2VQFC

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2vqfC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2vqfC02
2HHHC 4X62C 5LMUC 2OPLB 4LFBC 4DV4C 4LFAC 4JI4C 4X64C 4YHHC 2VQFC 4NOZA 1NYEA 4DV1C 4JI5C 2ONFA 4MTNA 2HJGA 1L2FA 4DV3C 1XNQC 4X65C 2ATWA 3J80D 3AF5A 1I94C 4NXNC 5A2QD 1USPB 2VQEC 2E8CA 2PT7G 3GKUA 4JI0C 4GKJC 1HNWC 1LQLA 4DR4C 1N34C 2UUAC 1WF3A 4DR6C 2BJOA 3R9WA 3OTOC 1XMOC 4MH4A 4DCSA 2QL8A 4JYAC 3AF6A 1ZB8A 1VLAA 3EERA 1HH2P 4B3MC 2DYJA 5BR8C 3LUSA 4DCTA 4DV0C 4JV5C 4LF5C 1WH9A 4DV5C 3I07A 4LF7C 2UXDC 3JAMD 4YY3C 4LF6C 4OX9C 4XX2A 2ZM6C 1HNXC 4DCVA 2EGTA 4LFCC 5FLXD 2XR1A 1N2FA 2JMPA 3T1YC 1N33C 1IBLC 3IEVA 4LF8C 1QWIA 4JI2C 2KZFA 1XNRC 2UXCC 2PN2A 3CJEA 1HNZC 4B3SC 4DR2C 1HR0C 1J5EC 4JI1C 4DR7C 1EGAA 4DV6C 1MKYA 1K0RA 1USPA 1KKGA 4B3RC 4DV7C 1XMQC 2CY1A 3R9XA 3J81D 2E8FA 4LF9C 4JI3C 1ML8A 2UUCC 2OPLA 3J7AD 4B3TC 4DR3C 1UKKA 4BSZA 5IWAC 2YCBA 4NXMC 2E7GA 4K0KC 4DCUA 1ZB9A 4KHPC 5LMNC 2F4VC 4LF4C 2D7VA 1IBMC 3IEUA 4AQYC 1PA4A 3T1HC 2ASBA 4DV2C 4JI8C 2UXBC 2CXCA 4JI7C 1N36C 1JOSA 1IBKC 5IT9D 4DR1C 4DR5C 2E5LC 1N32C 2E8EA 4JI6C 4GKKC 2UUBC 4DUYC 4DUZC 1FJGC 2UU9C 4X66C
chains in the Genus database with same CATH superfamily
4X62C 4FUQA 1XRBA 2NCLA 3SO4A 5AE3A 5A1GA 1VEHA 3GPCA 4YHHC 3H2TA 2V7BA 3A4IA 4NOZA 4DV1C 4FTFA 1IB8A 1L2FA 4X65C 3AF5A 4NXNC 3AY0A 3ETCA 3DLPX 2E8CA 3CW9A 4OYCA 5GTDA 1WF3A 1V25A 1MXBA 1XMOC 1ULTA 2MCQA 4DCSA 2M5HA 4BC7A 5BUQA 1HH2P 3NPDA 3NYQA 5BR8C 4DCTA 2YWBA 4G37A 2YWCA 1WH9A 1FLOA 2Y27A 4DCVA 5KYVA 5K8FA 1N2FA 3PBKA 5KEIA 2WD9A 3CW8X 1QM4A 2P20A 3VNRA 4D57A 4JI1C 3N54B 1XDXA 1MKYA 1XMQC 1UWDA 4I9GA 1TH5A 3VNQA 4D56A 3J7AD 4DR3C 4GXQA 2YCBA 3L8CA 2D7VA 2D1SA 4BC9A 3IEUA 4AQYC 3CQ1A 2AYAA 2PROA 1XHJA 5BSTA 2CXCA 4PUHA 1N36C 5IT9D 3LNOA 4GKKC 2PG1E 3DAYA 2HHHC 5LMUC 3TUFA 4LFAC 5IFIA 1RG9A 4X64C 4JI5C 2ONFA 4G36A 2HJGA 4DV3C 1XNQC 2YX1A 2ATWA 1AMUA 3J80D 1I94C 2M5OA 4PZPA 1T5DX 1HNWC 1LQLA 3R9WA 4IR7A 1RY2A 2QL8A 4JYAC 3LAXA 3S82A 2DYJA 2DHMA 5A19A 2KZ0A 3A9VA 1MDBA 4DV0C 4JV5C 3I07A 3JAMD 2D28C 1P4EA 4KTVA 1XS3A 1MDFA 2QW0X 2ZZNA 3T1YC 2ZTBA 1IBLC 2D1TA 3IEVA 2D27A 1QWIA 1O92A 3NI2A 2KZFA 3B7WA 2UXCC 3GR1A 1HR0C 4DR7C 2OBVA 3L95X 4B3RC 2CY1A 5ADZA 1ML8A 1PG3A 4R1MA 4DG9A 1P4EC 1UKKA 3G7SA 3A9UA 1ZB9A 5LMNC 2DPLA 1NY8A 1IBMC 5BUSA 3LNVA 5AE1A 3T1HC 2QVXX 3FCCA 1T5HX 4WS9A 4GS5A 4DUYC 3FM7A 1FUGA 4L7IA 4FUTA 4PUGA 2OPLB 4LFBC 3TDEA 3RG2A 1MD9A 4DG8A 1LCIA 4BBYA 1YJ7A 4MTNA 4L2ZA 1P7LA 2Y4OA 1MXAA 4KTTA 3DHVA 4GXRA 1USPB 3FCEA 2VZEA 2PT7G 4GKJC 2UUAC 4DR6C 2OO4A 3OTOC 4MH4A 2CU6A 3EERA 3TR3A 4EATA 3LUSA 5BSRA 3KXWA 2WP0C 3I08A 4BCAA 3LGXA 3R44A 3TQIA 2UXDC 5JRHA 4ISBA 4OX9C 1HNXC 3A25A 4PUIA 1XRCA 3K6RA 5FLXD 2JMPA 3E7XA 4RM3A 1N33C 4LF8C 4JI2C 2P02A 1XNRC 2PN2A 3CJEA 4B3SC 2P2FA 2JNVA 3C5EA 1EGAA 5A1IA 4HPVA 5BSWA 4DV6C 4RVNA 1USPA 1KKGA 5CZVA 3R9XA 4LF9C 2Z51A 5IWAC 5H9UA 4LE5A 1YGTA 3EQ6A 4KHPC 4DCUA 5K85A 2F4VC 4LF4C 5E7QA 4RVOA 3CQ2A 2P2BA 1PA4A 4ZJZA 4I9FA 1O93A 4DV2C 4D4IA 3IPLA 2UXBC 2D1RA 4JI7C 1IBKC 2D1QA 4DR1C 1N32C 3PESA 4RM2A 3RV2A 3GR0A 4G1IA 5DV9A 4DUZC 3UEBA 2VQEC 4JM1A 3CQ3A 2BH1X 4DV4C 4JI4C 3NYRA 1O90A 2VQFC 1NYEA 1V26A 4NDNA 3UX2A 5KYTA 2P2JA 5A2QD 5LCIA 3GKUA 4JI0C 1O9TA 4DR4C 1N34C 4OXIA 1WCJA 4R1LA 2QVYX 2BJOA 1PU1A 1PG4A 3AF6A 4R0MA 1ZB8A 1VLAA 4B3MC 2ZZMA 2MM9A 4LF5C 2P2QA 4DV5C 3A26A 4LF7C 1BA3A 4YY3C 4LF6C 5BSUA 4RLQA 4XX2A 2ZM6C 4RLFA 5BSVA 2EGTA 5BSMA 4LFCC 2XR1A 5BURA 3O2EA 1M6XA 4WV3A 4U5YD 2MMAB 1V60A 1HNZC 2P2MA 3N2QA 4DR2C 5T8SA 1J5EC 1K0RA 4PHTA 4TPSB 1XRAA 4DV7C 4ZLPA 3J81D 2E8FA 2KDNA 3UX3A 4JI3C 4ODJA 2UUCC 2OPLA 4B3TC 3UOWA 3PROC 4BSZA 2Y4NA 4IZ6A 4NXMC 2E7GA 4K0BA 4PROC 1M6XC 4K0KC 4RMNA 2QVZX 3IMLA 5AE2A 2VSQA 3UZ0A 3ETOA 2ASBA 4JI8C 3E7WA 1GPMA 1JOSA 3VNSA 4DR5C 2E5LC 4L4QA 2E8EA 4JI6C 2UUBC 5CZXA 4D4GA 1MXCA 2E0GA 5T8TA 1FJGC 2UU9C 4X66C
chains in the Genus database with same CATH topology
4X62C 4FUQA 1XRBA 3SO4A 5AE3A 5A1GA 3GPCA 4YHHC 3H2TA 2V7BA 3A4IA 4NOZA 4DV1C 4FTFA 1L2FA 4X65C 3AF5A 4NXNC 3ETCA 3DLPX 2E8CA 3CW9A 4OYCA 5GTDA 1WF3A 1V25A 1MXBA 1XMOC 1ULTA 4DCSA 4BC7A 5BUQA 1HH2P 3NPDA 3NYQA 5BR8C 4DCTA 2YWBA 4G37A 2YWCA 1WH9A 2Y27A 4DCVA 5KYVA 5K8FA 1N2FA 3PBKA 5KEIA 2WD9A 3CW8X 1QM4A 2P20A 3VNRA 4D57A 4JI1C 3N54B 1MKYA 1XMQC 4I9GA 3VNQA 4D56A 3J7AD 4DR3C 4GXQA 2YCBA 3L8CA 2D7VA 2D1SA 4BC9A 3IEUA 4AQYC 2AYAA 2PROA 5BSTA 2CXCA 1N36C 5IT9D 4GKKC 3DAYA 2HHHC 5LMUC 3TUFA 4LFAC 5IFIA 1RG9A 4X64C 4JI5C 2ONFA 4G36A 2HJGA 4DV3C 1XNQC 2ATWA 1AMUA 3J80D 1I94C 4PZPA 1T5DX 1HNWC 1LQLA 3R9WA 4IR7A 1RY2A 2QL8A 4JYAC 3LAXA 3S82A 2DYJA 5A19A 4DV0C 3A9VA 1MDBA 4JV5C 3I07A 3JAMD 2D28C 4KTVA 1MDFA 2QW0X 3T1YC 1IBLC 2D1TA 3IEVA 2D27A 1QWIA 1O92A 3NI2A 2KZFA 3B7WA 2UXCC 3GR1A 1HR0C 4DR7C 2OBVA 3L95X 4B3RC 2CY1A 5ADZA 1ML8A 1PG3A 4R1MA 4DG9A 1UKKA 3G7SA 3A9UA 1ZB9A 5LMNC 2DPLA 1IBMC 5BUSA 3LNVA 5AE1A 3T1HC 2QVXX 3FCCA 1T5HX 4WS9A 4GS5A 4DUYC 1FUGA 4L7IA 4FUTA 2OPLB 4LFBC 3TDEA 3RG2A 1MD9A 4DG8A 1LCIA 4BBYA 1YJ7A 4MTNA 4L2ZA 1P7LA 2Y4OA 1MXAA 4KTTA 3DHVA 4GXRA 1USPB 3FCEA 2VZEA 2PT7G 4GKJC 2UUAC 4DR6C 2OO4A 3OTOC 4MH4A 3EERA 4EATA 3LUSA 5BSRA 3KXWA 2WP0C 3I08A 4BCAA 3LGXA 3R44A 3TQIA 2UXDC 5JRHA 4ISBA 4OX9C 1HNXC 1XRCA 5FLXD 2JMPA 3E7XA 4RM3A 1N33C 4LF8C 4JI2C 2P02A 1XNRC 2PN2A 3CJEA 4B3SC 2P2FA 3C5EA 1EGAA 5A1IA 4HPVA 5BSWA 4DV6C 4RVNA 1USPA 1KKGA 5CZVA 3R9XA 4LF9C 5IWAC 5H9UA 4LE5A 3EQ6A 4KHPC 4DCUA 5K85A 2F4VC 4LF4C 5E7QA 4RVOA 2P2BA 1PA4A 4ZJZA 4I9FA 1O93A 4DV2C 4D4IA 3IPLA 2UXBC 2D1RA 4JI7C 1IBKC 2D1QA 4DR1C 1N32C 3PESA 4RM2A 3RV2A 3GR0A 4G1IA 5DV9A 4DUZC 2VQEC 4JM1A 2BH1X 4DV4C 4JI4C 3NYRA 1O90A 2VQFC 1NYEA 1V26A 4NDNA 5KYTA 2P2JA 5A2QD 3GKUA 4JI0C 1O9TA 4DR4C 1N34C 4OXIA 4R1LA 2QVYX 2BJOA 1PG4A 3AF6A 4R0MA 1ZB8A 1VLAA 4B3MC 4LF5C 2P2QA 4DV5C 4LF7C 1BA3A 4YY3C 4LF6C 5BSUA 4RLQA 4XX2A 2ZM6C 4RLFA 5BSVA 2EGTA 5BSMA 4LFCC 2XR1A 5BURA 4WV3A 4U5YD 1HNZC 2P2MA 3N2QA 4DR2C 5T8SA 1J5EC 1K0RA 4PHTA 4TPSB 1XRAA 4DV7C 4ZLPA 3J81D 2E8FA 4JI3C 4ODJA 2UUCC 2OPLA 4B3TC 3UOWA 3PROC 4BSZA 2Y4NA 4IZ6A 4NXMC 2E7GA 4K0BA 4PROC 4K0KC 4RMNA 2QVZX 3IMLA 5AE2A 2VSQA 3UZ0A 3ETOA 2ASBA 4JI8C 3E7WA 1GPMA 1JOSA 3VNSA 4DR5C 2E5LC 4L4QA 2E8EA 4JI6C 2UUBC 5CZXA 4D4GA 1MXCA 2E0GA 5T8TA 1FJGC 2UU9C 4X66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH C;  4X62 C;  5LMU C;  2OPL B;  4LFB C;  4DV4 C;  4LFA C;  4JI4 C;  4X64 C;  4YHH C;  2VQF C;  4NOZ A;  1NYE A;  4DV1 C;  4JI5 C;  2ONF A;  4MTN A;  2HJG A;  1L2F A;  4DV3 C;  1XNQ C;  4X65 C;  2ATW A;  3J80 D;  3AF5 A;  1I94 C;  4NXN C;  5A2Q D;  1USP B;  2VQE C;  2E8C A;  2PT7 G;  3GKU A;  4JI0 C;  4GKJ C;  1HNW C;  1LQL A;  4DR4 C;  1N34 C;  2UUA C;  1WF3 A;  4DR6 C;  2BJO A;  3R9W A;  3OTO C;  1XMO C;  4MH4 A;  4DCS A;  2QL8 A;  4JYA C;  3AF6 A;  1ZB8 A;  1VLA A;  3EER A;  1HH2 P;  4B3M C;  2DYJ A;  5BR8 C;  3LUS A;  4DCT A;  4DV0 C;  4JV5 C;  4LF5 C;  1WH9 A;  4DV5 C;  3I07 A;  4LF7 C;  2UXD C;  3JAM D;  4YY3 C;  4LF6 C;  4OX9 C;  4XX2 A;  2ZM6 C;  1HNX C;  4DCV A;  2EGT A;  4LFC C;  5FLX D;  2XR1 A;  1N2F A;  2JMP A;  3T1Y C;  1N33 C;  1IBL C;  3IEV A;  4LF8 C;  1QWI A;  4JI2 C;  2KZF A;  1XNR C;  2UXC C;  2PN2 A;  3CJE A;  1HNZ C;  4B3S C;  4DR2 C;  1HR0 C;  1J5E C;  4JI1 C;  4DR7 C;  1EGA A;  4DV6 C;  1MKY A;  1K0R A;  1USP A;  1KKG A;  4B3R C;  4DV7 C;  1XMQ C;  2CY1 A;  3R9X A;  3J81 D;  2E8F A;  4LF9 C;  4JI3 C;  1ML8 A;  2UUC C;  2OPL A;  3J7A D;  4B3T C;  4DR3 C;  1UKK A;  4BSZ A;  5IWA C;  2YCB A;  4NXM C;  2E7G A;  4K0K C;  4DCU A;  1ZB9 A;  4KHP C;  5LMN C;  2F4V C;  4LF4 C;  2D7V A;  1IBM C;  3IEU A;  4AQY C;  1PA4 A;  3T1H C;  2ASB A;  4DV2 C;  4JI8 C;  2UXB C;  2CXC A;  4JI7 C;  1N36 C;  1JOS A;  1IBK C;  5IT9 D;  4DR1 C;  4DR5 C;  2E5L C;  1N32 C;  2E8E A;  4JI6 C;  4GKK C;  2UUB C;  4DUY C;  4DUZ C;  1FJG C;  2UU9 C;  4X66 C; 
#chains in the Genus database with same CATH topology
 4X62 C;  4FUQ A;  1XRB A;  2NCL A;  3SO4 A;  5AE3 A;  5A1G A;  1VEH A;  3GPC A;  4YHH C;  3H2T A;  2V7B A;  3A4I A;  4NOZ A;  4DV1 C;  4FTF A;  1IB8 A;  1L2F A;  4X65 C;  3AF5 A;  4NXN C;  3AY0 A;  3ETC A;  3DLP X;  2E8C A;  3CW9 A;  4OYC A;  5GTD A;  1WF3 A;  1V25 A;  1MXB A;  1XMO C;  1ULT A;  2MCQ A;  4DCS A;  2M5H A;  4BC7 A;  5BUQ A;  1HH2 P;  3NPD A;  3NYQ A;  5BR8 C;  4DCT A;  2YWB A;  4G37 A;  2YWC A;  1WH9 A;  1FLO A;  2Y27 A;  4DCV A;  5KYV A;  5K8F A;  1N2F A;  3PBK A;  5KEI A;  2WD9 A;  3CW8 X;  1QM4 A;  2P20 A;  3VNR A;  4D57 A;  4JI1 C;  3N54 B;  1XDX A;  1MKY A;  1XMQ C;  1UWD A;  4I9G A;  1TH5 A;  3VNQ A;  4D56 A;  3J7A D;  4DR3 C;  4GXQ A;  2YCB A;  3L8C A;  2D7V A;  2D1S A;  4BC9 A;  3IEU A;  4AQY C;  3CQ1 A;  2AYA A;  2PRO A;  1XHJ A;  5BST A;  2CXC A;  4PUH A;  1N36 C;  5IT9 D;  3LNO A;  4GKK C;  2PG1 E;  3DAY A;  2HHH C;  5LMU C;  3TUF A;  4LFA C;  5IFI A;  1RG9 A;  4X64 C;  4JI5 C;  2ONF A;  4G36 A;  2HJG A;  4DV3 C;  1XNQ C;  2YX1 A;  2ATW A;  1AMU A;  3J80 D;  1I94 C;  2M5O A;  4PZP A;  1T5D X;  1HNW C;  1LQL A;  3R9W A;  4IR7 A;  1RY2 A;  2QL8 A;  4JYA C;  3LAX A;  3S82 A;  2DYJ A;  2DHM A;  5A19 A;  2KZ0 A;  3A9V A;  1MDB A;  4DV0 C;  4JV5 C;  3I07 A;  3JAM D;  2D28 C;  1P4E A;  4KTV A;  1XS3 A;  1MDF A;  2QW0 X;  2ZZN A;  3T1Y C;  2ZTB A;  1IBL C;  2D1T A;  3IEV A;  2D27 A;  1QWI A;  1O92 A;  3NI2 A;  2KZF A;  3B7W A;  2UXC C;  3GR1 A;  1HR0 C;  4DR7 C;  2OBV A;  3L95 X;  4B3R C;  2CY1 A;  5ADZ A;  1ML8 A;  1PG3 A;  4R1M A;  4DG9 A;  1P4E C;  1UKK A;  3G7S A;  3A9U A;  1ZB9 A;  5LMN C;  2DPL A;  1NY8 A;  1IBM C;  5BUS A;  3LNV A;  5AE1 A;  3T1H C;  2QVX X;  3FCC A;  1T5H X;  4WS9 A;  4GS5 A;  4DUY C;  3FM7 A;  1FUG A;  4L7I A;  4FUT A;  4PUG A;  2OPL B;  4LFB C;  3TDE A;  3RG2 A;  1MD9 A;  4DG8 A;  1LCI A;  4BBY A;  1YJ7 A;  4MTN A;  4L2Z A;  1P7L A;  2Y4O A;  1MXA A;  4KTT A;  3DHV A;  4GXR A;  1USP B;  3FCE A;  2VZE A;  2PT7 G;  4GKJ C;  2UUA C;  4DR6 C;  2OO4 A;  3OTO C;  4MH4 A;  2CU6 A;  3EER A;  3TR3 A;  4EAT A;  3LUS A;  5BSR A;  3KXW A;  2WP0 C;  3I08 A;  4BCA A;  3LGX A;  3R44 A;  3TQI A;  2UXD C;  5JRH A;  4ISB A;  4OX9 C;  1HNX C;  3A25 A;  4PUI A;  1XRC A;  3K6R A;  5FLX D;  2JMP A;  3E7X A;  4RM3 A;  1N33 C;  4LF8 C;  4JI2 C;  2P02 A;  1XNR C;  2PN2 A;  3CJE A;  4B3S C;  2P2F A;  2JNV A;  3C5E A;  1EGA A;  5A1I A;  4HPV A;  5BSW A;  4DV6 C;  4RVN A;  1USP A;  1KKG A;  5CZV A;  3R9X A;  4LF9 C;  2Z51 A;  5IWA C;  5H9U A;  4LE5 A;  1YGT A;  3EQ6 A;  4KHP C;  4DCU A;  5K85 A;  2F4V C;  4LF4 C;  5E7Q A;  4RVO A;  3CQ2 A;  2P2B A;  1PA4 A;  4ZJZ A;  4I9F A;  1O93 A;  4DV2 C;  4D4I A;  3IPL A;  2UXB C;  2D1R A;  4JI7 C;  1IBK C;  2D1Q A;  4DR1 C;  1N32 C;  3PES A;  4RM2 A;  3RV2 A;  3GR0 A;  4G1I A;  5DV9 A;  4DUZ C;  3UEB A;  2VQE C;  4JM1 A;  3CQ3 A;  2BH1 X;  4DV4 C;  4JI4 C;  3NYR A;  1O90 A;  2VQF C;  1NYE A;  1V26 A;  4NDN A;  3UX2 A;  5KYT A;  2P2J A;  5A2Q D;  5LCI A;  3GKU A;  4JI0 C;  1O9T A;  4DR4 C;  1N34 C;  4OXI A;  1WCJ A;  4R1L A;  2QVY X;  2BJO A;  1PU1 A;  1PG4 A;  3AF6 A;  4R0M A;  1ZB8 A;  1VLA A;  4B3M C;  2ZZM A;  2MM9 A;  4LF5 C;  2P2Q A;  4DV5 C;  3A26 A;  4LF7 C;  1BA3 A;  4YY3 C;  4LF6 C;  5BSU A;  4RLQ A;  4XX2 A;  2ZM6 C;  4RLF A;  5BSV A;  2EGT A;  5BSM A;  4LFC C;  2XR1 A;  5BUR A;  3O2E A;  1M6X A;  4WV3 A;  4U5Y D;  2MMA B;  1V60 A;  1HNZ C;  2P2M A;  3N2Q A;  4DR2 C;  5T8S A;  1J5E C;  1K0R A;  4PHT A;  4TPS B;  1XRA A;  4DV7 C;  4ZLP A;  3J81 D;  2E8F A;  2KDN A;  3UX3 A;  4JI3 C;  4ODJ A;  2UUC C;  2OPL A;  4B3T C;  3UOW A;  3PRO C;  4BSZ A;  2Y4N A;  4IZ6 A;  4NXM C;  2E7G A;  4K0B A;  4PRO C;  1M6X C;  4K0K C;  4RMN A;  2QVZ X;  3IML A;  5AE2 A;  2VSQ A;  3UZ0 A;  3ETO A;  2ASB A;  4JI8 C;  3E7W A;  1GPM A;  1JOS A;  3VNS A;  4DR5 C;  2E5L C;  4L4Q A;  2E8E A;  4JI6 C;  2UUB C;  5CZX A;  4D4G A;  1MXC A;  2E0G A;  5T8T A;  1FJG C;  2UU9 C;  4X66 C; 
#chains in the Genus database with same CATH homology
 4X62 C;  4FUQ A;  1XRB A;  3SO4 A;  5AE3 A;  5A1G A;  3GPC A;  4YHH C;  3H2T A;  2V7B A;  3A4I A;  4NOZ A;  4DV1 C;  4FTF A;  1L2F A;  4X65 C;  3AF5 A;  4NXN C;  3ETC A;  3DLP X;  2E8C A;  3CW9 A;  4OYC A;  5GTD A;  1WF3 A;  1V25 A;  1MXB A;  1XMO C;  1ULT A;  4DCS A;  4BC7 A;  5BUQ A;  1HH2 P;  3NPD A;  3NYQ A;  5BR8 C;  4DCT A;  2YWB A;  4G37 A;  2YWC A;  1WH9 A;  2Y27 A;  4DCV A;  5KYV A;  5K8F A;  1N2F A;  3PBK A;  5KEI A;  2WD9 A;  3CW8 X;  1QM4 A;  2P20 A;  3VNR A;  4D57 A;  4JI1 C;  3N54 B;  1MKY A;  1XMQ C;  4I9G A;  3VNQ A;  4D56 A;  3J7A D;  4DR3 C;  4GXQ A;  2YCB A;  3L8C A;  2D7V A;  2D1S A;  4BC9 A;  3IEU A;  4AQY C;  2AYA A;  2PRO A;  5BST A;  2CXC A;  1N36 C;  5IT9 D;  4GKK C;  3DAY A;  2HHH C;  5LMU C;  3TUF A;  4LFA C;  5IFI A;  1RG9 A;  4X64 C;  4JI5 C;  2ONF A;  4G36 A;  2HJG A;  4DV3 C;  1XNQ C;  2ATW A;  1AMU A;  3J80 D;  1I94 C;  4PZP A;  1T5D X;  1HNW C;  1LQL A;  3R9W A;  4IR7 A;  1RY2 A;  2QL8 A;  4JYA C;  3LAX A;  3S82 A;  2DYJ A;  5A19 A;  4DV0 C;  3A9V A;  1MDB A;  4JV5 C;  3I07 A;  3JAM D;  2D28 C;  4KTV A;  1MDF A;  2QW0 X;  3T1Y C;  1IBL C;  2D1T A;  3IEV A;  2D27 A;  1QWI A;  1O92 A;  3NI2 A;  2KZF A;  3B7W A;  2UXC C;  3GR1 A;  1HR0 C;  4DR7 C;  2OBV A;  3L95 X;  4B3R C;  2CY1 A;  5ADZ A;  1ML8 A;  1PG3 A;  4R1M A;  4DG9 A;  1UKK A;  3G7S A;  3A9U A;  1ZB9 A;  5LMN C;  2DPL A;  1IBM C;  5BUS A;  3LNV A;  5AE1 A;  3T1H C;  2QVX X;  3FCC A;  1T5H X;  4WS9 A;  4GS5 A;  4DUY C;  1FUG A;  4L7I A;  4FUT A;  2OPL B;  4LFB C;  3TDE A;  3RG2 A;  1MD9 A;  4DG8 A;  1LCI A;  4BBY A;  1YJ7 A;  4MTN A;  4L2Z A;  1P7L A;  2Y4O A;  1MXA A;  4KTT A;  3DHV A;  4GXR A;  1USP B;  3FCE A;  2VZE A;  2PT7 G;  4GKJ C;  2UUA C;  4DR6 C;  2OO4 A;  3OTO C;  4MH4 A;  3EER A;  4EAT A;  3LUS A;  5BSR A;  3KXW A;  2WP0 C;  3I08 A;  4BCA A;  3LGX A;  3R44 A;  3TQI A;  2UXD C;  5JRH A;  4ISB A;  4OX9 C;  1HNX C;  1XRC A;  5FLX D;  2JMP A;  3E7X A;  4RM3 A;  1N33 C;  4LF8 C;  4JI2 C;  2P02 A;  1XNR C;  2PN2 A;  3CJE A;  4B3S C;  2P2F A;  3C5E A;  1EGA A;  5A1I A;  4HPV A;  5BSW A;  4DV6 C;  4RVN A;  1USP A;  1KKG A;  5CZV A;  3R9X A;  4LF9 C;  5IWA C;  5H9U A;  4LE5 A;  3EQ6 A;  4KHP C;  4DCU A;  5K85 A;  2F4V C;  4LF4 C;  5E7Q A;  4RVO A;  2P2B A;  1PA4 A;  4ZJZ A;  4I9F A;  1O93 A;  4DV2 C;  4D4I A;  3IPL A;  2UXB C;  2D1R A;  4JI7 C;  1IBK C;  2D1Q A;  4DR1 C;  1N32 C;  3PES A;  4RM2 A;  3RV2 A;  3GR0 A;  4G1I A;  5DV9 A;  4DUZ C;  2VQE C;  4JM1 A;  2BH1 X;  4DV4 C;  4JI4 C;  3NYR A;  1O90 A;  2VQF C;  1NYE A;  1V26 A;  4NDN A;  5KYT A;  2P2J A;  5A2Q D;  3GKU A;  4JI0 C;  1O9T A;  4DR4 C;  1N34 C;  4OXI A;  4R1L A;  2QVY X;  2BJO A;  1PG4 A;  3AF6 A;  4R0M A;  1ZB8 A;  1VLA A;  4B3M C;  4LF5 C;  2P2Q A;  4DV5 C;  4LF7 C;  1BA3 A;  4YY3 C;  4LF6 C;  5BSU A;  4RLQ A;  4XX2 A;  2ZM6 C;  4RLF A;  5BSV A;  2EGT A;  5BSM A;  4LFC C;  2XR1 A;  5BUR A;  4WV3 A;  4U5Y D;  1HNZ C;  2P2M A;  3N2Q A;  4DR2 C;  5T8S A;  1J5E C;  1K0R A;  4PHT A;  4TPS B;  1XRA A;  4DV7 C;  4ZLP A;  3J81 D;  2E8F A;  4JI3 C;  4ODJ A;  2UUC C;  2OPL A;  4B3T C;  3UOW A;  3PRO C;  4BSZ A;  2Y4N A;  4IZ6 A;  4NXM C;  2E7G A;  4K0B A;  4PRO C;  4K0K C;  4RMN A;  2QVZ X;  3IML A;  5AE2 A;  2VSQ A;  3UZ0 A;  3ETO A;  2ASB A;  4JI8 C;  3E7W A;  1GPM A;  1JOS A;  3VNS A;  4DR5 C;  2E5L C;  4L4Q A;  2E8E A;  4JI6 C;  2UUB C;  5CZX A;  4D4G A;  1MXC A;  2E0G A;  5T8T A;  1FJG C;  2UU9 C;  4X66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...