4LF6C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4lf6C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4lf6C02
3IEVA 2HJGA 1N2FA 4JI6C 4MH4A 4GKKC 1IBLC 1N34C 4NOZA 1K0RA 1I94C 1ZB8A 2D7VA 5LMUC 3R9XA 2KZFA 4DCVA 3GKUA 2PN2A 1NYEA 1ZB9A 2JMPA 4K0KC 4DV2C 4YHHC 4JYAC 2EGTA 4DV6C 4DUZC 2ASBA 1HNXC 4DR1C 1N33C 1WF3A 1VLAA 5A2QD 2ONFA 1L2FA 2XR1A 1J5EC 1USPB 4LF4C 3J81D 4DV1C 4JI2C 4LF9C 4LF5C 4OX9C 2CXCA 4DR2C 4LFBC 2UU9C 3AF6A 3T1HC 4KHPC 4DV7C 4XX2A 3J7AD 1HH2P 4JI0C 4DV0C 4B3SC 4JI1C 4JI8C 4JI4C 1MKYA 2UXCC 3JAMD 4YY3C 1KKGA 1PA4A 5IT9D 4X66C 4LF7C 1WH9A 1XMOC 1USPA 3J80D 2VQEC 3EERA 2PT7G 1XNQC 2ATWA 4X65C 2VQFC 1XMQC 1XNRC 4DCUA 2BJOA 1EGAA 2DYJA 2UXDC 4DV4C 4DV3C 1UKKA 2E8EA 2UUCC 3CJEA 4JI5C 4DR3C 4X62C 4MTNA 1JOSA 4AQYC 4B3MC 1HNZC 5LMNC 4LF6C 4NXNC 4LF8C 4DR6C 3I07A 1ML8A 2HHHC 4BSZA 1HR0C 2UUBC 3R9WA 2F4VC 4B3TC 1N36C 4DCTA 4LFCC 4DR4C 4B3RC 2UXBC 1IBMC 5IWAC 4X64C 4DCSA 2E8CA 4DV5C 3AF5A 4DR7C 2E8FA 3IEUA 4NXMC 1QWIA 4JI7C 4LFAC 3T1YC 2E5LC 5BR8C 4JV5C 3OTOC 4GKJC 1N32C 4DUYC 5FLXD 2UUAC 2OPLB 2OPLA 4JI3C 3LUSA 1IBKC 1HNWC 2ZM6C 4DR5C 1LQLA 2QL8A 2E7GA 1FJGC 2CY1A 2YCBA
chains in the Genus database with same CATH superfamily
2HJGA 2OBVA 3GR0A 1V60A 1N34C 2D1TA 1ZB8A 3FCEA 2KZFA 2JMPA 3UZ0A 4JYAC 4DV6C 4DUZC 2QVXX 2ASBA 1HNXC 2QW0X 4D57A 3CQ3A 2YWCA 1FUGA 3CW8X 1WF3A 1VLAA 1PG3A 5BSVA 3O2EA 4LF4C 4DV1C 2ZZNA 1M6XC 2Y4NA 4LF5C 4K0BA 4OX9C 3UX2A 2UU9C 5T8SA 5JRHA 4KHPC 3A26A 4XX2A 1HH2P 1P4EA 3UEBA 2PG1E 4PZPA 4YY3C 1KKGA 1XMOC 3J80D 2OO4A 1O90A 4X65C 2P2BA 1XNRC 5LCIA 2BJOA 4DV3C 4DR3C 2D27A 1JOSA 1GPMA 5LMNC 3PROC 3KXWA 1ULTA 1MDFA 3LNOA 4B3TC 4LE5A 4LFCC 2MMAB 5GTDA 4DG8A 4DR4C 2E8CA 4DV5C 5BUQA 4RLFA 3K6RA 1O93A 3T1YC 4RVOA 4DUYC 2D1RA 5FLXD 4IZ6A 3SO4A 3FM7A 3NI2A 3LUSA 1IBKC 1HNWC 3GPCA 1P4EC 1O92A 2CY1A 4KTTA 5A1IA 4JI6C 4ODJA 1IBLC 3IMLA 4NOZA 1I94C 2V7BA 4BC9A 4WS9A 1MD9A 3R9XA 5K85A 4DCVA 1T5HX 1MXBA 2KZ0A 4DV2C 2KDNA 2EGTA 5BURA 1XRCA 5A2QD 5CZVA 1USPB 3J81D 1XS3A 4HPVA 3L8CA 1NY8A 3CQ1A 4LFBC 3AF6A 3T1HC 4G1IA 3VNSA 1IB8A 4BCAA 4JI0C 3NYRA 2QVYX 1PA4A 4LF7C 4G37A 2VQEC 1RG9A 3EERA 5BSTA 5BSRA 1MDBA 4ISBA 4ZJZA 3E7WA 5A1GA 4PROC 4I9FA 1UKKA 4WV3A 4D4IA 3I08A 4AQYC 2P2FA 3CQ2A 1HNZC 4LF6C 2HHHC 1FLOA 2F4VC 3PBKA 1XRAA 3H2TA 4U5YD 1AMUA 4B3RC 2NCLA 3S82A 5CZXA 4DCSA 3AF5A 3IEUA 4NXMC 4JI7C 3DHVA 5BR8C 3FCCA 4GXQA 3RG2A 2P20A 4G36A 2ZTBA 4ZLPA 2ZM6C 4L7IA 4DR5C 3LGXA 1FJGC 4I9GA 3G7SA 2P2QA 4FUQA 4RM2A 4MH4A 1XDXA 5KEIA 4OXIA 1K0RA 2D1SA 2D7VA 5LMUC 1NYEA 1MXAA 3TUFA 4YHHC 3LAXA 2Y27A 4NDNA 4RMNA 5K8FA 1L2FA 1YGTA 4JI2C 2QVZX 4L4QA 3UOWA 3VNRA 3N2QA 2AYAA 3AY0A 3PESA 4DV0C 4JI8C 4JI4C 2CU6A 4TPSB 1XHJA 2M5OA 1USPA 5BSWA 1XNQC 2ATWA 4RVNA 1V25A 4L2ZA 1XMQC 5A19A 4GS5A 5BSMA 1EGAA 2BH1X 2UXDC 2VSQA 4DV4C 2UUCC 2E8EA 4D56A 4MTNA 4X62C 4B3MC 3TQIA 5KYVA 3I07A 1ML8A 3A9UA 1MXCA 4BSZA 4R0MA 3R44A 2UUBC 1RY2A 1N36C 4FTFA 1BA3A 3IPLA 2UXBC 1IBMC 3C5EA 5IFIA 5KYTA 1QWIA 1UWDA 2WP0C 4LFAC 3TR3A 4FUTA 2E5LC 4JV5C 3OTOC 4GKJC 1N32C 3EQ6A 4JM1A 2VZEA 2UUAC 2OPLB 4RLQA 1P7LA 2MCQA 3RV2A 1LQLA 2QL8A 1QM4A 3A9VA 2E7GA 2Y4OA 2YCBA 3IEVA 3N54B 1N2FA 2JNVA 1WCJA 4GKKC 3UX3A 5AE1A 2D1QA 4BC7A 2DHMA 2P02A 3GKUA 1O9TA 2PN2A 3DLPX 5E7QA 3TDEA 1ZB9A 5BSUA 4K0KC 5AE3A 4R1LA 1PG4A 4PHTA 2MM9A 2Z51A 3A4IA 4DR1C 1N33C 4PUGA 4DG9A 4KTVA 2ONFA 2P2JA 2XR1A 1J5EC 3A25A 4LF9C 1V26A 2E0GA 3E7XA 5ADZA 2CXCA 4DR2C 4PUHA 4DV7C 3J7AD 1YJ7A 4PUIA 4B3SC 4JI1C 2D28C 4OYCA 2YWBA 1MKYA 2UXCC 3JAMD 5IT9D 4X66C 1WH9A 4GXRA 1LCIA 2PT7G 2DPLA 2VQFC 4IR7A 1T5DX 4RM3A 3ETCA 4DCUA 3DAYA 3VNQA 2DYJA 4JI5C 3LNVA 3CJEA 1TH5A 2ZZMA 4NXNC 4LF8C 4DR6C 2M5HA 3ETOA 5T8TA 1HR0C 5BUSA 3R9WA 4D4GA 2WD9A 4DCTA 2PROA 5DV9A 3B7WA 4EATA 3GR1A 5IWAC 4X64C 1PU1A 3NYQA 4DR7C 2E8FA 3CW9A 1M6XA 4R1MA 1VEHA 3L95X 2P2MA 3NPDA 2OPLA 2YX1A 4JI3C 5H9UA 1XRBA 4BBYA 5AE2A
chains in the Genus database with same CATH topology
2HJGA 2OBVA 3GR0A 1N34C 2D1TA 1ZB8A 3FCEA 2KZFA 2JMPA 3UZ0A 4JYAC 4DV6C 4DUZC 2QVXX 2ASBA 1HNXC 2QW0X 4D57A 2YWCA 1FUGA 3CW8X 1WF3A 1VLAA 1PG3A 5BSVA 4LF4C 4DV1C 2Y4NA 4LF5C 4K0BA 4OX9C 2UU9C 5T8SA 5JRHA 4KHPC 4XX2A 1HH2P 4PZPA 4YY3C 1KKGA 1XMOC 3J80D 2OO4A 1O90A 4X65C 2P2BA 1XNRC 2BJOA 4DV3C 4DR3C 2D27A 1JOSA 1GPMA 5LMNC 3PROC 3KXWA 1ULTA 1MDFA 4B3TC 4LE5A 4LFCC 5GTDA 4DG8A 4DR4C 2E8CA 4DV5C 5BUQA 4RLFA 1O93A 3T1YC 4RVOA 4DUYC 2D1RA 5FLXD 4IZ6A 3SO4A 3NI2A 3LUSA 1IBKC 1HNWC 3GPCA 1O92A 2CY1A 4KTTA 5A1IA 4JI6C 4ODJA 1IBLC 3IMLA 4NOZA 1I94C 2V7BA 4BC9A 4WS9A 1MD9A 3R9XA 5K85A 4DCVA 1T5HX 1MXBA 4DV2C 2EGTA 5BURA 1XRCA 5A2QD 5CZVA 1USPB 3J81D 4HPVA 3L8CA 4LFBC 3AF6A 3T1HC 4G1IA 3VNSA 4BCAA 4JI0C 3NYRA 2QVYX 1PA4A 4LF7C 4G37A 2VQEC 1RG9A 3EERA 5BSTA 5BSRA 1MDBA 4ISBA 4ZJZA 3E7WA 5A1GA 4PROC 4I9FA 1UKKA 4WV3A 4D4IA 3I08A 4AQYC 2P2FA 1HNZC 4LF6C 2HHHC 2F4VC 3PBKA 1XRAA 3H2TA 4U5YD 1AMUA 4B3RC 3S82A 5CZXA 4DCSA 3AF5A 3IEUA 4NXMC 4JI7C 3DHVA 5BR8C 3FCCA 4GXQA 3RG2A 2P20A 4G36A 4ZLPA 2ZM6C 4L7IA 4DR5C 3LGXA 1FJGC 4I9GA 3G7SA 2P2QA 4FUQA 4RM2A 4MH4A 5KEIA 4OXIA 1K0RA 2D1SA 2D7VA 5LMUC 1NYEA 1MXAA 3TUFA 4YHHC 3LAXA 2Y27A 4NDNA 4RMNA 5K8FA 1L2FA 4JI2C 2QVZX 4L4QA 3UOWA 3VNRA 3N2QA 2AYAA 3PESA 4DV0C 4JI8C 4JI4C 4TPSB 1USPA 5BSWA 1XNQC 2ATWA 4RVNA 1V25A 4L2ZA 1XMQC 5A19A 4GS5A 5BSMA 1EGAA 2BH1X 2UXDC 2VSQA 4DV4C 2UUCC 2E8EA 4D56A 4MTNA 4X62C 4B3MC 3TQIA 5KYVA 3I07A 1ML8A 3A9UA 1MXCA 4BSZA 4R0MA 3R44A 2UUBC 1RY2A 1N36C 4FTFA 1BA3A 3IPLA 2UXBC 1IBMC 3C5EA 5IFIA 5KYTA 1QWIA 2WP0C 4LFAC 4FUTA 2E5LC 4JV5C 3OTOC 4GKJC 1N32C 3EQ6A 4JM1A 2VZEA 2UUAC 2OPLB 4RLQA 1P7LA 3RV2A 1LQLA 2QL8A 1QM4A 3A9VA 2E7GA 2Y4OA 2YCBA 3IEVA 3N54B 1N2FA 4GKKC 5AE1A 2D1QA 4BC7A 2P02A 3GKUA 1O9TA 2PN2A 3DLPX 5E7QA 3TDEA 1ZB9A 5BSUA 4K0KC 5AE3A 4R1LA 1PG4A 4PHTA 3A4IA 4DR1C 1N33C 4DG9A 4KTVA 2ONFA 2P2JA 2XR1A 1J5EC 4LF9C 1V26A 2E0GA 3E7XA 5ADZA 2CXCA 4DR2C 4DV7C 3J7AD 1YJ7A 4B3SC 4JI1C 2D28C 4OYCA 2YWBA 1MKYA 2UXCC 3JAMD 5IT9D 4X66C 1WH9A 4GXRA 1LCIA 2PT7G 2DPLA 2VQFC 4IR7A 1T5DX 4RM3A 3ETCA 4DCUA 3DAYA 3VNQA 2DYJA 4JI5C 3LNVA 3CJEA 4NXNC 4LF8C 4DR6C 3ETOA 5T8TA 1HR0C 5BUSA 3R9WA 4D4GA 2WD9A 4DCTA 2PROA 5DV9A 3B7WA 4EATA 3GR1A 5IWAC 4X64C 3NYQA 4DR7C 2E8FA 3CW9A 4R1MA 3L95X 2P2MA 3NPDA 2OPLA 4JI3C 5H9UA 1XRBA 4BBYA 5AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEV A;  2HJG A;  1N2F A;  4JI6 C;  4MH4 A;  4GKK C;  1IBL C;  1N34 C;  4NOZ A;  1K0R A;  1I94 C;  1ZB8 A;  2D7V A;  5LMU C;  3R9X A;  2KZF A;  4DCV A;  3GKU A;  2PN2 A;  1NYE A;  1ZB9 A;  2JMP A;  4K0K C;  4DV2 C;  4YHH C;  4JYA C;  2EGT A;  4DV6 C;  4DUZ C;  2ASB A;  1HNX C;  4DR1 C;  1N33 C;  1WF3 A;  1VLA A;  5A2Q D;  2ONF A;  1L2F A;  2XR1 A;  1J5E C;  1USP B;  4LF4 C;  3J81 D;  4DV1 C;  4JI2 C;  4LF9 C;  4LF5 C;  4OX9 C;  2CXC A;  4DR2 C;  4LFB C;  2UU9 C;  3AF6 A;  3T1H C;  4KHP C;  4DV7 C;  4XX2 A;  3J7A D;  1HH2 P;  4JI0 C;  4DV0 C;  4B3S C;  4JI1 C;  4JI8 C;  4JI4 C;  1MKY A;  2UXC C;  3JAM D;  4YY3 C;  1KKG A;  1PA4 A;  5IT9 D;  4X66 C;  4LF7 C;  1WH9 A;  1XMO C;  1USP A;  3J80 D;  2VQE C;  3EER A;  2PT7 G;  1XNQ C;  2ATW A;  4X65 C;  2VQF C;  1XMQ C;  1XNR C;  4DCU A;  2BJO A;  1EGA A;  2DYJ A;  2UXD C;  4DV4 C;  4DV3 C;  1UKK A;  2E8E A;  2UUC C;  3CJE A;  4JI5 C;  4DR3 C;  4X62 C;  4MTN A;  1JOS A;  4AQY C;  4B3M C;  1HNZ C;  5LMN C;  4LF6 C;  4NXN C;  4LF8 C;  4DR6 C;  3I07 A;  1ML8 A;  2HHH C;  4BSZ A;  1HR0 C;  2UUB C;  3R9W A;  2F4V C;  4B3T C;  1N36 C;  4DCT A;  4LFC C;  4DR4 C;  4B3R C;  2UXB C;  1IBM C;  5IWA C;  4X64 C;  4DCS A;  2E8C A;  4DV5 C;  3AF5 A;  4DR7 C;  2E8F A;  3IEU A;  4NXM C;  1QWI A;  4JI7 C;  4LFA C;  3T1Y C;  2E5L C;  5BR8 C;  4JV5 C;  3OTO C;  4GKJ C;  1N32 C;  4DUY C;  5FLX D;  2UUA C;  2OPL B;  2OPL A;  4JI3 C;  3LUS A;  1IBK C;  1HNW C;  2ZM6 C;  4DR5 C;  1LQL A;  2QL8 A;  2E7G A;  1FJG C;  2CY1 A;  2YCB A; 
#chains in the Genus database with same CATH topology
 2HJG A;  2OBV A;  3GR0 A;  1V60 A;  1N34 C;  2D1T A;  1ZB8 A;  3FCE A;  2KZF A;  2JMP A;  3UZ0 A;  4JYA C;  4DV6 C;  4DUZ C;  2QVX X;  2ASB A;  1HNX C;  2QW0 X;  4D57 A;  3CQ3 A;  2YWC A;  1FUG A;  3CW8 X;  1WF3 A;  1VLA A;  1PG3 A;  5BSV A;  3O2E A;  4LF4 C;  4DV1 C;  2ZZN A;  1M6X C;  2Y4N A;  4LF5 C;  4K0B A;  4OX9 C;  3UX2 A;  2UU9 C;  5T8S A;  5JRH A;  4KHP C;  3A26 A;  4XX2 A;  1HH2 P;  1P4E A;  3UEB A;  2PG1 E;  4PZP A;  4YY3 C;  1KKG A;  1XMO C;  3J80 D;  2OO4 A;  1O90 A;  4X65 C;  2P2B A;  1XNR C;  5LCI A;  2BJO A;  4DV3 C;  4DR3 C;  2D27 A;  1JOS A;  1GPM A;  5LMN C;  3PRO C;  3KXW A;  1ULT A;  1MDF A;  3LNO A;  4B3T C;  4LE5 A;  4LFC C;  2MMA B;  5GTD A;  4DG8 A;  4DR4 C;  2E8C A;  4DV5 C;  5BUQ A;  4RLF A;  3K6R A;  1O93 A;  3T1Y C;  4RVO A;  4DUY C;  2D1R A;  5FLX D;  4IZ6 A;  3SO4 A;  3FM7 A;  3NI2 A;  3LUS A;  1IBK C;  1HNW C;  3GPC A;  1P4E C;  1O92 A;  2CY1 A;  4KTT A;  5A1I A;  4JI6 C;  4ODJ A;  1IBL C;  3IML A;  4NOZ A;  1I94 C;  2V7B A;  4BC9 A;  4WS9 A;  1MD9 A;  3R9X A;  5K85 A;  4DCV A;  1T5H X;  1MXB A;  2KZ0 A;  4DV2 C;  2KDN A;  2EGT A;  5BUR A;  1XRC A;  5A2Q D;  5CZV A;  1USP B;  3J81 D;  1XS3 A;  4HPV A;  3L8C A;  1NY8 A;  3CQ1 A;  4LFB C;  3AF6 A;  3T1H C;  4G1I A;  3VNS A;  1IB8 A;  4BCA A;  4JI0 C;  3NYR A;  2QVY X;  1PA4 A;  4LF7 C;  4G37 A;  2VQE C;  1RG9 A;  3EER A;  5BST A;  5BSR A;  1MDB A;  4ISB A;  4ZJZ A;  3E7W A;  5A1G A;  4PRO C;  4I9F A;  1UKK A;  4WV3 A;  4D4I A;  3I08 A;  4AQY C;  2P2F A;  3CQ2 A;  1HNZ C;  4LF6 C;  2HHH C;  1FLO A;  2F4V C;  3PBK A;  1XRA A;  3H2T A;  4U5Y D;  1AMU A;  4B3R C;  2NCL A;  3S82 A;  5CZX A;  4DCS A;  3AF5 A;  3IEU A;  4NXM C;  4JI7 C;  3DHV A;  5BR8 C;  3FCC A;  4GXQ A;  3RG2 A;  2P20 A;  4G36 A;  2ZTB A;  4ZLP A;  2ZM6 C;  4L7I A;  4DR5 C;  3LGX A;  1FJG C;  4I9G A;  3G7S A;  2P2Q A;  4FUQ A;  4RM2 A;  4MH4 A;  1XDX A;  5KEI A;  4OXI A;  1K0R A;  2D1S A;  2D7V A;  5LMU C;  1NYE A;  1MXA A;  3TUF A;  4YHH C;  3LAX A;  2Y27 A;  4NDN A;  4RMN A;  5K8F A;  1L2F A;  1YGT A;  4JI2 C;  2QVZ X;  4L4Q A;  3UOW A;  3VNR A;  3N2Q A;  2AYA A;  3AY0 A;  3PES A;  4DV0 C;  4JI8 C;  4JI4 C;  2CU6 A;  4TPS B;  1XHJ A;  2M5O A;  1USP A;  5BSW A;  1XNQ C;  2ATW A;  4RVN A;  1V25 A;  4L2Z A;  1XMQ C;  5A19 A;  4GS5 A;  5BSM A;  1EGA A;  2BH1 X;  2UXD C;  2VSQ A;  4DV4 C;  2UUC C;  2E8E A;  4D56 A;  4MTN A;  4X62 C;  4B3M C;  3TQI A;  5KYV A;  3I07 A;  1ML8 A;  3A9U A;  1MXC A;  4BSZ A;  4R0M A;  3R44 A;  2UUB C;  1RY2 A;  1N36 C;  4FTF A;  1BA3 A;  3IPL A;  2UXB C;  1IBM C;  3C5E A;  5IFI A;  5KYT A;  1QWI A;  1UWD A;  2WP0 C;  4LFA C;  3TR3 A;  4FUT A;  2E5L C;  4JV5 C;  3OTO C;  4GKJ C;  1N32 C;  3EQ6 A;  4JM1 A;  2VZE A;  2UUA C;  2OPL B;  4RLQ A;  1P7L A;  2MCQ A;  3RV2 A;  1LQL A;  2QL8 A;  1QM4 A;  3A9V A;  2E7G A;  2Y4O A;  2YCB A;  3IEV A;  3N54 B;  1N2F A;  2JNV A;  1WCJ A;  4GKK C;  3UX3 A;  5AE1 A;  2D1Q A;  4BC7 A;  2DHM A;  2P02 A;  3GKU A;  1O9T A;  2PN2 A;  3DLP X;  5E7Q A;  3TDE A;  1ZB9 A;  5BSU A;  4K0K C;  5AE3 A;  4R1L A;  1PG4 A;  4PHT A;  2MM9 A;  2Z51 A;  3A4I A;  4DR1 C;  1N33 C;  4PUG A;  4DG9 A;  4KTV A;  2ONF A;  2P2J A;  2XR1 A;  1J5E C;  3A25 A;  4LF9 C;  1V26 A;  2E0G A;  3E7X A;  5ADZ A;  2CXC A;  4DR2 C;  4PUH A;  4DV7 C;  3J7A D;  1YJ7 A;  4PUI A;  4B3S C;  4JI1 C;  2D28 C;  4OYC A;  2YWB A;  1MKY A;  2UXC C;  3JAM D;  5IT9 D;  4X66 C;  1WH9 A;  4GXR A;  1LCI A;  2PT7 G;  2DPL A;  2VQF C;  4IR7 A;  1T5D X;  4RM3 A;  3ETC A;  4DCU A;  3DAY A;  3VNQ A;  2DYJ A;  4JI5 C;  3LNV A;  3CJE A;  1TH5 A;  2ZZM A;  4NXN C;  4LF8 C;  4DR6 C;  2M5H A;  3ETO A;  5T8T A;  1HR0 C;  5BUS A;  3R9W A;  4D4G A;  2WD9 A;  4DCT A;  2PRO A;  5DV9 A;  3B7W A;  4EAT A;  3GR1 A;  5IWA C;  4X64 C;  1PU1 A;  3NYQ A;  4DR7 C;  2E8F A;  3CW9 A;  1M6X A;  4R1M A;  1VEH A;  3L95 X;  2P2M A;  3NPD A;  2OPL A;  2YX1 A;  4JI3 C;  5H9U A;  1XRB A;  4BBY A;  5AE2 A; 
#chains in the Genus database with same CATH homology
 2HJG A;  2OBV A;  3GR0 A;  1N34 C;  2D1T A;  1ZB8 A;  3FCE A;  2KZF A;  2JMP A;  3UZ0 A;  4JYA C;  4DV6 C;  4DUZ C;  2QVX X;  2ASB A;  1HNX C;  2QW0 X;  4D57 A;  2YWC A;  1FUG A;  3CW8 X;  1WF3 A;  1VLA A;  1PG3 A;  5BSV A;  4LF4 C;  4DV1 C;  2Y4N A;  4LF5 C;  4K0B A;  4OX9 C;  2UU9 C;  5T8S A;  5JRH A;  4KHP C;  4XX2 A;  1HH2 P;  4PZP A;  4YY3 C;  1KKG A;  1XMO C;  3J80 D;  2OO4 A;  1O90 A;  4X65 C;  2P2B A;  1XNR C;  2BJO A;  4DV3 C;  4DR3 C;  2D27 A;  1JOS A;  1GPM A;  5LMN C;  3PRO C;  3KXW A;  1ULT A;  1MDF A;  4B3T C;  4LE5 A;  4LFC C;  5GTD A;  4DG8 A;  4DR4 C;  2E8C A;  4DV5 C;  5BUQ A;  4RLF A;  1O93 A;  3T1Y C;  4RVO A;  4DUY C;  2D1R A;  5FLX D;  4IZ6 A;  3SO4 A;  3NI2 A;  3LUS A;  1IBK C;  1HNW C;  3GPC A;  1O92 A;  2CY1 A;  4KTT A;  5A1I A;  4JI6 C;  4ODJ A;  1IBL C;  3IML A;  4NOZ A;  1I94 C;  2V7B A;  4BC9 A;  4WS9 A;  1MD9 A;  3R9X A;  5K85 A;  4DCV A;  1T5H X;  1MXB A;  4DV2 C;  2EGT A;  5BUR A;  1XRC A;  5A2Q D;  5CZV A;  1USP B;  3J81 D;  4HPV A;  3L8C A;  4LFB C;  3AF6 A;  3T1H C;  4G1I A;  3VNS A;  4BCA A;  4JI0 C;  3NYR A;  2QVY X;  1PA4 A;  4LF7 C;  4G37 A;  2VQE C;  1RG9 A;  3EER A;  5BST A;  5BSR A;  1MDB A;  4ISB A;  4ZJZ A;  3E7W A;  5A1G A;  4PRO C;  4I9F A;  1UKK A;  4WV3 A;  4D4I A;  3I08 A;  4AQY C;  2P2F A;  1HNZ C;  4LF6 C;  2HHH C;  2F4V C;  3PBK A;  1XRA A;  3H2T A;  4U5Y D;  1AMU A;  4B3R C;  3S82 A;  5CZX A;  4DCS A;  3AF5 A;  3IEU A;  4NXM C;  4JI7 C;  3DHV A;  5BR8 C;  3FCC A;  4GXQ A;  3RG2 A;  2P20 A;  4G36 A;  4ZLP A;  2ZM6 C;  4L7I A;  4DR5 C;  3LGX A;  1FJG C;  4I9G A;  3G7S A;  2P2Q A;  4FUQ A;  4RM2 A;  4MH4 A;  5KEI A;  4OXI A;  1K0R A;  2D1S A;  2D7V A;  5LMU C;  1NYE A;  1MXA A;  3TUF A;  4YHH C;  3LAX A;  2Y27 A;  4NDN A;  4RMN A;  5K8F A;  1L2F A;  4JI2 C;  2QVZ X;  4L4Q A;  3UOW A;  3VNR A;  3N2Q A;  2AYA A;  3PES A;  4DV0 C;  4JI8 C;  4JI4 C;  4TPS B;  1USP A;  5BSW A;  1XNQ C;  2ATW A;  4RVN A;  1V25 A;  4L2Z A;  1XMQ C;  5A19 A;  4GS5 A;  5BSM A;  1EGA A;  2BH1 X;  2UXD C;  2VSQ A;  4DV4 C;  2UUC C;  2E8E A;  4D56 A;  4MTN A;  4X62 C;  4B3M C;  3TQI A;  5KYV A;  3I07 A;  1ML8 A;  3A9U A;  1MXC A;  4BSZ A;  4R0M A;  3R44 A;  2UUB C;  1RY2 A;  1N36 C;  4FTF A;  1BA3 A;  3IPL A;  2UXB C;  1IBM C;  3C5E A;  5IFI A;  5KYT A;  1QWI A;  2WP0 C;  4LFA C;  4FUT A;  2E5L C;  4JV5 C;  3OTO C;  4GKJ C;  1N32 C;  3EQ6 A;  4JM1 A;  2VZE A;  2UUA C;  2OPL B;  4RLQ A;  1P7L A;  3RV2 A;  1LQL A;  2QL8 A;  1QM4 A;  3A9V A;  2E7G A;  2Y4O A;  2YCB A;  3IEV A;  3N54 B;  1N2F A;  4GKK C;  5AE1 A;  2D1Q A;  4BC7 A;  2P02 A;  3GKU A;  1O9T A;  2PN2 A;  3DLP X;  5E7Q A;  3TDE A;  1ZB9 A;  5BSU A;  4K0K C;  5AE3 A;  4R1L A;  1PG4 A;  4PHT A;  3A4I A;  4DR1 C;  1N33 C;  4DG9 A;  4KTV A;  2ONF A;  2P2J A;  2XR1 A;  1J5E C;  4LF9 C;  1V26 A;  2E0G A;  3E7X A;  5ADZ A;  2CXC A;  4DR2 C;  4DV7 C;  3J7A D;  1YJ7 A;  4B3S C;  4JI1 C;  2D28 C;  4OYC A;  2YWB A;  1MKY A;  2UXC C;  3JAM D;  5IT9 D;  4X66 C;  1WH9 A;  4GXR A;  1LCI A;  2PT7 G;  2DPL A;  2VQF C;  4IR7 A;  1T5D X;  4RM3 A;  3ETC A;  4DCU A;  3DAY A;  3VNQ A;  2DYJ A;  4JI5 C;  3LNV A;  3CJE A;  4NXN C;  4LF8 C;  4DR6 C;  3ETO A;  5T8T A;  1HR0 C;  5BUS A;  3R9W A;  4D4G A;  2WD9 A;  4DCT A;  2PRO A;  5DV9 A;  3B7W A;  4EAT A;  3GR1 A;  5IWA C;  4X64 C;  3NYQ A;  4DR7 C;  2E8F A;  3CW9 A;  4R1M A;  3L95 X;  2P2M A;  3NPD A;  2OPL A;  4JI3 C;  5H9U A;  1XRB A;  4BBY A;  5AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...