2VQFC

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2vqfC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2vqfC02
1N2FA 2HJGA 3AF5A 1JOSA 1USPB 1IBKC 1USPA 4JI1C 1HNWC 2OPLB 2QL8A 4DCVA 4DUZC 2HHHC 4NXMC 1PA4A 1N36C 4JV5C 4AQYC 5FLXD 4DV6C 1N33C 4JI4C 1WH9A 3OTOC 1IBMC 2UXDC 4JI3C 4LFCC 1LQLA 2E5LC 4DR3C 4DV1C 2UU9C 1NYEA 2UXBC 5A2QD 1HR0C 2UUCC 4JI6C 4B3RC 4BSZA 4DV3C 4DV0C 1XMQC 2ONFA 1WF3A 4DR5C 3JAMD 1XMOC 3T1YC 4LF9C 3EERA 1VLAA 1KKGA 3AF6A 1MKYA 4B3TC 4DR1C 4LF8C 1N32C 4JI0C 2DYJA 4MTNA 2PN2A 5LMUC 3IEVA 2UUAC 2CXCA 2XR1A 2F4VC 1N34C 4DR7C 2ATWA 1HNZC 1UKKA 2EGTA 4DV7C 1FJGC 3IEUA 2CY1A 5IT9D 2PT7G 4DV4C 1I94C 4B3SC 2VQFC 1QWIA 4LF4C 4GKJC 2UUBC 2ASBA 4DR2C 4GKKC 3R9WA 2VQEC 1K0RA 4JI5C 5BR8C 3J80D 4B3MC 1ZB8A 3CJEA 4XX2A 4LFBC 1XNRC 2E8CA 1J5EC 4DCSA 4LF6C 4DUYC 1EGAA 2YCBA 3I07A 4DR6C 1ML8A 4K0KC 4NXNC 3J7AD 2BJOA 4JI7C 4DCUA 2E7GA 3LUSA 4X65C 1ZB9A 2D7VA 4JI8C 2OPLA 4JYAC 2JMPA 4YY3C 4KHPC 4OX9C 1IBLC 1HNXC 2ZM6C 5LMNC 4JI2C 4DV2C 3J81D 4DCTA 4YHHC 4MH4A 3T1HC 3GKUA 4X64C 4DR4C 4NOZA 4X66C 4LFAC 3R9XA 4LF5C 2UXCC 1L2FA 4DV5C 2E8FA 4X62C 1XNQC 2E8EA 2KZFA 4LF7C 5IWAC 1HH2P
chains in the Genus database with same CATH superfamily
2VSQA 1IBKC 5K85A 4KTVA 2D1QA 4D4IA 4ZLPA 4ISBA 2HHHC 3H2TA 4RVOA 4JM1A 1P4EA 1NYEA 5BSWA 5A2QD 4L7IA 4JI6C 2OBVA 4WS9A 1XMQC 2BH1X 4D4GA 1WF3A 2Y4NA 4DR5C 4ODJA 1XMOC 4OXIA 2PROA 4GXRA 1KKGA 3AF6A 1N32C 5LMUC 2QW0X 1IB8A 1N34C 3SO4A 4RM2A 1UKKA 4TPSB 3IEUA 4DV4C 2WD9A 4HPVA 2P2FA 5T8SA 2VQFC 3A25A 4LF4C 2UUBC 2QVXX 1ULTA 4GKKC 3ETOA 4G36A 4BBYA 3PESA 3NYRA 5GTDA 1M6XA 4LFBC 2D1RA 1PG3A 2YCBA 2PG1E 2D1TA 4NXNC 4NDNA 4R1MA 2AYAA 2CU6A 2OPLA 4BC9A 3RG2A 4RLQA 1HNXC 4L2ZA 5A1GA 3J81D 4DCTA 1MXAA 1M6XC 4DR4C 4IR7A 1L2FA 1XRBA 2E8EA 1XHJA 3G7SA 1HH2P 1PU1A 1FLOA 5LCIA 3LGXA 1JOSA 1USPA 2MMAB 2M5OA 1HNWC 2OPLB 5KEIA 5BSRA 4DCVA 3B7WA 4DUZC 4JV5C 4JI4C 4LE5A 3OTOC 1IBMC 4WV3A 4KTTA 2E5LC 2UU9C 2UXBC 4U5YD 1RY2A 2WP0C 5CZXA 5BUSA 1UWDA 5KYVA 2ONFA 3A9VA 3JAMD 3T1YC 2P2BA 1MKYA 4DR1C 1BA3A 4PHTA 2QVZX 5A19A 2CXCA 3IMLA 3N2QA 2D27A 2ATWA 2DHMA 4DR7C 1QM4A 2EGTA 4DV7C 2MM9A 1FJGC 2P20A 2CY1A 3TR3A 3AY0A 1QWIA 4GKJC 3GR0A 2MCQA 2P2JA 3EQ6A 4JI5C 1O93A 3NYQA 1V60A 5BR8C 4XX2A 1XNRC 1XS3A 4RMNA 2NCLA 1EGAA 5BSMA 3FM7A 4BC7A 4K0KC 2ZZNA 2BJOA 1PG4A 4JI7C 4DCUA 2E7GA 3IPLA 3LUSA 5H9UA 3A26A 3CQ1A 5BSVA 3VNRA 4OX9C 1IBLC 4JI2C 3GKUA 4X64C 4GXQA 2E0GA 4L4QA 4NOZA 4LFAC 4OYCA 4PUGA 4LF5C 4DV5C 2E8FA 1MDFA 1P4EC 4DG8A 2YX1A 2KZFA 4DG9A 4LF7C 3N54B 2P2MA 2HJGA 2QVYX 3AF5A 4JI1C 5BSTA 2Y27A 1YGTA 4NXMC 1NY8A 4R0MA 4AQYC 3TUFA 4PUHA 5FLXD 1N33C 1T5HX 2M5HA 1WH9A 2UXDC 4JI3C 4ZJZA 3PBKA 2ZZMA 4PUIA 3CW8X 3PROC 2UUCC 4G37A 4BSZA 4DV3C 1P7LA 2YWBA 4DV0C 3I08A 4I9FA 3NI2A 4IZ6A 3KXWA 4R1LA 1LCIA 4LF9C 4RVNA 3L95X 4LF8C 4MTNA 3IEVA 2UUAC 2XR1A 2F4VC 4EATA 1HNZC 3GPCA 4GS5A 4FUTA 3C5EA 1MDBA 5CZVA 3UZ0A 2PT7G 1GPMA 3LAXA 3ETCA 2JNVA 5DV9A 2VZEA 3DAYA 4DR2C 3UEBA 2VQEC 4G1IA 1MXCA 1RG9A 4I9GA 3J80D 4B3MC 3CJEA 2E8CA 1J5EC 4LF6C 5E7QA 4DR6C 3A9UA 4D56A 3LNVA 4JI8C 2P2QA 3TQIA 4JYAC 2JMPA 4YY3C 4KHPC 1MD9A 2V7BA 4PZPA 2ZM6C 3FCEA 5IFIA 4DV2C 5JRHA 2ZTBA 4MH4A 3T1HC 5AE2A 3DLPX 3S82A 2UXCC 1XNQC 3CQ3A 3GR1A 1N2FA 1USPB 1O90A 3FCCA 3CQ2A 1V25A 3LNOA 2QL8A 1YJ7A 2Y4OA 3L8CA 1PA4A 1N36C 5AE1A 5T8TA 4DV6C 3VNSA 4LFCC 1LQLA 4DR3C 4DV1C 1HR0C 5KYTA 4B3RC 2Z51A 1AMUA 5A1IA 3CW9A 2P02A 2D1SA 1T5DX 5AE3A 3O2EA 5BSUA 3EERA 1VLAA 4B3TC 1XDXA 4K0BA 4JI0C 2DYJA 2PN2A 5BUQA 4FUQA 4RLFA 3UX3A 1XRAA 2KZ0A 4BCAA 5ADZA 4RM3A 4PROC 1VEHA 5IT9D 1I94C 4B3SC 1V26A 2ASBA 1O92A 3VNQA 4FTFA 3R9WA 3R44A 3E7XA 1K0RA 4D57A 1ZB8A 1FUGA 1XRCA 1MXBA 4DCSA 3E7WA 2KDNA 3RV2A 4DUYC 2DPLA 3I07A 1ML8A 3J7AD 1TH5A 2D28C 2OO4A 1WCJA 4X65C 1ZB9A 2D7VA 3UOWA 2YWCA 3NPDA 3TDEA 5LMNC 4YHHC 3UX2A 4X66C 3DHVA 3R9XA 3A4IA 1O9TA 5K8FA 5BURA 4X62C 3K6RA 5IWAC
chains in the Genus database with same CATH topology
2VSQA 1IBKC 5K85A 4KTVA 2D1QA 4D4IA 4ZLPA 4ISBA 2HHHC 3H2TA 4RVOA 4JM1A 1NYEA 5BSWA 5A2QD 4L7IA 4JI6C 2OBVA 4WS9A 1XMQC 2BH1X 4D4GA 1WF3A 2Y4NA 4DR5C 4ODJA 1XMOC 4OXIA 2PROA 4GXRA 1KKGA 3AF6A 1N32C 5LMUC 2QW0X 1N34C 3SO4A 4RM2A 1UKKA 4TPSB 3IEUA 5T8SA 2WD9A 4HPVA 2P2FA 4DV4C 2VQFC 4LF4C 2UUBC 2QVXX 1ULTA 4GKKC 3ETOA 4G36A 4BBYA 3PESA 3NYRA 5GTDA 4LFBC 2D1RA 1PG3A 2YCBA 2D1TA 4NXNC 4NDNA 4R1MA 2AYAA 2OPLA 4BC9A 3RG2A 4RLQA 1HNXC 4L2ZA 5A1GA 3J81D 4DCTA 1MXAA 4DR4C 4IR7A 1L2FA 1XRBA 2E8EA 3G7SA 1HH2P 3LGXA 1JOSA 1USPA 1HNWC 2OPLB 5KEIA 5BSRA 4DCVA 3B7WA 4DUZC 4JV5C 4JI4C 4LE5A 3OTOC 1IBMC 4WV3A 4KTTA 2E5LC 2UU9C 2UXBC 4U5YD 1RY2A 2WP0C 5CZXA 5BUSA 5KYVA 2ONFA 3A9VA 3JAMD 3T1YC 2P2BA 1MKYA 4DR1C 1BA3A 4PHTA 2QVZX 5A19A 2CXCA 3IMLA 3N2QA 2D27A 2ATWA 4DR7C 1QM4A 2EGTA 4DV7C 1FJGC 2P20A 2CY1A 1QWIA 4GKJC 3GR0A 2P2JA 3EQ6A 4JI5C 1O93A 3NYQA 5BR8C 4XX2A 1XNRC 4RMNA 1EGAA 5BSMA 4BC7A 4K0KC 2BJOA 1PG4A 4JI7C 4DCUA 2E7GA 3IPLA 3LUSA 5H9UA 5BSVA 3VNRA 4OX9C 1IBLC 4JI2C 3GKUA 4X64C 4GXQA 2E0GA 4L4QA 4NOZA 4LFAC 4OYCA 4LF5C 4DV5C 2E8FA 1MDFA 4DG8A 2KZFA 4DG9A 4LF7C 3N54B 2P2MA 2HJGA 2QVYX 3AF5A 4JI1C 5BSTA 2Y27A 4NXMC 4R0MA 4AQYC 3TUFA 5FLXD 1N33C 1T5HX 1WH9A 2UXDC 4JI3C 4ZJZA 3PBKA 3CW8X 3PROC 2UUCC 4G37A 4BSZA 4DV3C 1P7LA 2YWBA 4DV0C 3I08A 4I9FA 3NI2A 4IZ6A 3KXWA 4R1LA 1LCIA 4LF9C 4RVNA 3L95X 4LF8C 4MTNA 3IEVA 2UUAC 2XR1A 2F4VC 4EATA 1HNZC 3GPCA 4GS5A 4FUTA 3C5EA 1MDBA 5CZVA 3UZ0A 2PT7G 1GPMA 3LAXA 3ETCA 5DV9A 2VZEA 3DAYA 4DR2C 2VQEC 4G1IA 1MXCA 1RG9A 4I9GA 3J80D 4B3MC 3CJEA 2E8CA 1J5EC 4LF6C 5E7QA 4DR6C 3A9UA 4D56A 3LNVA 4JI8C 2P2QA 3TQIA 4JYAC 2JMPA 4YY3C 4KHPC 1MD9A 2V7BA 4PZPA 2ZM6C 3FCEA 5IFIA 4DV2C 5JRHA 4MH4A 3T1HC 5AE2A 3DLPX 3S82A 2UXCC 1XNQC 3GR1A 1N2FA 1USPB 1O90A 3FCCA 1V25A 2QL8A 1YJ7A 2Y4OA 3L8CA 1PA4A 1N36C 5AE1A 5T8TA 4DV6C 3VNSA 4LFCC 1LQLA 4DR3C 4DV1C 1HR0C 5KYTA 4B3RC 1AMUA 5A1IA 3CW9A 2P02A 2D1SA 1T5DX 5AE3A 5BSUA 3EERA 1VLAA 4B3TC 4K0BA 4JI0C 2DYJA 2PN2A 5BUQA 4FUQA 4RLFA 1XRAA 4BCAA 5ADZA 4RM3A 4PROC 5IT9D 1I94C 4B3SC 1V26A 2ASBA 1O92A 3VNQA 4FTFA 3R9WA 3R44A 3E7XA 1K0RA 4D57A 1ZB8A 1FUGA 1XRCA 1MXBA 4DCSA 3E7WA 3RV2A 4DUYC 2DPLA 3I07A 1ML8A 3J7AD 2D28C 2OO4A 4X65C 1ZB9A 2D7VA 3UOWA 2YWCA 3NPDA 3TDEA 5LMNC 4YHHC 4X66C 3DHVA 3R9XA 3A4IA 1O9TA 5K8FA 5BURA 4X62C 5IWAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  2HJG A;  3AF5 A;  1JOS A;  1USP B;  1IBK C;  1USP A;  4JI1 C;  1HNW C;  2OPL B;  2QL8 A;  4DCV A;  4DUZ C;  2HHH C;  4NXM C;  1PA4 A;  1N36 C;  4JV5 C;  4AQY C;  5FLX D;  4DV6 C;  1N33 C;  4JI4 C;  1WH9 A;  3OTO C;  1IBM C;  2UXD C;  4JI3 C;  4LFC C;  1LQL A;  2E5L C;  4DR3 C;  4DV1 C;  2UU9 C;  1NYE A;  2UXB C;  5A2Q D;  1HR0 C;  2UUC C;  4JI6 C;  4B3R C;  4BSZ A;  4DV3 C;  4DV0 C;  1XMQ C;  2ONF A;  1WF3 A;  4DR5 C;  3JAM D;  1XMO C;  3T1Y C;  4LF9 C;  3EER A;  1VLA A;  1KKG A;  3AF6 A;  1MKY A;  4B3T C;  4DR1 C;  4LF8 C;  1N32 C;  4JI0 C;  2DYJ A;  4MTN A;  2PN2 A;  5LMU C;  3IEV A;  2UUA C;  2CXC A;  2XR1 A;  2F4V C;  1N34 C;  4DR7 C;  2ATW A;  1HNZ C;  1UKK A;  2EGT A;  4DV7 C;  1FJG C;  3IEU A;  2CY1 A;  5IT9 D;  2PT7 G;  4DV4 C;  1I94 C;  4B3S C;  2VQF C;  1QWI A;  4LF4 C;  4GKJ C;  2UUB C;  2ASB A;  4DR2 C;  4GKK C;  3R9W A;  2VQE C;  1K0R A;  4JI5 C;  5BR8 C;  3J80 D;  4B3M C;  1ZB8 A;  3CJE A;  4XX2 A;  4LFB C;  1XNR C;  2E8C A;  1J5E C;  4DCS A;  4LF6 C;  4DUY C;  1EGA A;  2YCB A;  3I07 A;  4DR6 C;  1ML8 A;  4K0K C;  4NXN C;  3J7A D;  2BJO A;  4JI7 C;  4DCU A;  2E7G A;  3LUS A;  4X65 C;  1ZB9 A;  2D7V A;  4JI8 C;  2OPL A;  4JYA C;  2JMP A;  4YY3 C;  4KHP C;  4OX9 C;  1IBL C;  1HNX C;  2ZM6 C;  5LMN C;  4JI2 C;  4DV2 C;  3J81 D;  4DCT A;  4YHH C;  4MH4 A;  3T1H C;  3GKU A;  4X64 C;  4DR4 C;  4NOZ A;  4X66 C;  4LFA C;  3R9X A;  4LF5 C;  2UXC C;  1L2F A;  4DV5 C;  2E8F A;  4X62 C;  1XNQ C;  2E8E A;  2KZF A;  4LF7 C;  5IWA C;  1HH2 P; 
#chains in the Genus database with same CATH topology
 2VSQ A;  1IBK C;  5K85 A;  4KTV A;  2D1Q A;  4D4I A;  4ZLP A;  4ISB A;  2HHH C;  3H2T A;  4RVO A;  4JM1 A;  1P4E A;  1NYE A;  5BSW A;  5A2Q D;  4L7I A;  4JI6 C;  2OBV A;  4WS9 A;  1XMQ C;  2BH1 X;  4D4G A;  1WF3 A;  2Y4N A;  4DR5 C;  4ODJ A;  1XMO C;  4OXI A;  2PRO A;  4GXR A;  1KKG A;  3AF6 A;  1N32 C;  5LMU C;  2QW0 X;  1IB8 A;  1N34 C;  3SO4 A;  4RM2 A;  1UKK A;  4TPS B;  3IEU A;  4DV4 C;  2WD9 A;  4HPV A;  2P2F A;  5T8S A;  2VQF C;  3A25 A;  4LF4 C;  2UUB C;  2QVX X;  1ULT A;  4GKK C;  3ETO A;  4G36 A;  4BBY A;  3PES A;  3NYR A;  5GTD A;  1M6X A;  4LFB C;  2D1R A;  1PG3 A;  2YCB A;  2PG1 E;  2D1T A;  4NXN C;  4NDN A;  4R1M A;  2AYA A;  2CU6 A;  2OPL A;  4BC9 A;  3RG2 A;  4RLQ A;  1HNX C;  4L2Z A;  5A1G A;  3J81 D;  4DCT A;  1MXA A;  1M6X C;  4DR4 C;  4IR7 A;  1L2F A;  1XRB A;  2E8E A;  1XHJ A;  3G7S A;  1HH2 P;  1PU1 A;  1FLO A;  5LCI A;  3LGX A;  1JOS A;  1USP A;  2MMA B;  2M5O A;  1HNW C;  2OPL B;  5KEI A;  5BSR A;  4DCV A;  3B7W A;  4DUZ C;  4JV5 C;  4JI4 C;  4LE5 A;  3OTO C;  1IBM C;  4WV3 A;  4KTT A;  2E5L C;  2UU9 C;  2UXB C;  4U5Y D;  1RY2 A;  2WP0 C;  5CZX A;  5BUS A;  1UWD A;  5KYV A;  2ONF A;  3A9V A;  3JAM D;  3T1Y C;  2P2B A;  1MKY A;  4DR1 C;  1BA3 A;  4PHT A;  2QVZ X;  5A19 A;  2CXC A;  3IML A;  3N2Q A;  2D27 A;  2ATW A;  2DHM A;  4DR7 C;  1QM4 A;  2EGT A;  4DV7 C;  2MM9 A;  1FJG C;  2P20 A;  2CY1 A;  3TR3 A;  3AY0 A;  1QWI A;  4GKJ C;  3GR0 A;  2MCQ A;  2P2J A;  3EQ6 A;  4JI5 C;  1O93 A;  3NYQ A;  1V60 A;  5BR8 C;  4XX2 A;  1XNR C;  1XS3 A;  4RMN A;  2NCL A;  1EGA A;  5BSM A;  3FM7 A;  4BC7 A;  4K0K C;  2ZZN A;  2BJO A;  1PG4 A;  4JI7 C;  4DCU A;  2E7G A;  3IPL A;  3LUS A;  5H9U A;  3A26 A;  3CQ1 A;  5BSV A;  3VNR A;  4OX9 C;  1IBL C;  4JI2 C;  3GKU A;  4X64 C;  4GXQ A;  2E0G A;  4L4Q A;  4NOZ A;  4LFA C;  4OYC A;  4PUG A;  4LF5 C;  4DV5 C;  2E8F A;  1MDF A;  1P4E C;  4DG8 A;  2YX1 A;  2KZF A;  4DG9 A;  4LF7 C;  3N54 B;  2P2M A;  2HJG A;  2QVY X;  3AF5 A;  4JI1 C;  5BST A;  2Y27 A;  1YGT A;  4NXM C;  1NY8 A;  4R0M A;  4AQY C;  3TUF A;  4PUH A;  5FLX D;  1N33 C;  1T5H X;  2M5H A;  1WH9 A;  2UXD C;  4JI3 C;  4ZJZ A;  3PBK A;  2ZZM A;  4PUI A;  3CW8 X;  3PRO C;  2UUC C;  4G37 A;  4BSZ A;  4DV3 C;  1P7L A;  2YWB A;  4DV0 C;  3I08 A;  4I9F A;  3NI2 A;  4IZ6 A;  3KXW A;  4R1L A;  1LCI A;  4LF9 C;  4RVN A;  3L95 X;  4LF8 C;  4MTN A;  3IEV A;  2UUA C;  2XR1 A;  2F4V C;  4EAT A;  1HNZ C;  3GPC A;  4GS5 A;  4FUT A;  3C5E A;  1MDB A;  5CZV A;  3UZ0 A;  2PT7 G;  1GPM A;  3LAX A;  3ETC A;  2JNV A;  5DV9 A;  2VZE A;  3DAY A;  4DR2 C;  3UEB A;  2VQE C;  4G1I A;  1MXC A;  1RG9 A;  4I9G A;  3J80 D;  4B3M C;  3CJE A;  2E8C A;  1J5E C;  4LF6 C;  5E7Q A;  4DR6 C;  3A9U A;  4D56 A;  3LNV A;  4JI8 C;  2P2Q A;  3TQI A;  4JYA C;  2JMP A;  4YY3 C;  4KHP C;  1MD9 A;  2V7B A;  4PZP A;  2ZM6 C;  3FCE A;  5IFI A;  4DV2 C;  5JRH A;  2ZTB A;  4MH4 A;  3T1H C;  5AE2 A;  3DLP X;  3S82 A;  2UXC C;  1XNQ C;  3CQ3 A;  3GR1 A;  1N2F A;  1USP B;  1O90 A;  3FCC A;  3CQ2 A;  1V25 A;  3LNO A;  2QL8 A;  1YJ7 A;  2Y4O A;  3L8C A;  1PA4 A;  1N36 C;  5AE1 A;  5T8T A;  4DV6 C;  3VNS A;  4LFC C;  1LQL A;  4DR3 C;  4DV1 C;  1HR0 C;  5KYT A;  4B3R C;  2Z51 A;  1AMU A;  5A1I A;  3CW9 A;  2P02 A;  2D1S A;  1T5D X;  5AE3 A;  3O2E A;  5BSU A;  3EER A;  1VLA A;  4B3T C;  1XDX A;  4K0B A;  4JI0 C;  2DYJ A;  2PN2 A;  5BUQ A;  4FUQ A;  4RLF A;  3UX3 A;  1XRA A;  2KZ0 A;  4BCA A;  5ADZ A;  4RM3 A;  4PRO C;  1VEH A;  5IT9 D;  1I94 C;  4B3S C;  1V26 A;  2ASB A;  1O92 A;  3VNQ A;  4FTF A;  3R9W A;  3R44 A;  3E7X A;  1K0R A;  4D57 A;  1ZB8 A;  1FUG A;  1XRC A;  1MXB A;  4DCS A;  3E7W A;  2KDN A;  3RV2 A;  4DUY C;  2DPL A;  3I07 A;  1ML8 A;  3J7A D;  1TH5 A;  2D28 C;  2OO4 A;  1WCJ A;  4X65 C;  1ZB9 A;  2D7V A;  3UOW A;  2YWC A;  3NPD A;  3TDE A;  5LMN C;  4YHH C;  3UX2 A;  4X66 C;  3DHV A;  3R9X A;  3A4I A;  1O9T A;  5K8F A;  5BUR A;  4X62 C;  3K6R A;  5IWA C; 
#chains in the Genus database with same CATH homology
 2VSQ A;  1IBK C;  5K85 A;  4KTV A;  2D1Q A;  4D4I A;  4ZLP A;  4ISB A;  2HHH C;  3H2T A;  4RVO A;  4JM1 A;  1NYE A;  5BSW A;  5A2Q D;  4L7I A;  4JI6 C;  2OBV A;  4WS9 A;  1XMQ C;  2BH1 X;  4D4G A;  1WF3 A;  2Y4N A;  4DR5 C;  4ODJ A;  1XMO C;  4OXI A;  2PRO A;  4GXR A;  1KKG A;  3AF6 A;  1N32 C;  5LMU C;  2QW0 X;  1N34 C;  3SO4 A;  4RM2 A;  1UKK A;  4TPS B;  3IEU A;  5T8S A;  2WD9 A;  4HPV A;  2P2F A;  4DV4 C;  2VQF C;  4LF4 C;  2UUB C;  2QVX X;  1ULT A;  4GKK C;  3ETO A;  4G36 A;  4BBY A;  3PES A;  3NYR A;  5GTD A;  4LFB C;  2D1R A;  1PG3 A;  2YCB A;  2D1T A;  4NXN C;  4NDN A;  4R1M A;  2AYA A;  2OPL A;  4BC9 A;  3RG2 A;  4RLQ A;  1HNX C;  4L2Z A;  5A1G A;  3J81 D;  4DCT A;  1MXA A;  4DR4 C;  4IR7 A;  1L2F A;  1XRB A;  2E8E A;  3G7S A;  1HH2 P;  3LGX A;  1JOS A;  1USP A;  1HNW C;  2OPL B;  5KEI A;  5BSR A;  4DCV A;  3B7W A;  4DUZ C;  4JV5 C;  4JI4 C;  4LE5 A;  3OTO C;  1IBM C;  4WV3 A;  4KTT A;  2E5L C;  2UU9 C;  2UXB C;  4U5Y D;  1RY2 A;  2WP0 C;  5CZX A;  5BUS A;  5KYV A;  2ONF A;  3A9V A;  3JAM D;  3T1Y C;  2P2B A;  1MKY A;  4DR1 C;  1BA3 A;  4PHT A;  2QVZ X;  5A19 A;  2CXC A;  3IML A;  3N2Q A;  2D27 A;  2ATW A;  4DR7 C;  1QM4 A;  2EGT A;  4DV7 C;  1FJG C;  2P20 A;  2CY1 A;  1QWI A;  4GKJ C;  3GR0 A;  2P2J A;  3EQ6 A;  4JI5 C;  1O93 A;  3NYQ A;  5BR8 C;  4XX2 A;  1XNR C;  4RMN A;  1EGA A;  5BSM A;  4BC7 A;  4K0K C;  2BJO A;  1PG4 A;  4JI7 C;  4DCU A;  2E7G A;  3IPL A;  3LUS A;  5H9U A;  5BSV A;  3VNR A;  4OX9 C;  1IBL C;  4JI2 C;  3GKU A;  4X64 C;  4GXQ A;  2E0G A;  4L4Q A;  4NOZ A;  4LFA C;  4OYC A;  4LF5 C;  4DV5 C;  2E8F A;  1MDF A;  4DG8 A;  2KZF A;  4DG9 A;  4LF7 C;  3N54 B;  2P2M A;  2HJG A;  2QVY X;  3AF5 A;  4JI1 C;  5BST A;  2Y27 A;  4NXM C;  4R0M A;  4AQY C;  3TUF A;  5FLX D;  1N33 C;  1T5H X;  1WH9 A;  2UXD C;  4JI3 C;  4ZJZ A;  3PBK A;  3CW8 X;  3PRO C;  2UUC C;  4G37 A;  4BSZ A;  4DV3 C;  1P7L A;  2YWB A;  4DV0 C;  3I08 A;  4I9F A;  3NI2 A;  4IZ6 A;  3KXW A;  4R1L A;  1LCI A;  4LF9 C;  4RVN A;  3L95 X;  4LF8 C;  4MTN A;  3IEV A;  2UUA C;  2XR1 A;  2F4V C;  4EAT A;  1HNZ C;  3GPC A;  4GS5 A;  4FUT A;  3C5E A;  1MDB A;  5CZV A;  3UZ0 A;  2PT7 G;  1GPM A;  3LAX A;  3ETC A;  5DV9 A;  2VZE A;  3DAY A;  4DR2 C;  2VQE C;  4G1I A;  1MXC A;  1RG9 A;  4I9G A;  3J80 D;  4B3M C;  3CJE A;  2E8C A;  1J5E C;  4LF6 C;  5E7Q A;  4DR6 C;  3A9U A;  4D56 A;  3LNV A;  4JI8 C;  2P2Q A;  3TQI A;  4JYA C;  2JMP A;  4YY3 C;  4KHP C;  1MD9 A;  2V7B A;  4PZP A;  2ZM6 C;  3FCE A;  5IFI A;  4DV2 C;  5JRH A;  4MH4 A;  3T1H C;  5AE2 A;  3DLP X;  3S82 A;  2UXC C;  1XNQ C;  3GR1 A;  1N2F A;  1USP B;  1O90 A;  3FCC A;  1V25 A;  2QL8 A;  1YJ7 A;  2Y4O A;  3L8C A;  1PA4 A;  1N36 C;  5AE1 A;  5T8T A;  4DV6 C;  3VNS A;  4LFC C;  1LQL A;  4DR3 C;  4DV1 C;  1HR0 C;  5KYT A;  4B3R C;  1AMU A;  5A1I A;  3CW9 A;  2P02 A;  2D1S A;  1T5D X;  5AE3 A;  5BSU A;  3EER A;  1VLA A;  4B3T C;  4K0B A;  4JI0 C;  2DYJ A;  2PN2 A;  5BUQ A;  4FUQ A;  4RLF A;  1XRA A;  4BCA A;  5ADZ A;  4RM3 A;  4PRO C;  5IT9 D;  1I94 C;  4B3S C;  1V26 A;  2ASB A;  1O92 A;  3VNQ A;  4FTF A;  3R9W A;  3R44 A;  3E7X A;  1K0R A;  4D57 A;  1ZB8 A;  1FUG A;  1XRC A;  1MXB A;  4DCS A;  3E7W A;  3RV2 A;  4DUY C;  2DPL A;  3I07 A;  1ML8 A;  3J7A D;  2D28 C;  2OO4 A;  4X65 C;  1ZB9 A;  2D7V A;  3UOW A;  2YWC A;  3NPD A;  3TDE A;  5LMN C;  4YHH C;  4X66 C;  3DHV A;  3R9X A;  3A4I A;  1O9T A;  5K8F A;  5BUR A;  4X62 C;  5IWA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...