4LF6C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf6C02
2ONFA 2UXDC 3CJEA 3EERA 1UKKA 1PA4A 2JMPA 2UXCC 4JI6C 1XMQC 4B3RC 4JI8C 5LMNC 4K0KC 1QWIA 1HNZC 4JI5C 1N32C 2OPLB 5FLXD 4LFBC 1IBKC 2E5LC 4DUZC 4JYAC 3T1YC 2CXCA 2E8FA 2XR1A 1VLAA 4DR6C 4NOZA 1LQLA 1KKGA 4B3SC 2OPLA 4DR1C 1HH2P 2VQEC 2QL8A 3J7AD 4DCTA 1MKYA 2UUAC 4DV1C 4DCSA 1N33C 4JI3C 4JV5C 1N36C 1HR0C 1N2FA 1L2FA 4YY3C 4DUYC 5IT9D 4JI7C 4GKKC 1FJGC 2HHHC 2UUBC 2F4VC 4DR7C 2CY1A 1EGAA 2ASBA 4DV4C 4DV3C 2YCBA 1I94C 1USPB 4LF4C 2D7VA 4YHHC 4X65C 2KZFA 4DCVA 5BR8C 2DYJA 2ZM6C 1XNRC 4LF7C 3IEVA 1USPA 4LF8C 4JI4C 3IEUA 2HJGA 3J80D 1K0RA 1J5EC 4LF6C 3R9WA 4DR3C 3GKUA 1XMOC 1ML8A 4NXNC 4X66C 1IBMC 3AF6A 4BSZA 2VQFC 1WF3A 4DCUA 2UU9C 2E7GA 4DV7C 2UUCC 4DR4C 2E8EA 2ATWA 4JI1C 3R9XA 4XX2A 4LF5C 5LMUC 3OTOC 4DV6C 5IWAC 1NYEA 4B3MC 4KHPC 1HNWC 4DR5C 1ZB8A 4AQYC 4MTNA 2PT7G 3I07A 4GKJC 1XNQC 1JOSA 3JAMD 1HNXC 2UXBC 3LUSA 4B3TC 4JI2C 4LF9C 4DR2C 4X64C 5A2QD 4NXMC 1WH9A 4LFCC 1ZB9A 4OX9C 4MH4A 4JI0C 2BJOA 3J81D 4DV2C 4LFAC 3T1HC 2E8CA 2EGTA 4DV5C 4DV0C 3AF5A 1IBLC 4X62C 1N34C 2PN2A
chains in the Genus database with same CATH superfamily
2WD9A 1XRCA 2D1RA 3RV2A 3CJEA 2JMPA 1V60A 4B3RC 4JI8C 4HPVA 1NY8A 1QWIA 1HNZC 3L95X 3C5EA 3A9UA 2E5LC 4DUZC 2ZZMA 3T1YC 4JYAC 2E8FA 3UX2A 3VNRA 2XR1A 1VLAA 4NOZA 1KKGA 4DG8A 5A19A 2M5OA 2VQEC 4EATA 3J7AD 4DCTA 1N33C 1N36C 3DHVA 1BA3A 3DLPX 5CZXA 1M6XC 2Z51A 1EGAA 2YCBA 3A26A 4LF4C 4D56A 1YGTA 4LF7C 3IEVA 1USPA 4LF8C 3FCCA 4ZLPA 4D4GA 4RM3A 4L2ZA 5T8SA 1WF3A 4KTTA 4BBYA 5AE3A 4RM2A 1QM4A 1MXCA 5KEIA 1ULTA 1PG3A 2ATWA 4JI1C 4XX2A 2NCLA 5DV9A 1V26A 2BH1X 3LGXA 1NYEA 4B3MC 3I08A 3NI2A 4MTNA 2MM9A 3CQ3A 1O92A 3UEBA 3A4IA 1JOSA 4IZ6A 4JI2C 4IR7A 2MCQA 1PG4A 4DR2C 2PROA 2V7BA 2YWBA 1WH9A 2WP0C 3UOWA 3UZ0A 2VSQA 3KXWA 4TPSB 1XS3A 4R1LA 4LFAC 4DG9A 3FM7A 1P7LA 3L8CA 4DV5C 2P20A 4L4QA 1XRAA 3AF5A 5KYTA 1IBLC 1N34C 5K85A 2ONFA 4GS5A 2KDNA 4PUGA 3CQ2A 4K0KC 5T8TA 3LNVA 5KYVA 2OPLB 4G1IA 5BSWA 5FLXD 3CW9A 2CU6A 4PROC 1IB8A 4DR6C 4PHTA 4B3SC 3S82A 5BSMA 3CQ1A 2QL8A 1MKYA 3GR1A 5BUSA 4WV3A 4DV1C 4DCSA 2OO4A 1N2FA 5IT9D 2HHHC 5AE2A 4G37A 1T5HX 4RVOA 1GPMA 2DYJA 5A1IA 4JI4C 3J80D 3VNSA 4DR3C 1XMOC 4NXNC 3N54B 1IBMC 4BSZA 4DCUA 2UU9C 4D57A 2UUCC 1MDBA 2E8EA 2VZEA 2YX1A 4LF5C 1FLOA 1WCJA 2ZTBA 4DV6C 1MD9A 3O2EA 4KHPC 2Y27A 4RMNA 2Y4OA 4U5YD 1VEHA 4FTFA 5ADZA 4ZJZA 5BSTA 1XNQC 3JAMD 2UXBC 3LUSA 1XRBA 3NYQA 4B3TC 3NYRA 3RG2A 1LCIA 1ZB9A 5BSVA 1MDFA 4OX9C 3B7WA 2DHMA 3IPLA 4BC9A 1P4EC 4JI0C 1FUGA 1PU1A 2P2JA 3J81D 4DV2C 2E8CA 2D28C 3TUFA 1UWDA 3K6RA 4OYCA 2D1SA 3TR3A 1N32C 3AY0A 3N2QA 3G7SA 2DPLA 3GR0A 1MXBA 4G36A 5BURA 2UUAC 4KTVA 4JI3C 1XHJA 1V25A 4JV5C 1FJGC 1L2FA 4JI7C 2QVZX 4RLQA 3LNOA 4DR7C 2CY1A 5A1GA 4RLFA 4JM1A 4ISBA 1USPB 1I94C 4YHHC 3PROC 2KZFA 2D1TA 4DCVA 5BR8C 2ZM6C 2JNVA 4NDNA 4L7IA 1AMUA 3A25A 2HJGA 1J5EC 2P2FA 4LF6C 3R9WA 1ML8A 4X66C 5BSUA 3AF6A 1O93A 5BUQA 2VQFC 2P2BA 4DV7C 1O9TA 3IMLA 2D27A 3CW8X 5IFIA 4DR4C 4BC7A 1RY2A 3R9XA 4RVNA 2M5HA 5LMUC 4BCAA 4I9GA 3OTOC 5JRHA 5LCIA 3GPCA 3NPDA 3I07A 2E0GA 5GTDA 3A9VA 1O90A 2QVYX 2MMAB 5A2QD 1P4EA 4LFCC 3E7WA 4MH4A 2ZZNA 1TH5A 5K8FA 3T1HC 2AYAA 2OBVA 4DV0C 3ETCA 4X62C 2PN2A 2Y4NA 1RG9A 3PESA 2QVXX 2UXDC 3EERA 1UKKA 1PA4A 2P02A 3TDEA 4JI6C 2UXCC 1XMQC 5LMNC 4R1MA 5AE1A 4JI5C 5CZVA 4LFBC 1IBKC 4LE5A 2CXCA 3ETOA 4ODJA 3TQIA 4FUQA 1LQLA 2OPLA 4DR1C 1HH2P 4WS9A 1HR0C 1XDXA 4YY3C 4DUYC 4GKKC 2UUBC 2F4VC 5H9UA 3PBKA 1T5DX 4PZPA 2ASBA 4DV4C 4DV3C 1MXAA 2D7VA 4X65C 4R0MA 1XNRC 3IEUA 4PUIA 5BSRA 4GXQA 1K0RA 3GKUA 3E7XA 2YWCA 2PG1E 3R44A 4FUTA 3SO4A 2E7GA 5E7QA 2D1QA 4OXIA 4GXRA 4I9FA 5IWAC 1YJ7A 1HNWC 1ZB8A 4AQYC 3H2TA 3DAYA 2PT7G 4GKJC 1M6XA 1HNXC 3LAXA 4LF9C 2P2MA 4K0BA 3VNQA 4X64C 3EQ6A 4NXMC 3UX3A 4D4IA 2BJOA 2EGTA 2P2QA 2KZ0A 4PUHA 4DR5C 2QW0X 3FCEA
chains in the Genus database with same CATH topology
2WD9A 1XRCA 2D1RA 3RV2A 3CJEA 2JMPA 4B3RC 4JI8C 4HPVA 1QWIA 1HNZC 3L95X 3C5EA 3A9UA 2E5LC 4DUZC 4JYAC 3T1YC 2E8FA 3VNRA 2XR1A 1VLAA 4NOZA 1KKGA 4DG8A 5A19A 2VQEC 4EATA 3J7AD 4DCTA 1N33C 1N36C 3DHVA 1BA3A 3DLPX 5CZXA 1EGAA 2YCBA 4LF4C 4D56A 4LF7C 3IEVA 1USPA 4LF8C 3FCCA 4ZLPA 4D4GA 4RM3A 4L2ZA 5T8SA 1WF3A 4KTTA 4BBYA 5AE3A 4RM2A 1QM4A 1MXCA 5KEIA 1ULTA 1PG3A 2ATWA 4JI1C 4XX2A 5DV9A 1V26A 2BH1X 3LGXA 1NYEA 4B3MC 3I08A 3NI2A 4MTNA 1O92A 3A4IA 1JOSA 4IZ6A 4JI2C 4IR7A 1PG4A 4DR2C 2PROA 2V7BA 2YWBA 1WH9A 2WP0C 3UOWA 3UZ0A 2VSQA 3KXWA 4TPSB 4R1LA 4LFAC 4DG9A 1P7LA 3L8CA 4DV5C 2P20A 4L4QA 1XRAA 3AF5A 5KYTA 1IBLC 1N34C 5K85A 2ONFA 4GS5A 4K0KC 5T8TA 3LNVA 5KYVA 2OPLB 4G1IA 5BSWA 5FLXD 3CW9A 4PROC 4DR6C 4PHTA 4B3SC 3S82A 5BSMA 2QL8A 1MKYA 3GR1A 5BUSA 4WV3A 4DV1C 4DCSA 2OO4A 1N2FA 5IT9D 2HHHC 5AE2A 4G37A 1T5HX 4RVOA 1GPMA 2DYJA 5A1IA 4JI4C 3J80D 3VNSA 4DR3C 1XMOC 4NXNC 3N54B 1IBMC 4BSZA 4DCUA 2UU9C 4D57A 2UUCC 1MDBA 2E8EA 2VZEA 4LF5C 4DV6C 1MD9A 4KHPC 2Y27A 4RMNA 2Y4OA 4U5YD 4FTFA 5ADZA 4ZJZA 5BSTA 1XNQC 3JAMD 2UXBC 3LUSA 1XRBA 3NYQA 4B3TC 3NYRA 3RG2A 1LCIA 1ZB9A 5BSVA 1MDFA 4OX9C 3B7WA 3IPLA 4BC9A 4JI0C 1FUGA 2P2JA 3J81D 4DV2C 2E8CA 2D28C 3TUFA 4OYCA 2D1SA 1N32C 3N2QA 3G7SA 2DPLA 3GR0A 1MXBA 4G36A 5BURA 2UUAC 4KTVA 4JI3C 1V25A 4JV5C 1FJGC 1L2FA 4JI7C 2QVZX 4RLQA 4DR7C 2CY1A 5A1GA 4RLFA 4JM1A 4ISBA 1USPB 1I94C 4YHHC 3PROC 2KZFA 2D1TA 4DCVA 5BR8C 2ZM6C 4NDNA 4L7IA 1AMUA 2HJGA 1J5EC 2P2FA 4LF6C 3R9WA 1ML8A 4X66C 5BSUA 3AF6A 1O93A 5BUQA 2VQFC 2P2BA 4DV7C 1O9TA 3IMLA 2D27A 3CW8X 5IFIA 4DR4C 4BC7A 1RY2A 3R9XA 4RVNA 5LMUC 4BCAA 4I9GA 3OTOC 5JRHA 3GPCA 3NPDA 3I07A 2E0GA 5GTDA 3A9VA 1O90A 2QVYX 5A2QD 4LFCC 3E7WA 4MH4A 5K8FA 3T1HC 2AYAA 2OBVA 4DV0C 3ETCA 4X62C 2PN2A 2Y4NA 1RG9A 3PESA 2QVXX 2UXDC 3EERA 1UKKA 1PA4A 2P02A 3TDEA 4JI6C 2UXCC 1XMQC 5LMNC 4R1MA 5AE1A 4JI5C 5CZVA 4LFBC 1IBKC 4LE5A 2CXCA 3ETOA 4ODJA 3TQIA 4FUQA 1LQLA 2OPLA 4DR1C 1HH2P 4WS9A 1HR0C 4YY3C 4DUYC 4GKKC 2UUBC 2F4VC 5H9UA 3PBKA 1T5DX 4PZPA 2ASBA 4DV4C 4DV3C 1MXAA 2D7VA 4X65C 4R0MA 1XNRC 3IEUA 5BSRA 4GXQA 1K0RA 3GKUA 3E7XA 2YWCA 3R44A 4FUTA 3SO4A 2E7GA 5E7QA 2D1QA 4OXIA 4GXRA 4I9FA 5IWAC 1YJ7A 1HNWC 1ZB8A 4AQYC 3H2TA 3DAYA 2PT7G 4GKJC 1HNXC 3LAXA 4LF9C 2P2MA 4K0BA 3VNQA 4X64C 3EQ6A 4NXMC 4D4IA 2BJOA 2EGTA 2P2QA 4DR5C 2QW0X 3FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONF A;  2UXD C;  3CJE A;  3EER A;  1UKK A;  1PA4 A;  2JMP A;  2UXC C;  4JI6 C;  1XMQ C;  4B3R C;  4JI8 C;  5LMN C;  4K0K C;  1QWI A;  1HNZ C;  4JI5 C;  1N32 C;  2OPL B;  5FLX D;  4LFB C;  1IBK C;  2E5L C;  4DUZ C;  4JYA C;  3T1Y C;  2CXC A;  2E8F A;  2XR1 A;  1VLA A;  4DR6 C;  4NOZ A;  1LQL A;  1KKG A;  4B3S C;  2OPL A;  4DR1 C;  1HH2 P;  2VQE C;  2QL8 A;  3J7A D;  4DCT A;  1MKY A;  2UUA C;  4DV1 C;  4DCS A;  1N33 C;  4JI3 C;  4JV5 C;  1N36 C;  1HR0 C;  1N2F A;  1L2F A;  4YY3 C;  4DUY C;  5IT9 D;  4JI7 C;  4GKK C;  1FJG C;  2HHH C;  2UUB C;  2F4V C;  4DR7 C;  2CY1 A;  1EGA A;  2ASB A;  4DV4 C;  4DV3 C;  2YCB A;  1I94 C;  1USP B;  4LF4 C;  2D7V A;  4YHH C;  4X65 C;  2KZF A;  4DCV A;  5BR8 C;  2DYJ A;  2ZM6 C;  1XNR C;  4LF7 C;  3IEV A;  1USP A;  4LF8 C;  4JI4 C;  3IEU A;  2HJG A;  3J80 D;  1K0R A;  1J5E C;  4LF6 C;  3R9W A;  4DR3 C;  3GKU A;  1XMO C;  1ML8 A;  4NXN C;  4X66 C;  1IBM C;  3AF6 A;  4BSZ A;  2VQF C;  1WF3 A;  4DCU A;  2UU9 C;  2E7G A;  4DV7 C;  2UUC C;  4DR4 C;  2E8E A;  2ATW A;  4JI1 C;  3R9X A;  4XX2 A;  4LF5 C;  5LMU C;  3OTO C;  4DV6 C;  5IWA C;  1NYE A;  4B3M C;  4KHP C;  1HNW C;  4DR5 C;  1ZB8 A;  4AQY C;  4MTN A;  2PT7 G;  3I07 A;  4GKJ C;  1XNQ C;  1JOS A;  3JAM D;  1HNX C;  2UXB C;  3LUS A;  4B3T C;  4JI2 C;  4LF9 C;  4DR2 C;  4X64 C;  5A2Q D;  4NXM C;  1WH9 A;  4LFC C;  1ZB9 A;  4OX9 C;  4MH4 A;  4JI0 C;  2BJO A;  3J81 D;  4DV2 C;  4LFA C;  3T1H C;  2E8C A;  2EGT A;  4DV5 C;  4DV0 C;  3AF5 A;  1IBL C;  4X62 C;  1N34 C;  2PN2 A; 
#chains in the Genus database with same CATH topology
 2WD9 A;  1XRC A;  2D1R A;  3RV2 A;  3CJE A;  2JMP A;  1V60 A;  4B3R C;  4JI8 C;  4HPV A;  1NY8 A;  1QWI A;  1HNZ C;  3L95 X;  3C5E A;  3A9U A;  2E5L C;  4DUZ C;  2ZZM A;  3T1Y C;  4JYA C;  2E8F A;  3UX2 A;  3VNR A;  2XR1 A;  1VLA A;  4NOZ A;  1KKG A;  4DG8 A;  5A19 A;  2M5O A;  2VQE C;  4EAT A;  3J7A D;  4DCT A;  1N33 C;  1N36 C;  3DHV A;  1BA3 A;  3DLP X;  5CZX A;  1M6X C;  2Z51 A;  1EGA A;  2YCB A;  3A26 A;  4LF4 C;  4D56 A;  1YGT A;  4LF7 C;  3IEV A;  1USP A;  4LF8 C;  3FCC A;  4ZLP A;  4D4G A;  4RM3 A;  4L2Z A;  5T8S A;  1WF3 A;  4KTT A;  4BBY A;  5AE3 A;  4RM2 A;  1QM4 A;  1MXC A;  5KEI A;  1ULT A;  1PG3 A;  2ATW A;  4JI1 C;  4XX2 A;  2NCL A;  5DV9 A;  1V26 A;  2BH1 X;  3LGX A;  1NYE A;  4B3M C;  3I08 A;  3NI2 A;  4MTN A;  2MM9 A;  3CQ3 A;  1O92 A;  3UEB A;  3A4I A;  1JOS A;  4IZ6 A;  4JI2 C;  4IR7 A;  2MCQ A;  1PG4 A;  4DR2 C;  2PRO A;  2V7B A;  2YWB A;  1WH9 A;  2WP0 C;  3UOW A;  3UZ0 A;  2VSQ A;  3KXW A;  4TPS B;  1XS3 A;  4R1L A;  4LFA C;  4DG9 A;  3FM7 A;  1P7L A;  3L8C A;  4DV5 C;  2P20 A;  4L4Q A;  1XRA A;  3AF5 A;  5KYT A;  1IBL C;  1N34 C;  5K85 A;  2ONF A;  4GS5 A;  2KDN A;  4PUG A;  3CQ2 A;  4K0K C;  5T8T A;  3LNV A;  5KYV A;  2OPL B;  4G1I A;  5BSW A;  5FLX D;  3CW9 A;  2CU6 A;  4PRO C;  1IB8 A;  4DR6 C;  4PHT A;  4B3S C;  3S82 A;  5BSM A;  3CQ1 A;  2QL8 A;  1MKY A;  3GR1 A;  5BUS A;  4WV3 A;  4DV1 C;  4DCS A;  2OO4 A;  1N2F A;  5IT9 D;  2HHH C;  5AE2 A;  4G37 A;  1T5H X;  4RVO A;  1GPM A;  2DYJ A;  5A1I A;  4JI4 C;  3J80 D;  3VNS A;  4DR3 C;  1XMO C;  4NXN C;  3N54 B;  1IBM C;  4BSZ A;  4DCU A;  2UU9 C;  4D57 A;  2UUC C;  1MDB A;  2E8E A;  2VZE A;  2YX1 A;  4LF5 C;  1FLO A;  1WCJ A;  2ZTB A;  4DV6 C;  1MD9 A;  3O2E A;  4KHP C;  2Y27 A;  4RMN A;  2Y4O A;  4U5Y D;  1VEH A;  4FTF A;  5ADZ A;  4ZJZ A;  5BST A;  1XNQ C;  3JAM D;  2UXB C;  3LUS A;  1XRB A;  3NYQ A;  4B3T C;  3NYR A;  3RG2 A;  1LCI A;  1ZB9 A;  5BSV A;  1MDF A;  4OX9 C;  3B7W A;  2DHM A;  3IPL A;  4BC9 A;  1P4E C;  4JI0 C;  1FUG A;  1PU1 A;  2P2J A;  3J81 D;  4DV2 C;  2E8C A;  2D28 C;  3TUF A;  1UWD A;  3K6R A;  4OYC A;  2D1S A;  3TR3 A;  1N32 C;  3AY0 A;  3N2Q A;  3G7S A;  2DPL A;  3GR0 A;  1MXB A;  4G36 A;  5BUR A;  2UUA C;  4KTV A;  4JI3 C;  1XHJ A;  1V25 A;  4JV5 C;  1FJG C;  1L2F A;  4JI7 C;  2QVZ X;  4RLQ A;  3LNO A;  4DR7 C;  2CY1 A;  5A1G A;  4RLF A;  4JM1 A;  4ISB A;  1USP B;  1I94 C;  4YHH C;  3PRO C;  2KZF A;  2D1T A;  4DCV A;  5BR8 C;  2ZM6 C;  2JNV A;  4NDN A;  4L7I A;  1AMU A;  3A25 A;  2HJG A;  1J5E C;  2P2F A;  4LF6 C;  3R9W A;  1ML8 A;  4X66 C;  5BSU A;  3AF6 A;  1O93 A;  5BUQ A;  2VQF C;  2P2B A;  4DV7 C;  1O9T A;  3IML A;  2D27 A;  3CW8 X;  5IFI A;  4DR4 C;  4BC7 A;  1RY2 A;  3R9X A;  4RVN A;  2M5H A;  5LMU C;  4BCA A;  4I9G A;  3OTO C;  5JRH A;  5LCI A;  3GPC A;  3NPD A;  3I07 A;  2E0G A;  5GTD A;  3A9V A;  1O90 A;  2QVY X;  2MMA B;  5A2Q D;  1P4E A;  4LFC C;  3E7W A;  4MH4 A;  2ZZN A;  1TH5 A;  5K8F A;  3T1H C;  2AYA A;  2OBV A;  4DV0 C;  3ETC A;  4X62 C;  2PN2 A;  2Y4N A;  1RG9 A;  3PES A;  2QVX X;  2UXD C;  3EER A;  1UKK A;  1PA4 A;  2P02 A;  3TDE A;  4JI6 C;  2UXC C;  1XMQ C;  5LMN C;  4R1M A;  5AE1 A;  4JI5 C;  5CZV A;  4LFB C;  1IBK C;  4LE5 A;  2CXC A;  3ETO A;  4ODJ A;  3TQI A;  4FUQ A;  1LQL A;  2OPL A;  4DR1 C;  1HH2 P;  4WS9 A;  1HR0 C;  1XDX A;  4YY3 C;  4DUY C;  4GKK C;  2UUB C;  2F4V C;  5H9U A;  3PBK A;  1T5D X;  4PZP A;  2ASB A;  4DV4 C;  4DV3 C;  1MXA A;  2D7V A;  4X65 C;  4R0M A;  1XNR C;  3IEU A;  4PUI A;  5BSR A;  4GXQ A;  1K0R A;  3GKU A;  3E7X A;  2YWC A;  2PG1 E;  3R44 A;  4FUT A;  3SO4 A;  2E7G A;  5E7Q A;  2D1Q A;  4OXI A;  4GXR A;  4I9F A;  5IWA C;  1YJ7 A;  1HNW C;  1ZB8 A;  4AQY C;  3H2T A;  3DAY A;  2PT7 G;  4GKJ C;  1M6X A;  1HNX C;  3LAX A;  4LF9 C;  2P2M A;  4K0B A;  3VNQ A;  4X64 C;  3EQ6 A;  4NXM C;  3UX3 A;  4D4I A;  2BJO A;  2EGT A;  2P2Q A;  2KZ0 A;  4PUH A;  4DR5 C;  2QW0 X;  3FCE A; 
#chains in the Genus database with same CATH homology
 2WD9 A;  1XRC A;  2D1R A;  3RV2 A;  3CJE A;  2JMP A;  4B3R C;  4JI8 C;  4HPV A;  1QWI A;  1HNZ C;  3L95 X;  3C5E A;  3A9U A;  2E5L C;  4DUZ C;  4JYA C;  3T1Y C;  2E8F A;  3VNR A;  2XR1 A;  1VLA A;  4NOZ A;  1KKG A;  4DG8 A;  5A19 A;  2VQE C;  4EAT A;  3J7A D;  4DCT A;  1N33 C;  1N36 C;  3DHV A;  1BA3 A;  3DLP X;  5CZX A;  1EGA A;  2YCB A;  4LF4 C;  4D56 A;  4LF7 C;  3IEV A;  1USP A;  4LF8 C;  3FCC A;  4ZLP A;  4D4G A;  4RM3 A;  4L2Z A;  5T8S A;  1WF3 A;  4KTT A;  4BBY A;  5AE3 A;  4RM2 A;  1QM4 A;  1MXC A;  5KEI A;  1ULT A;  1PG3 A;  2ATW A;  4JI1 C;  4XX2 A;  5DV9 A;  1V26 A;  2BH1 X;  3LGX A;  1NYE A;  4B3M C;  3I08 A;  3NI2 A;  4MTN A;  1O92 A;  3A4I A;  1JOS A;  4IZ6 A;  4JI2 C;  4IR7 A;  1PG4 A;  4DR2 C;  2PRO A;  2V7B A;  2YWB A;  1WH9 A;  2WP0 C;  3UOW A;  3UZ0 A;  2VSQ A;  3KXW A;  4TPS B;  4R1L A;  4LFA C;  4DG9 A;  1P7L A;  3L8C A;  4DV5 C;  2P20 A;  4L4Q A;  1XRA A;  3AF5 A;  5KYT A;  1IBL C;  1N34 C;  5K85 A;  2ONF A;  4GS5 A;  4K0K C;  5T8T A;  3LNV A;  5KYV A;  2OPL B;  4G1I A;  5BSW A;  5FLX D;  3CW9 A;  4PRO C;  4DR6 C;  4PHT A;  4B3S C;  3S82 A;  5BSM A;  2QL8 A;  1MKY A;  3GR1 A;  5BUS A;  4WV3 A;  4DV1 C;  4DCS A;  2OO4 A;  1N2F A;  5IT9 D;  2HHH C;  5AE2 A;  4G37 A;  1T5H X;  4RVO A;  1GPM A;  2DYJ A;  5A1I A;  4JI4 C;  3J80 D;  3VNS A;  4DR3 C;  1XMO C;  4NXN C;  3N54 B;  1IBM C;  4BSZ A;  4DCU A;  2UU9 C;  4D57 A;  2UUC C;  1MDB A;  2E8E A;  2VZE A;  4LF5 C;  4DV6 C;  1MD9 A;  4KHP C;  2Y27 A;  4RMN A;  2Y4O A;  4U5Y D;  4FTF A;  5ADZ A;  4ZJZ A;  5BST A;  1XNQ C;  3JAM D;  2UXB C;  3LUS A;  1XRB A;  3NYQ A;  4B3T C;  3NYR A;  3RG2 A;  1LCI A;  1ZB9 A;  5BSV A;  1MDF A;  4OX9 C;  3B7W A;  3IPL A;  4BC9 A;  4JI0 C;  1FUG A;  2P2J A;  3J81 D;  4DV2 C;  2E8C A;  2D28 C;  3TUF A;  4OYC A;  2D1S A;  1N32 C;  3N2Q A;  3G7S A;  2DPL A;  3GR0 A;  1MXB A;  4G36 A;  5BUR A;  2UUA C;  4KTV A;  4JI3 C;  1V25 A;  4JV5 C;  1FJG C;  1L2F A;  4JI7 C;  2QVZ X;  4RLQ A;  4DR7 C;  2CY1 A;  5A1G A;  4RLF A;  4JM1 A;  4ISB A;  1USP B;  1I94 C;  4YHH C;  3PRO C;  2KZF A;  2D1T A;  4DCV A;  5BR8 C;  2ZM6 C;  4NDN A;  4L7I A;  1AMU A;  2HJG A;  1J5E C;  2P2F A;  4LF6 C;  3R9W A;  1ML8 A;  4X66 C;  5BSU A;  3AF6 A;  1O93 A;  5BUQ A;  2VQF C;  2P2B A;  4DV7 C;  1O9T A;  3IML A;  2D27 A;  3CW8 X;  5IFI A;  4DR4 C;  4BC7 A;  1RY2 A;  3R9X A;  4RVN A;  5LMU C;  4BCA A;  4I9G A;  3OTO C;  5JRH A;  3GPC A;  3NPD A;  3I07 A;  2E0G A;  5GTD A;  3A9V A;  1O90 A;  2QVY X;  5A2Q D;  4LFC C;  3E7W A;  4MH4 A;  5K8F A;  3T1H C;  2AYA A;  2OBV A;  4DV0 C;  3ETC A;  4X62 C;  2PN2 A;  2Y4N A;  1RG9 A;  3PES A;  2QVX X;  2UXD C;  3EER A;  1UKK A;  1PA4 A;  2P02 A;  3TDE A;  4JI6 C;  2UXC C;  1XMQ C;  5LMN C;  4R1M A;  5AE1 A;  4JI5 C;  5CZV A;  4LFB C;  1IBK C;  4LE5 A;  2CXC A;  3ETO A;  4ODJ A;  3TQI A;  4FUQ A;  1LQL A;  2OPL A;  4DR1 C;  1HH2 P;  4WS9 A;  1HR0 C;  4YY3 C;  4DUY C;  4GKK C;  2UUB C;  2F4V C;  5H9U A;  3PBK A;  1T5D X;  4PZP A;  2ASB A;  4DV4 C;  4DV3 C;  1MXA A;  2D7V A;  4X65 C;  4R0M A;  1XNR C;  3IEU A;  5BSR A;  4GXQ A;  1K0R A;  3GKU A;  3E7X A;  2YWC A;  3R44 A;  4FUT A;  3SO4 A;  2E7G A;  5E7Q A;  2D1Q A;  4OXI A;  4GXR A;  4I9F A;  5IWA C;  1YJ7 A;  1HNW C;  1ZB8 A;  4AQY C;  3H2T A;  3DAY A;  2PT7 G;  4GKJ C;  1HNX C;  3LAX A;  4LF9 C;  2P2M A;  4K0B A;  3VNQ A;  4X64 C;  3EQ6 A;  4NXM C;  4D4I A;  2BJO A;  2EGT A;  2P2Q A;  4DR5 C;  2QW0 X;  3FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...