2VQFC

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2vqfC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2vqfC02
2PN2A 4KHPC 4DV0C 1HH2P 1N36C 4DR6C 4LFCC 4NOZA 2E8EA 4GKKC 5BR8C 4OX9C 4NXNC 4DV1C 1USPA 1XMOC 4DR4C 2CY1A 1N33C 5FLXD 4X64C 2ATWA 1WH9A 1N2FA 1HR0C 4DV3C 4BSZA 3R9WA 2F4VC 5A2QD 3T1HC 2UUAC 4JI6C 4JI8C 4DCTA 4MH4A 2EGTA 1XMQC 4JI7C 2VQFC 5LMUC 4JV5C 4LF4C 1LQLA 2BJOA 3EERA 2HHHC 2DYJA 1K0RA 3J80D 4JI2C 3IEVA 4LF6C 1N34C 2PT7G 2YCBA 1IBMC 4LF8C 2E8FA 2XR1A 4DUZC 2UUBC 2UU9C 4MTNA 2E5LC 4DCVA 4LF7C 4YY3C 1NYEA 5LMNC 4X62C 3R9XA 4LFBC 1UKKA 2UXDC 1XNQC 2UUCC 4YHHC 4DCUA 1VLAA 1HNZC 3OTOC 1ZB8A 2OPLB 4DV5C 1ZB9A 4B3TC 4JI3C 1EGAA 1HNWC 1L2FA 1IBKC 1WF3A 2ONFA 4DV6C 4JYAC 4B3SC 4AQYC 5IT9D 3T1YC 4X65C 2ASBA 1QWIA 1HNXC 2E8CA 4DUYC 4DR2C 2VQEC 1MKYA 4B3RC 3J7AD 4JI0C 1FJGC 4DR5C 4XX2A 2KZFA 3CJEA 3IEUA 4NXMC 1JOSA 4JI4C 1USPB 5IWAC 4B3MC 4GKJC 3AF6A 3LUSA 4JI1C 1IBLC 3AF5A 4X66C 4LF5C 2HJGA 2D7VA 1ML8A 1PA4A 3I07A 4DV2C 4DR1C 2E7GA 4LF9C 3J81D 2OPLA 2QL8A 1J5EC 4LFAC 2UXCC 3JAMD 4DR3C 1I94C 4DR7C 2JMPA 4JI5C 4K0KC 2CXCA 4DCSA 1N32C 2ZM6C 3GKUA 1XNRC 4DV7C 2UXBC 1KKGA 4DV4C
chains in the Genus database with same CATH superfamily
3DAYA 4DV0C 2JNVA 4U5YD 5A1GA 5KEIA 3B7WA 4DR6C 4LFCC 1WCJA 3I08A 3TQIA 1XMOC 3NPDA 2CY1A 5K8FA 1N33C 5FLXD 3O2EA 1N2FA 4DV3C 4BSZA 2YWBA 1T5DX 4RLFA 2F4VC 4BC9A 4MH4A 1YGTA 2KDNA 1O92A 4DG8A 4JV5C 3N2QA 3L8CA 1FLOA 1LQLA 3H2TA 3K6RA 4DG9A 3C5EA 1XHJA 2D28C 3PESA 1NYEA 3UZ0A 4LFBC 1XNQC 1IB8A 3A25A 2D27A 3FCCA 4D57A 4EATA 4DCUA 1ZB8A 1LCIA 4JI3C 3IPLA 3L95X 1WF3A 2ONFA 4JYAC 4B3SC 3LGXA 5BUQA 4AQYC 4HPVA 3T1YC 3TUFA 2ASBA 4DR2C 1XS3A 4JM1A 2Z51A 5H9UA 4DR5C 3CJEA 5IFIA 4NXMC 4RM3A 4JI4C 3A26A 5IWAC 2P2FA 3LNVA 3AF6A 5A1IA 4TPSB 4L4QA 4G37A 4RVOA 1V25A 1MDBA 3G7SA 3I07A 3VNSA 4PROC 5GTDA 5AE2A 2QL8A 3KXWA 1O9TA 4D4IA 2UXCC 1I94C 2JMPA 5JRHA 4JI5C 2MM9A 4DCSA 1XNRC 3GKUA 4DV7C 2UXBC 1MXAA 5BSRA 4KHPC 1HH2P 3A4IA 2AYAA 2P02A 4NOZA 4OX9C 3TR3A 1MXCA 1PU1A 3E7XA 1XRAA 5DV9A 3PBKA 2ZZMA 2QVYX 2ATWA 4PUGA 4FTFA 2OO4A 1PG4A 4G1IA 4PZPA 5A2QD 3T1HC 2D1SA 2UUAC 4JI8C 4DCTA 3UEBA 1XRBA 4R1LA 2MCQA 2NCLA 4IZ6A 2HHHC 3NYRA 1K0RA 4WS9A 3J80D 4JI2C 5CZXA 4LF6C 5ADZA 2PT7G 4OYCA 2UU9C 4DCVA 5BSUA 3S82A 5LMNC 3R9XA 5E7QA 2UXDC 2QVXX 2UUCC 1AMUA 4KTVA 4YHHC 1VLAA 3SO4A 4DV5C 1ZB9A 3GR0A 4B3TC 1HNWC 3VNQA 1IBKC 4FUQA 4DV6C 5AE3A 4I9FA 2P2BA 1RY2A 2CU6A 3DLPX 4WV3A 4DUYC 3FCEA 4B3RC 4KTTA 2ZTBA 4XX2A 3IEUA 1JOSA 1MDFA 4B3MC 4ISBA 2P20A 4BCAA 3LUSA 1GPMA 2YWCA 3AF5A 2E0GA 1RG9A 4X66C 4DV2C 4OXIA 4K0BA 3J81D 4LFAC 1NY8A 4DR7C 2D1TA 4RM2A 4R0MA 3CQ3A 1N36C 4ZLPA 2DPLA 2WP0C 4D56A 2E8EA 4GKKC 3RG2A 4NXNC 4DV1C 1XDXA 2P2MA 2QVZX 4RMNA 2EGTA 1XMQC 1MXBA 4JI7C 2VQFC 5LMUC 1P7LA 2BJOA 3NI2A 2DYJA 3IEVA 4RVNA 3FM7A 4ZJZA 1FUGA 1IBMC 2Y4OA 4LF8C 2E8FA 1BA3A 4DUZC 4YY3C 5BSTA 2OBVA 2MMAB 1UKKA 3CQ2A 3E7WA 5BSMA 4IR7A 2OPLB 4L7IA 5BSVA 5T8TA 5BUSA 1EGAA 3IMLA 3CQ1A 1MD9A 2V7BA 5IT9D 4GXQA 4X65C 1QWIA 1HNXC 4FUTA 2D1RA 4GXRA 1MKYA 1O90A 2VQEC 1T5HX 3J7AD 4JI0C 3UX2A 2BH1X 2YX1A 1USPB 4JI1C 4LF5C 2D7VA 1ML8A 1PA4A 3EQ6A 2M5OA 1M6XC 2E7GA 5BURA 2Y27A 1M6XA 2OPLA 3RV2A 1J5EC 1UWDA 3GR1A 3JAMD 4G36A 4DR3C 4I9GA 4K0KC 3GPCA 3NYQA 3ETCA 3N54B 2P2JA 3CW9A 1XRCA 1KKGA 2PN2A 4PHTA 3VNRA 3CW8X 3AY0A 2D1QA 5AE1A 1O93A 5BR8C 1USPA 2WD9A 4DR4C 5A19A 4X64C 1WH9A 1HR0C 2QW0X 3R9WA 4PUHA 4BC7A 5K85A 4JI6C 3A9VA 4LF4C 3EERA 4LE5A 2VZEA 4NDNA 1N34C 1TH5A 2YCBA 2XR1A 2DHMA 2UUBC 4MTNA 2E5LC 4LF7C 4X62C 5KYVA 4GS5A 3UX3A 2PG1E 1HNZC 3OTOC 2M5HA 4ODJA 1YJ7A 2VSQA 1L2FA 4RLQA 1V60A 3LAXA 3PROC 4R1MA 3TDEA 1P4EC 2E8CA 4BBYA 1V26A 1P4EA 4PUIA 5CZVA 2ZZNA 3UOWA 1FJGC 2KZFA 2P2QA 4GKJC 1ULTA 4L2ZA 1IBLC 2HJGA 3A9UA 5KYTA 1PG3A 1QM4A 4DR1C 4D4GA 2PROA 5LCIA 3ETOA 4LF9C 3DHVA 3LNOA 5T8SA 2KZ0A 3R44A 2CXCA 1N32C 1VEHA 5BSWA 2ZM6C 2Y4NA 4DV4C
chains in the Genus database with same CATH topology
3DAYA 4DV0C 4U5YD 5A1GA 5KEIA 3B7WA 4DR6C 4LFCC 3I08A 3TQIA 1XMOC 3NPDA 2CY1A 5K8FA 1N33C 5FLXD 1N2FA 4DV3C 4BSZA 2YWBA 1T5DX 4RLFA 2F4VC 4BC9A 4MH4A 1O92A 4DG8A 4JV5C 3N2QA 3L8CA 1LQLA 3H2TA 4DG9A 3C5EA 2D28C 3PESA 1NYEA 3UZ0A 4LFBC 1XNQC 2D27A 3FCCA 4D57A 4EATA 4DCUA 1ZB8A 1LCIA 4JI3C 3IPLA 3L95X 1WF3A 2ONFA 4JYAC 4B3SC 3LGXA 5BUQA 4AQYC 4HPVA 3T1YC 3TUFA 2ASBA 4DR2C 4JM1A 5H9UA 4DR5C 3CJEA 4NXMC 4JI4C 4RM3A 5IFIA 5IWAC 2P2FA 3LNVA 3AF6A 5A1IA 4TPSB 4L4QA 4G37A 4RVOA 1V25A 1MDBA 3G7SA 3I07A 3VNSA 4PROC 5GTDA 3KXWA 2QL8A 4D4IA 1O9TA 5AE2A 2UXCC 1I94C 2JMPA 5JRHA 4JI5C 4DCSA 1XNRC 3GKUA 4DV7C 2UXBC 1MXAA 5BSRA 4KHPC 1HH2P 3A4IA 2AYAA 2P02A 4NOZA 4OX9C 1MXCA 3E7XA 1XRAA 5DV9A 3PBKA 2QVYX 2ATWA 4FTFA 2OO4A 1PG4A 4G1IA 4PZPA 5A2QD 3T1HC 2D1SA 2UUAC 4JI8C 4DCTA 1XRBA 4R1LA 4IZ6A 2HHHC 3NYRA 1K0RA 4WS9A 3J80D 4JI2C 5CZXA 4LF6C 5ADZA 2PT7G 4OYCA 2UU9C 4DCVA 5BSUA 3S82A 5LMNC 3R9XA 5E7QA 2UXDC 2QVXX 2UUCC 1AMUA 4KTVA 4YHHC 1VLAA 3SO4A 4DV5C 1ZB9A 3GR0A 4B3TC 1HNWC 3VNQA 1IBKC 4FUQA 4DV6C 5AE3A 4I9FA 2P2BA 1RY2A 3DLPX 4WV3A 4DUYC 3FCEA 4B3RC 4KTTA 4XX2A 3IEUA 1JOSA 1MDFA 4B3MC 4ISBA 2P20A 4BCAA 3LUSA 1GPMA 2YWCA 3AF5A 2E0GA 1RG9A 4X66C 4DV2C 4OXIA 4K0BA 3J81D 4LFAC 4DR7C 2D1TA 4RM2A 4R0MA 1N36C 4ZLPA 2DPLA 2WP0C 4D56A 2E8EA 4GKKC 3RG2A 4NXNC 4DV1C 2P2MA 2QVZX 4RMNA 2EGTA 1XMQC 1MXBA 4JI7C 2VQFC 5LMUC 1P7LA 2BJOA 3NI2A 2DYJA 3IEVA 4RVNA 4ZJZA 1FUGA 1IBMC 2Y4OA 4LF8C 2E8FA 1BA3A 4DUZC 4YY3C 5BSTA 2OBVA 1UKKA 3E7WA 5BSMA 4IR7A 2OPLB 4L7IA 5BSVA 5T8TA 5BUSA 1EGAA 3IMLA 1MD9A 2V7BA 5IT9D 4GXQA 4X65C 1QWIA 1HNXC 4FUTA 2D1RA 4GXRA 1MKYA 1O90A 2VQEC 1T5HX 3J7AD 4JI0C 2BH1X 1USPB 4JI1C 4LF5C 2D7VA 1ML8A 1PA4A 3EQ6A 2E7GA 5BURA 2Y27A 2OPLA 3RV2A 1J5EC 3JAMD 3GR1A 4G36A 4DR3C 4I9GA 4K0KC 3GPCA 3NYQA 3ETCA 3N54B 2P2JA 3CW9A 1XRCA 1KKGA 2PN2A 4PHTA 3VNRA 3CW8X 2D1QA 5AE1A 1O93A 5BR8C 1USPA 2WD9A 4DR4C 5A19A 4X64C 1WH9A 1HR0C 2QW0X 3R9WA 4BC7A 5K85A 4JI6C 3A9VA 4LF4C 3EERA 4LE5A 2VZEA 4NDNA 1N34C 2YCBA 2XR1A 2UUBC 4MTNA 2E5LC 4LF7C 4X62C 5KYVA 4GS5A 1HNZC 3OTOC 4ODJA 1YJ7A 2VSQA 1L2FA 4RLQA 3LAXA 3PROC 4R1MA 3TDEA 2E8CA 4BBYA 1V26A 5CZVA 3UOWA 1FJGC 2KZFA 2P2QA 4GKJC 1ULTA 4L2ZA 1IBLC 2HJGA 3A9UA 5KYTA 1PG3A 1QM4A 4DR1C 4D4GA 2PROA 4LF9C 3ETOA 3DHVA 5T8SA 3R44A 2CXCA 1N32C 5BSWA 2ZM6C 2Y4NA 4DV4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PN2 A;  4KHP C;  4DV0 C;  1HH2 P;  1N36 C;  4DR6 C;  4LFC C;  4NOZ A;  2E8E A;  4GKK C;  5BR8 C;  4OX9 C;  4NXN C;  4DV1 C;  1USP A;  1XMO C;  4DR4 C;  2CY1 A;  1N33 C;  5FLX D;  4X64 C;  2ATW A;  1WH9 A;  1N2F A;  1HR0 C;  4DV3 C;  4BSZ A;  3R9W A;  2F4V C;  5A2Q D;  3T1H C;  2UUA C;  4JI6 C;  4JI8 C;  4DCT A;  4MH4 A;  2EGT A;  1XMQ C;  4JI7 C;  2VQF C;  5LMU C;  4JV5 C;  4LF4 C;  1LQL A;  2BJO A;  3EER A;  2HHH C;  2DYJ A;  1K0R A;  3J80 D;  4JI2 C;  3IEV A;  4LF6 C;  1N34 C;  2PT7 G;  2YCB A;  1IBM C;  4LF8 C;  2E8F A;  2XR1 A;  4DUZ C;  2UUB C;  2UU9 C;  4MTN A;  2E5L C;  4DCV A;  4LF7 C;  4YY3 C;  1NYE A;  5LMN C;  4X62 C;  3R9X A;  4LFB C;  1UKK A;  2UXD C;  1XNQ C;  2UUC C;  4YHH C;  4DCU A;  1VLA A;  1HNZ C;  3OTO C;  1ZB8 A;  2OPL B;  4DV5 C;  1ZB9 A;  4B3T C;  4JI3 C;  1EGA A;  1HNW C;  1L2F A;  1IBK C;  1WF3 A;  2ONF A;  4DV6 C;  4JYA C;  4B3S C;  4AQY C;  5IT9 D;  3T1Y C;  4X65 C;  2ASB A;  1QWI A;  1HNX C;  2E8C A;  4DUY C;  4DR2 C;  2VQE C;  1MKY A;  4B3R C;  3J7A D;  4JI0 C;  1FJG C;  4DR5 C;  4XX2 A;  2KZF A;  3CJE A;  3IEU A;  4NXM C;  1JOS A;  4JI4 C;  1USP B;  5IWA C;  4B3M C;  4GKJ C;  3AF6 A;  3LUS A;  4JI1 C;  1IBL C;  3AF5 A;  4X66 C;  4LF5 C;  2HJG A;  2D7V A;  1ML8 A;  1PA4 A;  3I07 A;  4DV2 C;  4DR1 C;  2E7G A;  4LF9 C;  3J81 D;  2OPL A;  2QL8 A;  1J5E C;  4LFA C;  2UXC C;  3JAM D;  4DR3 C;  1I94 C;  4DR7 C;  2JMP A;  4JI5 C;  4K0K C;  2CXC A;  4DCS A;  1N32 C;  2ZM6 C;  3GKU A;  1XNR C;  4DV7 C;  2UXB C;  1KKG A;  4DV4 C; 
#chains in the Genus database with same CATH topology
 3DAY A;  4DV0 C;  2JNV A;  4U5Y D;  5A1G A;  5KEI A;  3B7W A;  4DR6 C;  4LFC C;  1WCJ A;  3I08 A;  3TQI A;  1XMO C;  3NPD A;  2CY1 A;  5K8F A;  1N33 C;  5FLX D;  3O2E A;  1N2F A;  4DV3 C;  4BSZ A;  2YWB A;  1T5D X;  4RLF A;  2F4V C;  4BC9 A;  4MH4 A;  1YGT A;  2KDN A;  1O92 A;  4DG8 A;  4JV5 C;  3N2Q A;  3L8C A;  1FLO A;  1LQL A;  3H2T A;  3K6R A;  4DG9 A;  3C5E A;  1XHJ A;  2D28 C;  3PES A;  1NYE A;  3UZ0 A;  4LFB C;  1XNQ C;  1IB8 A;  3A25 A;  2D27 A;  3FCC A;  4D57 A;  4EAT A;  4DCU A;  1ZB8 A;  1LCI A;  4JI3 C;  3IPL A;  3L95 X;  1WF3 A;  2ONF A;  4JYA C;  4B3S C;  3LGX A;  5BUQ A;  4AQY C;  4HPV A;  3T1Y C;  3TUF A;  2ASB A;  4DR2 C;  1XS3 A;  4JM1 A;  2Z51 A;  5H9U A;  4DR5 C;  3CJE A;  5IFI A;  4NXM C;  4RM3 A;  4JI4 C;  3A26 A;  5IWA C;  2P2F A;  3LNV A;  3AF6 A;  5A1I A;  4TPS B;  4L4Q A;  4G37 A;  4RVO A;  1V25 A;  1MDB A;  3G7S A;  3I07 A;  3VNS A;  4PRO C;  5GTD A;  5AE2 A;  2QL8 A;  3KXW A;  1O9T A;  4D4I A;  2UXC C;  1I94 C;  2JMP A;  5JRH A;  4JI5 C;  2MM9 A;  4DCS A;  1XNR C;  3GKU A;  4DV7 C;  2UXB C;  1MXA A;  5BSR A;  4KHP C;  1HH2 P;  3A4I A;  2AYA A;  2P02 A;  4NOZ A;  4OX9 C;  3TR3 A;  1MXC A;  1PU1 A;  3E7X A;  1XRA A;  5DV9 A;  3PBK A;  2ZZM A;  2QVY X;  2ATW A;  4PUG A;  4FTF A;  2OO4 A;  1PG4 A;  4G1I A;  4PZP A;  5A2Q D;  3T1H C;  2D1S A;  2UUA C;  4JI8 C;  4DCT A;  3UEB A;  1XRB A;  4R1L A;  2MCQ A;  2NCL A;  4IZ6 A;  2HHH C;  3NYR A;  1K0R A;  4WS9 A;  3J80 D;  4JI2 C;  5CZX A;  4LF6 C;  5ADZ A;  2PT7 G;  4OYC A;  2UU9 C;  4DCV A;  5BSU A;  3S82 A;  5LMN C;  3R9X A;  5E7Q A;  2UXD C;  2QVX X;  2UUC C;  1AMU A;  4KTV A;  4YHH C;  1VLA A;  3SO4 A;  4DV5 C;  1ZB9 A;  3GR0 A;  4B3T C;  1HNW C;  3VNQ A;  1IBK C;  4FUQ A;  4DV6 C;  5AE3 A;  4I9F A;  2P2B A;  1RY2 A;  2CU6 A;  3DLP X;  4WV3 A;  4DUY C;  3FCE A;  4B3R C;  4KTT A;  2ZTB A;  4XX2 A;  3IEU A;  1JOS A;  1MDF A;  4B3M C;  4ISB A;  2P20 A;  4BCA A;  3LUS A;  1GPM A;  2YWC A;  3AF5 A;  2E0G A;  1RG9 A;  4X66 C;  4DV2 C;  4OXI A;  4K0B A;  3J81 D;  4LFA C;  1NY8 A;  4DR7 C;  2D1T A;  4RM2 A;  4R0M A;  3CQ3 A;  1N36 C;  4ZLP A;  2DPL A;  2WP0 C;  4D56 A;  2E8E A;  4GKK C;  3RG2 A;  4NXN C;  4DV1 C;  1XDX A;  2P2M A;  2QVZ X;  4RMN A;  2EGT A;  1XMQ C;  1MXB A;  4JI7 C;  2VQF C;  5LMU C;  1P7L A;  2BJO A;  3NI2 A;  2DYJ A;  3IEV A;  4RVN A;  3FM7 A;  4ZJZ A;  1FUG A;  1IBM C;  2Y4O A;  4LF8 C;  2E8F A;  1BA3 A;  4DUZ C;  4YY3 C;  5BST A;  2OBV A;  2MMA B;  1UKK A;  3CQ2 A;  3E7W A;  5BSM A;  4IR7 A;  2OPL B;  4L7I A;  5BSV A;  5T8T A;  5BUS A;  1EGA A;  3IML A;  3CQ1 A;  1MD9 A;  2V7B A;  5IT9 D;  4GXQ A;  4X65 C;  1QWI A;  1HNX C;  4FUT A;  2D1R A;  4GXR A;  1MKY A;  1O90 A;  2VQE C;  1T5H X;  3J7A D;  4JI0 C;  3UX2 A;  2BH1 X;  2YX1 A;  1USP B;  4JI1 C;  4LF5 C;  2D7V A;  1ML8 A;  1PA4 A;  3EQ6 A;  2M5O A;  1M6X C;  2E7G A;  5BUR A;  2Y27 A;  1M6X A;  2OPL A;  3RV2 A;  1J5E C;  1UWD A;  3GR1 A;  3JAM D;  4G36 A;  4DR3 C;  4I9G A;  4K0K C;  3GPC A;  3NYQ A;  3ETC A;  3N54 B;  2P2J A;  3CW9 A;  1XRC A;  1KKG A;  2PN2 A;  4PHT A;  3VNR A;  3CW8 X;  3AY0 A;  2D1Q A;  5AE1 A;  1O93 A;  5BR8 C;  1USP A;  2WD9 A;  4DR4 C;  5A19 A;  4X64 C;  1WH9 A;  1HR0 C;  2QW0 X;  3R9W A;  4PUH A;  4BC7 A;  5K85 A;  4JI6 C;  3A9V A;  4LF4 C;  3EER A;  4LE5 A;  2VZE A;  4NDN A;  1N34 C;  1TH5 A;  2YCB A;  2XR1 A;  2DHM A;  2UUB C;  4MTN A;  2E5L C;  4LF7 C;  4X62 C;  5KYV A;  4GS5 A;  3UX3 A;  2PG1 E;  1HNZ C;  3OTO C;  2M5H A;  4ODJ A;  1YJ7 A;  2VSQ A;  1L2F A;  4RLQ A;  1V60 A;  3LAX A;  3PRO C;  4R1M A;  3TDE A;  1P4E C;  2E8C A;  4BBY A;  1V26 A;  1P4E A;  4PUI A;  5CZV A;  2ZZN A;  3UOW A;  1FJG C;  2KZF A;  2P2Q A;  4GKJ C;  1ULT A;  4L2Z A;  1IBL C;  2HJG A;  3A9U A;  5KYT A;  1PG3 A;  1QM4 A;  4DR1 C;  4D4G A;  2PRO A;  5LCI A;  3ETO A;  4LF9 C;  3DHV A;  3LNO A;  5T8S A;  2KZ0 A;  3R44 A;  2CXC A;  1N32 C;  1VEH A;  5BSW A;  2ZM6 C;  2Y4N A;  4DV4 C; 
#chains in the Genus database with same CATH homology
 3DAY A;  4DV0 C;  4U5Y D;  5A1G A;  5KEI A;  3B7W A;  4DR6 C;  4LFC C;  3I08 A;  3TQI A;  1XMO C;  3NPD A;  2CY1 A;  5K8F A;  1N33 C;  5FLX D;  1N2F A;  4DV3 C;  4BSZ A;  2YWB A;  1T5D X;  4RLF A;  2F4V C;  4BC9 A;  4MH4 A;  1O92 A;  4DG8 A;  4JV5 C;  3N2Q A;  3L8C A;  1LQL A;  3H2T A;  4DG9 A;  3C5E A;  2D28 C;  3PES A;  1NYE A;  3UZ0 A;  4LFB C;  1XNQ C;  2D27 A;  3FCC A;  4D57 A;  4EAT A;  4DCU A;  1ZB8 A;  1LCI A;  4JI3 C;  3IPL A;  3L95 X;  1WF3 A;  2ONF A;  4JYA C;  4B3S C;  3LGX A;  5BUQ A;  4AQY C;  4HPV A;  3T1Y C;  3TUF A;  2ASB A;  4DR2 C;  4JM1 A;  5H9U A;  4DR5 C;  3CJE A;  4NXM C;  4JI4 C;  4RM3 A;  5IFI A;  5IWA C;  2P2F A;  3LNV A;  3AF6 A;  5A1I A;  4TPS B;  4L4Q A;  4G37 A;  4RVO A;  1V25 A;  1MDB A;  3G7S A;  3I07 A;  3VNS A;  4PRO C;  5GTD A;  3KXW A;  2QL8 A;  4D4I A;  1O9T A;  5AE2 A;  2UXC C;  1I94 C;  2JMP A;  5JRH A;  4JI5 C;  4DCS A;  1XNR C;  3GKU A;  4DV7 C;  2UXB C;  1MXA A;  5BSR A;  4KHP C;  1HH2 P;  3A4I A;  2AYA A;  2P02 A;  4NOZ A;  4OX9 C;  1MXC A;  3E7X A;  1XRA A;  5DV9 A;  3PBK A;  2QVY X;  2ATW A;  4FTF A;  2OO4 A;  1PG4 A;  4G1I A;  4PZP A;  5A2Q D;  3T1H C;  2D1S A;  2UUA C;  4JI8 C;  4DCT A;  1XRB A;  4R1L A;  4IZ6 A;  2HHH C;  3NYR A;  1K0R A;  4WS9 A;  3J80 D;  4JI2 C;  5CZX A;  4LF6 C;  5ADZ A;  2PT7 G;  4OYC A;  2UU9 C;  4DCV A;  5BSU A;  3S82 A;  5LMN C;  3R9X A;  5E7Q A;  2UXD C;  2QVX X;  2UUC C;  1AMU A;  4KTV A;  4YHH C;  1VLA A;  3SO4 A;  4DV5 C;  1ZB9 A;  3GR0 A;  4B3T C;  1HNW C;  3VNQ A;  1IBK C;  4FUQ A;  4DV6 C;  5AE3 A;  4I9F A;  2P2B A;  1RY2 A;  3DLP X;  4WV3 A;  4DUY C;  3FCE A;  4B3R C;  4KTT A;  4XX2 A;  3IEU A;  1JOS A;  1MDF A;  4B3M C;  4ISB A;  2P20 A;  4BCA A;  3LUS A;  1GPM A;  2YWC A;  3AF5 A;  2E0G A;  1RG9 A;  4X66 C;  4DV2 C;  4OXI A;  4K0B A;  3J81 D;  4LFA C;  4DR7 C;  2D1T A;  4RM2 A;  4R0M A;  1N36 C;  4ZLP A;  2DPL A;  2WP0 C;  4D56 A;  2E8E A;  4GKK C;  3RG2 A;  4NXN C;  4DV1 C;  2P2M A;  2QVZ X;  4RMN A;  2EGT A;  1XMQ C;  1MXB A;  4JI7 C;  2VQF C;  5LMU C;  1P7L A;  2BJO A;  3NI2 A;  2DYJ A;  3IEV A;  4RVN A;  4ZJZ A;  1FUG A;  1IBM C;  2Y4O A;  4LF8 C;  2E8F A;  1BA3 A;  4DUZ C;  4YY3 C;  5BST A;  2OBV A;  1UKK A;  3E7W A;  5BSM A;  4IR7 A;  2OPL B;  4L7I A;  5BSV A;  5T8T A;  5BUS A;  1EGA A;  3IML A;  1MD9 A;  2V7B A;  5IT9 D;  4GXQ A;  4X65 C;  1QWI A;  1HNX C;  4FUT A;  2D1R A;  4GXR A;  1MKY A;  1O90 A;  2VQE C;  1T5H X;  3J7A D;  4JI0 C;  2BH1 X;  1USP B;  4JI1 C;  4LF5 C;  2D7V A;  1ML8 A;  1PA4 A;  3EQ6 A;  2E7G A;  5BUR A;  2Y27 A;  2OPL A;  3RV2 A;  1J5E C;  3JAM D;  3GR1 A;  4G36 A;  4DR3 C;  4I9G A;  4K0K C;  3GPC A;  3NYQ A;  3ETC A;  3N54 B;  2P2J A;  3CW9 A;  1XRC A;  1KKG A;  2PN2 A;  4PHT A;  3VNR A;  3CW8 X;  2D1Q A;  5AE1 A;  1O93 A;  5BR8 C;  1USP A;  2WD9 A;  4DR4 C;  5A19 A;  4X64 C;  1WH9 A;  1HR0 C;  2QW0 X;  3R9W A;  4BC7 A;  5K85 A;  4JI6 C;  3A9V A;  4LF4 C;  3EER A;  4LE5 A;  2VZE A;  4NDN A;  1N34 C;  2YCB A;  2XR1 A;  2UUB C;  4MTN A;  2E5L C;  4LF7 C;  4X62 C;  5KYV A;  4GS5 A;  1HNZ C;  3OTO C;  4ODJ A;  1YJ7 A;  2VSQ A;  1L2F A;  4RLQ A;  3LAX A;  3PRO C;  4R1M A;  3TDE A;  2E8C A;  4BBY A;  1V26 A;  5CZV A;  3UOW A;  1FJG C;  2KZF A;  2P2Q A;  4GKJ C;  1ULT A;  4L2Z A;  1IBL C;  2HJG A;  3A9U A;  5KYT A;  1PG3 A;  1QM4 A;  4DR1 C;  4D4G A;  2PRO A;  4LF9 C;  3ETO A;  3DHV A;  5T8S A;  3R44 A;  2CXC A;  1N32 C;  5BSW A;  2ZM6 C;  2Y4N A;  4DV4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...