 2WP0C 1PU1A 4BBYA 2UXCC 1L2FA 3PESA 3A25A 4LF6C 1IBLC 1MXCA 4D57A 1XDXA 4L7IA 4PUGA 2CXCA 3B7WA 2BH1X 1WH9A 3ETCA 4OYCA 2F4VC 2AYAA 4B3RC 3J7AD 2D1TA 4DR3C 5BR8C 1PG4A 4OX9C 4DCVA 2E8EA 4BC7A 3AF5A 4HPVA 3VNSA 4DUZC 1NY8A 1N2FA 2PT7G 4L4QA 4FUTA 2PN2A 5BUQA 1LCIA 4G37A 3G7SA 2VQEC 1NYEA 4RMNA 4DR5C 2KZ0A 4LFCC 4AQYC 4DV1C 3O2EA 2QVZX 2QVXX 2E5LC 2P20A 1P4EC 3CW8X 2CU6A 3IMLA 2VQFC 5BSRA 4FUQA 5A19A 4DV2C 1GPMA 4NXNC 3TDEA 5BSTA 3AF6A 3S82A 2OBVA 3CQ2A 4EATA 1UKKA 3A9UA 4KTVA 5DV9A 5CZXA 5T8TA 2MMAB 1YJ7A 5KEIA 4IR7A 4OXIA 3UOWA 3IEVA 1FLOA 3I07A 1RY2A 2OPLA 1HNWC 3UEBA 5LCIA 4ISBA 4G1IA 1M6XC 4DR2C 3E7XA 1MDFA 1QM4A 4X64C 5KYVA 2HHHC 1XMQC 2KZFA 5AE1A 1O90A 4B3MC 4U5YD 4DV7C 4LFAC 4XX2A 2ATWA 1WF3A 2YWBA 1HR0C 5A2QD 3JAMD 2YWCA 5ADZA 4JI1C 2BJOA 2QW0X 2E8FA 3I08A 1XMOC 2CY1A 4D4IA 3N2QA 4DR6C 3UX2A 1MXBA 1RG9A 5A1GA 1XS3A 2ZTBA 2E7GA 4LE5A 3NYRA 5T8SA 1J5EC 5LMUC 3CQ1A 4D4GA 4WS9A 3IPLA 4PUHA 2YX1A 2YCBA 2PG1E 4DV6C 4PROC 5BSVA 3LNVA 5AE3A 3DHVA 2V7BA 3TUFA 2P2BA 1T5DX 3VNQA 3T1HC 4JI2C 2QVYX 1EGAA 4JV5C 2ONFA 4GXQA 5KYTA 4NDNA 4L2ZA 3J80D 3LGXA 3L95X 1UWDA 3T1YC 1XHJA 4GXRA 1QWIA 3C5EA 2D1QA 1N32C 1O93A 2UUBC 4RLQA 1LQLA 1P4EA 1XRCA 4LF4C 1MDBA 1WCJA 4X65C 1MKYA 2ZZMA 3FCCA 3LAXA 2Y27A 4K0KC 4LFBC 4WV3A 2Y4OA 3NI2A 1HH2P 4YHHC 4NOZA 3TQIA 5FLXD 4ZLPA 4YY3C 4JM1A 4DR4C 3PBKA 5BSMA 5A1IA 4X66C 3PROC 1XRBA 1ULTA 1BA3A 3R9WA 1TH5A 4LF9C 4LF8C 1FUGA 1M6XA 1T5HX 1XNQC 4X62C 2JMPA 1V25A 5BSUA 4D56A 3UX3A 2ZM6C 1N36C 4PHTA 2D7VA 3GR0A 2M5OA 3AY0A 1IB8A 3FM7A 5IWAC 3R44A 5BURA 2WD9A 1N33C 4MH4A 2VZEA 4IZ6A 4DG9A 1MD9A 2E0GA 5E7QA 1K0RA 2PROA 1FJGC 4R1LA 1VLAA 4GS5A 4KTTA 2P2JA 1O9TA 2QL8A 3RG2A 4B3SC 2D1SA 2HJGA 3LNOA 4ODJA 4RVNA 2D1RA 3EERA 4JI4C 2OO4A 3DLPX 4TPSB 4R1MA 1I94C 4NXMC 5IT9D 1VEHA 3NPDA 5AE2A 1XRAA 3NYQA 1IBKC 5K85A 4KHPC 1IBMC 3EQ6A 2P02A 1V26A 4JI3C 4DG8A 3UZ0A 3CQ3A 3A9VA 1PG3A 2EGTA 5GTDA 5JRHA 5CZVA 4LF7C 1V60A 2E8CA 4DV5C 4PZPA 2NCLA 4FTFA 3GPCA 4B3TC 4DCSA 3LUSA 5H9UA 3SO4A 2Y4NA 3GR1A 3K6RA 2P2QA 5K8FA 4PUIA 2P2MA 4BC9A 3H2TA 1ZB8A 4DUYC 3OTOC 1USPA 4RM3A 4DV3C 1USPB 2UUAC 2MM9A 1ZB9A 2ZZNA 4R0MA 4RVOA 5BUSA 2MCQA 4LF5C 3RV2A 2UU9C 3GKUA 2D28C 4MTNA 4GKJC 3A4IA 1O92A 4DR1C 3J81D 3DAYA 2UUCC 4I9FA 4JI6C 2UXDC 4RLFA 3R9XA 4BCAA 3A26A 3L8CA 1JOSA 3VNRA 2D27A 2M5HA 1N34C 4BSZA 1MXAA 2DPLA 3CW9A 2KDNA 1PA4A 4DR7C 2DHMA 5LMNC 2VSQA 3CJEA 4DCTA 4DV0C 4JI0C 5BSWA 1HNXC 3N54B 2ASBA 3E7WA 1KKGA 2XR1A 1ML8A 5IFIA 2DYJA 3FCEA 4K0BA 2OPLB 4G36A 4RM2A 4I9GA 4GKKC 4DCUA 2Z51A 3IEUA 1HNZC 3TR3A 2UXBC 1YGTA
chains in the Genus database with same CATH topology
1AMUA 1XNRC 2P2FA 4JYAC 3ETOA 4JI5C 4DV4C 1P7LA 4ZJZA 4JI8C 4JI7C 3KXWA 2WP0C 4BBYA 2UXCC 1L2FA 3PESA 4LF6C 1IBLC 1MXCA 4D57A 4L7IA 2CXCA 3B7WA 2BH1X 1WH9A 3ETCA 4OYCA 2F4VC 2AYAA 4B3RC 3J7AD 2D1TA 4DR3C 5BR8C 1PG4A 4OX9C 4DCVA 2E8EA 4BC7A 3AF5A 4HPVA 3VNSA 4DUZC 1N2FA 2PT7G 4L4QA 4FUTA 2PN2A 5BUQA 1LCIA 4G37A 3G7SA 2VQEC 1NYEA 4RMNA 4DR5C 4LFCC 4AQYC 4DV1C 2QVZX 2QVXX 2E5LC 2P20A 3CW8X 2VQFC 3IMLA 5BSRA 4FUQA 5A19A 4DV2C 1GPMA 4NXNC 3TDEA 5BSTA 3AF6A 3S82A 2OBVA 4EATA 1UKKA 3A9UA 4KTVA 5DV9A 5CZXA 5T8TA 1YJ7A 5KEIA 4IR7A 4OXIA 3UOWA 3IEVA 3I07A 1RY2A 2OPLA 1HNWC 4ISBA 4G1IA 4DR2C 3E7XA 1MDFA 1QM4A 4X64C 5KYVA 2HHHC 1XMQC 2KZFA 5AE1A 1O90A 4B3MC 4U5YD 4DV7C 4LFAC 4XX2A 2ATWA 1WF3A 2YWBA 1HR0C 5A2QD 3JAMD 2YWCA 5ADZA 4JI1C 2BJOA 2QW0X 2E8FA 3I08A 1XMOC 2CY1A 4D4IA 3N2QA 4DR6C 1MXBA 1RG9A 5A1GA 2E7GA 4LE5A 3NYRA 5T8SA 1J5EC 5LMUC 4D4GA 4WS9A 3IPLA 2YCBA 4DV6C 4PROC 5BSVA 3LNVA 5AE3A 3DHVA 2V7BA 3TUFA 2P2BA 1T5DX 3VNQA 3T1HC 4JI2C 2QVYX 1EGAA 4JV5C 2ONFA 4GXQA 5KYTA 4NDNA 4L2ZA 3J80D 3LGXA 3L95X 3T1YC 4GXRA 1QWIA 3C5EA 2D1QA 1N32C 1O93A 2UUBC 4RLQA 1LQLA 1XRCA 4LF4C 1MDBA 4X65C 1MKYA 3FCCA 3LAXA 2Y27A 4K0KC 4LFBC 4WV3A 2Y4OA 3NI2A 1HH2P 4YHHC 4NOZA 3TQIA 5FLXD 4ZLPA 4YY3C 4JM1A 4DR4C 3PBKA 5BSMA 5A1IA 4X66C 3PROC 1XRBA 1ULTA 1BA3A 3R9WA 4LF9C 4LF8C 1FUGA 1T5HX 1XNQC 4X62C 2JMPA 1V25A 5BSUA 4D56A 2ZM6C 1N36C 4PHTA 2D7VA 3GR0A 5IWAC 3R44A 5BURA 2WD9A 1N33C 4MH4A 2VZEA 4IZ6A 4DG9A 1MD9A 2E0GA 5E7QA 1K0RA 2PROA 1FJGC 4R1LA 1VLAA 4GS5A 4KTTA 2P2JA 1O9TA 2QL8A 3RG2A 4B3SC 2D1SA 2HJGA 4ODJA 4RVNA 2D1RA 3EERA 4JI4C 2OO4A 3DLPX 4TPSB 4R1MA 1I94C 4NXMC 5IT9D 3NPDA 5AE2A 1XRAA 3NYQA 1IBKC 5K85A 4KHPC 1IBMC 3EQ6A 2P02A 1V26A 4JI3C 4DG8A 3UZ0A 3A9VA 1PG3A 2EGTA 5GTDA 5JRHA 5CZVA 4LF7C 2E8CA 4DV5C 4PZPA 4FTFA 3GPCA 4B3TC 4DCSA 3LUSA 5H9UA 3SO4A 2Y4NA 3GR1A 2P2QA 5K8FA 2P2MA 4BC9A 3H2TA 1ZB8A 4DUYC 3OTOC 1USPA 4RM3A 4DV3C 1USPB 2UUAC 1ZB9A 4R0MA 4RVOA 5BUSA 4LF5C 3RV2A 2UU9C 3GKUA 2D28C 4MTNA 4GKJC 3A4IA 1O92A 4DR1C 3J81D 3DAYA 2UUCC 4I9FA 4JI6C 2UXDC 4RLFA 3R9XA 4BCAA 3L8CA 1JOSA 3VNRA 2D27A 1N34C 4BSZA 1MXAA 2DPLA 3CW9A 1PA4A 4DR7C 5LMNC 2VSQA 3CJEA 4DCTA 4DV0C 4JI0C 5BSWA 1HNXC 3N54B 2ASBA 3E7WA 1KKGA 2XR1A 1ML8A 5IFIA 2DYJA 3FCEA 4K0BA 2OPLB 4G36A 4RM2A 4I9GA 4GKKC 4DCUA 1HNZC 3IEUA 2UXBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM C;  1LQL A;  1XNR C;  4JYA C;  4JI3 C;  4JI5 C;  4DV4 C;  4LF4 C;  2EGT A;  4X65 C;  1MKY A;  4JI8 C;  4LF7 C;  3IEV A;  2E8C A;  3I07 A;  4DV5 C;  2OPL A;  1HNW C;  4K0K C;  4B3T C;  4LFB C;  4DCS A;  4JI7 C;  3LUS A;  4DR2 C;  1HH2 P;  4YHH C;  2UXC C;  4X64 C;  2HHH C;  4NOZ A;  1L2F A;  1XMQ C;  5FLX D;  2KZF A;  1ZB8 A;  4DUY C;  4YY3 C;  3OTO C;  1USP A;  4LF6 C;  4DV3 C;  1IBL C;  1USP B;  4B3M C;  4DR4 C;  2UUA C;  4DV7 C;  4LFA C;  2CXC A;  4XX2 A;  1ZB9 A;  1WH9 A;  2ATW A;  4X66 C;  2F4V C;  1WF3 A;  1HR0 C;  5A2Q D;  4B3R C;  3JAM D;  3R9W A;  3J7A D;  4LF5 C;  4DR3 C;  4LF9 C;  5BR8 C;  4JI1 C;  4LF8 C;  4OX9 C;  2UU9 C;  3GKU A;  4GKJ C;  4MTN A;  4DCV A;  2BJO A;  2E8E A;  4X62 C;  2JMP A;  1XNQ C;  2E8F A;  1XMO C;  3AF5 A;  4DR1 C;  3J81 D;  2CY1 A;  4DR6 C;  2UUC C;  4JI6 C;  2UXD C;  2ZM6 C;  1N36 C;  2D7V A;  3R9X A;  4DUZ C;  1N2F A;  2PT7 G;  2E7G A;  5IWA C;  2PN2 A;  1J5E C;  1JOS A;  5LMU C;  1N33 C;  4MH4 A;  2YCB A;  2VQE C;  1N34 C;  4BSZ A;  4DV6 C;  1NYE A;  4DR5 C;  4LFC C;  1K0R A;  4AQY C;  1PA4 A;  1FJG C;  4DV1 C;  4DR7 C;  5LMN C;  1VLA A;  4DCT A;  3CJE A;  2E5L C;  4DV0 C;  4JI0 C;  2QL8 A;  3T1H C;  1HNX C;  4JI2 C;  4B3S C;  1EGA A;  2HJG A;  4JV5 C;  2ONF A;  2ASB A;  1KKG A;  2VQF C;  2XR1 A;  1ML8 A;  3J80 D;  3EER A;  2DYJ A;  4JI4 C;  2OPL B;  3T1Y C;  4DV2 C;  4NXN C;  3AF6 A;  1QWI A;  1I94 C;  4NXM C;  5IT9 D;  4GKK C;  4DCU A;  1HNZ C;  3IEU A;  1N32 C;  1UKK A;  1IBK C;  2UXB C;  4KHP C;  2UUB C; 
#chains in the Genus database with same CATH topology
 1AMU A;  1XNR C;  2P2F A;  4JYA C;  3ETO A;  4JI5 C;  4DV4 C;  1P7L A;  4ZJZ A;  4JI8 C;  2JNV A;  4JI7 C;  3KXW A;  2WP0 C;  1PU1 A;  4BBY A;  2UXC C;  1L2F A;  3PES A;  3A25 A;  4LF6 C;  1IBL C;  1MXC A;  4D57 A;  1XDX A;  4L7I A;  4PUG A;  2CXC A;  3B7W A;  2BH1 X;  1WH9 A;  3ETC A;  4OYC A;  2F4V C;  2AYA A;  4B3R C;  3J7A D;  2D1T A;  4DR3 C;  5BR8 C;  1PG4 A;  4OX9 C;  4DCV A;  2E8E A;  4BC7 A;  3AF5 A;  4HPV A;  3VNS A;  4DUZ C;  1NY8 A;  1N2F A;  2PT7 G;  4L4Q A;  4FUT A;  2PN2 A;  5BUQ A;  1LCI A;  4G37 A;  3G7S A;  2VQE C;  1NYE A;  4RMN A;  4DR5 C;  2KZ0 A;  4LFC C;  4AQY C;  4DV1 C;  3O2E A;  2QVZ X;  2QVX X;  2E5L C;  2P20 A;  1P4E C;  3CW8 X;  2CU6 A;  3IML A;  2VQF C;  5BSR A;  4FUQ A;  5A19 A;  4DV2 C;  1GPM A;  4NXN C;  3TDE A;  5BST A;  3AF6 A;  3S82 A;  2OBV A;  3CQ2 A;  4EAT A;  1UKK A;  3A9U A;  4KTV A;  5DV9 A;  5CZX A;  5T8T A;  2MMA B;  1YJ7 A;  5KEI A;  4IR7 A;  4OXI A;  3UOW A;  3IEV A;  1FLO A;  3I07 A;  1RY2 A;  2OPL A;  1HNW C;  3UEB A;  5LCI A;  4ISB A;  4G1I A;  1M6X C;  4DR2 C;  3E7X A;  1MDF A;  1QM4 A;  4X64 C;  5KYV A;  2HHH C;  1XMQ C;  2KZF A;  5AE1 A;  1O90 A;  4B3M C;  4U5Y D;  4DV7 C;  4LFA C;  4XX2 A;  2ATW A;  1WF3 A;  2YWB A;  1HR0 C;  5A2Q D;  3JAM D;  2YWC A;  5ADZ A;  4JI1 C;  2BJO A;  2QW0 X;  2E8F A;  3I08 A;  1XMO C;  2CY1 A;  4D4I A;  3N2Q A;  4DR6 C;  3UX2 A;  1MXB A;  1RG9 A;  5A1G A;  1XS3 A;  2ZTB A;  2E7G A;  4LE5 A;  3NYR A;  5T8S A;  1J5E C;  5LMU C;  3CQ1 A;  4D4G A;  4WS9 A;  3IPL A;  4PUH A;  2YX1 A;  2YCB A;  2PG1 E;  4DV6 C;  4PRO C;  5BSV A;  3LNV A;  5AE3 A;  3DHV A;  2V7B A;  3TUF A;  2P2B A;  1T5D X;  3VNQ A;  3T1H C;  4JI2 C;  2QVY X;  1EGA A;  4JV5 C;  2ONF A;  4GXQ A;  5KYT A;  4NDN A;  4L2Z A;  3J80 D;  3LGX A;  3L95 X;  1UWD A;  3T1Y C;  1XHJ A;  4GXR A;  1QWI A;  3C5E A;  2D1Q A;  1N32 C;  1O93 A;  2UUB C;  4RLQ A;  1LQL A;  1P4E A;  1XRC A;  4LF4 C;  1MDB A;  1WCJ A;  4X65 C;  1MKY A;  2ZZM A;  3FCC A;  3LAX A;  2Y27 A;  4K0K C;  4LFB C;  4WV3 A;  2Y4O A;  3NI2 A;  1HH2 P;  4YHH C;  4NOZ A;  3TQI A;  5FLX D;  4ZLP A;  4YY3 C;  4JM1 A;  4DR4 C;  3PBK A;  5BSM A;  5A1I A;  4X66 C;  3PRO C;  1XRB A;  1ULT A;  1BA3 A;  3R9W A;  1TH5 A;  4LF9 C;  4LF8 C;  1FUG A;  1M6X A;  1T5H X;  1XNQ C;  4X62 C;  2JMP A;  1V25 A;  5BSU A;  4D56 A;  3UX3 A;  2ZM6 C;  1N36 C;  4PHT A;  2D7V A;  3GR0 A;  2M5O A;  3AY0 A;  1IB8 A;  3FM7 A;  5IWA C;  3R44 A;  5BUR A;  2WD9 A;  1N33 C;  4MH4 A;  2VZE A;  4IZ6 A;  4DG9 A;  1MD9 A;  2E0G A;  5E7Q A;  1K0R A;  2PRO A;  1FJG C;  4R1L A;  1VLA A;  4GS5 A;  4KTT A;  2P2J A;  1O9T A;  2QL8 A;  3RG2 A;  4B3S C;  2D1S A;  2HJG A;  3LNO A;  4ODJ A;  4RVN A;  2D1R A;  3EER A;  4JI4 C;  2OO4 A;  3DLP X;  4TPS B;  4R1M A;  1I94 C;  4NXM C;  5IT9 D;  1VEH A;  3NPD A;  5AE2 A;  1XRA A;  3NYQ A;  1IBK C;  5K85 A;  4KHP C;  1IBM C;  3EQ6 A;  2P02 A;  1V26 A;  4JI3 C;  4DG8 A;  3UZ0 A;  3CQ3 A;  3A9V A;  1PG3 A;  2EGT A;  5GTD A;  5JRH A;  5CZV A;  4LF7 C;  1V60 A;  2E8C A;  4DV5 C;  4PZP A;  2NCL A;  4FTF A;  3GPC A;  4B3T C;  4DCS A;  3LUS A;  5H9U A;  3SO4 A;  2Y4N A;  3GR1 A;  3K6R A;  2P2Q A;  5K8F A;  4PUI A;  2P2M A;  4BC9 A;  3H2T A;  1ZB8 A;  4DUY C;  3OTO C;  1USP A;  4RM3 A;  4DV3 C;  1USP B;  2UUA C;  2MM9 A;  1ZB9 A;  2ZZN A;  4R0M A;  4RVO A;  5BUS A;  2MCQ A;  4LF5 C;  3RV2 A;  2UU9 C;  3GKU A;  2D28 C;  4MTN A;  4GKJ C;  3A4I A;  1O92 A;  4DR1 C;  3J81 D;  3DAY A;  2UUC C;  4I9F A;  4JI6 C;  2UXD C;  4RLF A;  3R9X A;  4BCA A;  3A26 A;  3L8C A;  1JOS A;  3VNR A;  2D27 A;  2M5H A;  1N34 C;  4BSZ A;  1MXA A;  2DPL A;  3CW9 A;  2KDN A;  1PA4 A;  4DR7 C;  2DHM A;  5LMN C;  2VSQ A;  3CJE A;  4DCT A;  4DV0 C;  4JI0 C;  5BSW A;  1HNX C;  3N54 B;  2ASB A;  3E7W A;  1KKG A;  2XR1 A;  1ML8 A;  5IFI A;  2DYJ A;  3FCE A;  4K0B A;  2OPL B;  4G36 A;  4RM2 A;  4I9G A;  4GKK C;  4DCU A;  2Z51 A;  3IEU A;  1HNZ C;  3TR3 A;  2UXB C;  1YGT A; 
#chains in the Genus database with same CATH homology
 1AMU A;  1XNR C;  2P2F A;  4JYA C;  3ETO A;  4JI5 C;  4DV4 C;  1P7L A;  4ZJZ A;  4JI8 C;  4JI7 C;  3KXW A;  2WP0 C;  4BBY A;  2UXC C;  1L2F A;  3PES A;  4LF6 C;  1IBL C;  1MXC A;  4D57 A;  4L7I A;  2CXC A;  3B7W A;  2BH1 X;  1WH9 A;  3ETC A;  4OYC A;  2F4V C;  2AYA A;  4B3R C;  3J7A D;  2D1T A;  4DR3 C;  5BR8 C;  1PG4 A;  4OX9 C;  4DCV A;  2E8E A;  4BC7 A;  3AF5 A;  4HPV A;  3VNS A;  4DUZ C;  1N2F A;  2PT7 G;  4L4Q A;  4FUT A;  2PN2 A;  5BUQ A;  1LCI A;  4G37 A;  3G7S A;  2VQE C;  1NYE A;  4RMN A;  4DR5 C;  4LFC C;  4AQY C;  4DV1 C;  2QVZ X;  2QVX X;  2E5L C;  2P20 A;  3CW8 X;  2VQF C;  3IML A;  5BSR A;  4FUQ A;  5A19 A;  4DV2 C;  1GPM A;  4NXN C;  3TDE A;  5BST A;  3AF6 A;  3S82 A;  2OBV A;  4EAT A;  1UKK A;  3A9U A;  4KTV A;  5DV9 A;  5CZX A;  5T8T A;  1YJ7 A;  5KEI A;  4IR7 A;  4OXI A;  3UOW A;  3IEV A;  3I07 A;  1RY2 A;  2OPL A;  1HNW C;  4ISB A;  4G1I A;  4DR2 C;  3E7X A;  1MDF A;  1QM4 A;  4X64 C;  5KYV A;  2HHH C;  1XMQ C;  2KZF A;  5AE1 A;  1O90 A;  4B3M C;  4U5Y D;  4DV7 C;  4LFA C;  4XX2 A;  2ATW A;  1WF3 A;  2YWB A;  1HR0 C;  5A2Q D;  3JAM D;  2YWC A;  5ADZ A;  4JI1 C;  2BJO A;  2QW0 X;  2E8F A;  3I08 A;  1XMO C;  2CY1 A;  4D4I A;  3N2Q A;  4DR6 C;  1MXB A;  1RG9 A;  5A1G A;  2E7G A;  4LE5 A;  3NYR A;  5T8S A;  1J5E C;  5LMU C;  4D4G A;  4WS9 A;  3IPL A;  2YCB A;  4DV6 C;  4PRO C;  5BSV A;  3LNV A;  5AE3 A;  3DHV A;  2V7B A;  3TUF A;  2P2B A;  1T5D X;  3VNQ A;  3T1H C;  4JI2 C;  2QVY X;  1EGA A;  4JV5 C;  2ONF A;  4GXQ A;  5KYT A;  4NDN A;  4L2Z A;  3J80 D;  3LGX A;  3L95 X;  3T1Y C;  4GXR A;  1QWI A;  3C5E A;  2D1Q A;  1N32 C;  1O93 A;  2UUB C;  4RLQ A;  1LQL A;  1XRC A;  4LF4 C;  1MDB A;  4X65 C;  1MKY A;  3FCC A;  3LAX A;  2Y27 A;  4K0K C;  4LFB C;  4WV3 A;  2Y4O A;  3NI2 A;  1HH2 P;  4YHH C;  4NOZ A;  3TQI A;  5FLX D;  4ZLP A;  4YY3 C;  4JM1 A;  4DR4 C;  3PBK A;  5BSM A;  5A1I A;  4X66 C;  3PRO C;  1XRB A;  1ULT A;  1BA3 A;  3R9W A;  4LF9 C;  4LF8 C;  1FUG A;  1T5H X;  1XNQ C;  4X62 C;  2JMP A;  1V25 A;  5BSU A;  4D56 A;  2ZM6 C;  1N36 C;  4PHT A;  2D7V A;  3GR0 A;  5IWA C;  3R44 A;  5BUR A;  2WD9 A;  1N33 C;  4MH4 A;  2VZE A;  4IZ6 A;  4DG9 A;  1MD9 A;  2E0G A;  5E7Q A;  1K0R A;  2PRO A;  1FJG C;  4R1L A;  1VLA A;  4GS5 A;  4KTT A;  2P2J A;  1O9T A;  2QL8 A;  3RG2 A;  4B3S C;  2D1S A;  2HJG A;  4ODJ A;  4RVN A;  2D1R A;  3EER A;  4JI4 C;  2OO4 A;  3DLP X;  4TPS B;  4R1M A;  1I94 C;  4NXM C;  5IT9 D;  3NPD A;  5AE2 A;  1XRA A;  3NYQ A;  1IBK C;  5K85 A;  4KHP C;  1IBM C;  3EQ6 A;  2P02 A;  1V26 A;  4JI3 C;  4DG8 A;  3UZ0 A;  3A9V A;  1PG3 A;  2EGT A;  5GTD A;  5JRH A;  5CZV A;  4LF7 C;  2E8C A;  4DV5 C;  4PZP A;  4FTF A;  3GPC A;  4B3T C;  4DCS A;  3LUS A;  5H9U A;  3SO4 A;  2Y4N A;  3GR1 A;  2P2Q A;  5K8F A;  2P2M A;  4BC9 A;  3H2T A;  1ZB8 A;  4DUY C;  3OTO C;  1USP A;  4RM3 A;  4DV3 C;  1USP B;  2UUA C;  1ZB9 A;  4R0M A;  4RVO A;  5BUS A;  4LF5 C;  3RV2 A;  2UU9 C;  3GKU A;  2D28 C;  4MTN A;  4GKJ C;  3A4I A;  1O92 A;  4DR1 C;  3J81 D;  3DAY A;  2UUC C;  4I9F A;  4JI6 C;  2UXD C;  4RLF A;  3R9X A;  4BCA A;  3L8C A;  1JOS A;  3VNR A;  2D27 A;  1N34 C;  4BSZ A;  1MXA A;  2DPL A;  3CW9 A;  1PA4 A;  4DR7 C;  5LMN C;  2VSQ A;  3CJE A;  4DCT A;  4DV0 C;  4JI0 C;  5BSW A;  1HNX C;  3N54 B;  2ASB A;  3E7W A;  1KKG A;  2XR1 A;  1ML8 A;  5IFI A;  2DYJ A;  3FCE A;  4K0B A;  2OPL B;  4G36 A;  4RM2 A;  4I9G A;  4GKK C;  4DCU A;  1HNZ C;  3IEU A;  2UXB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...