4JYAC

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jyaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4jyaC02
5LMNC 1XNQC 1N32C 3AF5A 1ML8A 2CXCA 4JI4C 3AF6A 1N36C 4DR4C 4LF7C 1HNWC 3T1HC 2BJOA 1N2FA 1VLAA 4X65C 4NXMC 2ZM6C 1NYEA 1N34C 1EGAA 4JI0C 1IBKC 4LF4C 4DR2C 4DR5C 2E8EA 4DR1C 3EERA 5A2QD 4DR6C 4GKJC 1XMOC 3IEUA 5IT9D 2UXBC 2UUBC 4JV5C 4LF9C 4JI1C 4OX9C 2ATWA 1XNRC 2KZFA 1PA4A 1WH9A 2E7GA 1UKKA 3CJEA 1I94C 4JI2C 4JYAC 1HNXC 4MH4A 2E8CA 4DR3C 2UU9C 4DCVA 5IWAC 1HR0C 4NOZA 1QWIA 4XX2A 4LFBC 2UXDC 4JI6C 2E5LC 2UXCC 4B3TC 4DUYC 4KHPC 3I07A 3LUSA 1ZB8A 4BSZA 4LF5C 4YHHC 4DV3C 1MKYA 3OTOC 2XR1A 1N33C 4DCUA 3R9XA 3R9WA 2EGTA 1IBMC 4MTNA 2UUAC 2PN2A 2HJGA 1HH2P 4X64C 2OPLB 4DV6C 4DV5C 1ZB9A 4B3MC 1J5EC 1WF3A 3GKUA 4DCTA 3JAMD 2YCBA 3T1YC 4JI5C 2OPLA 2PT7G 2JMPA 1KKGA 4X62C 4DV7C 4X66C 4AQYC 4LFAC 3J81D 2UUCC 2ASBA 1USPA 5LMUC 4B3RC 4DV0C 4DV2C 2VQFC 4DCSA 1XMQC 4GKKC 1K0RA 4DR7C 4JI8C 4DV4C 4JI3C 2HHHC 4LF6C 2ONFA 2E8FA 3IEVA 1LQLA 3J7AD 1IBLC 1HNZC 2CY1A 2QL8A 4DV1C 4LF8C 4K0KC 1FJGC 5FLXD 1USPB 5BR8C 3J80D 4DUZC 1L2FA 4YY3C 4JI7C 4LFCC 2VQEC 4NXNC 2D7VA 4B3SC 1JOSA 2DYJA 2F4VC
chains in the Genus database with same CATH superfamily
3N2QA 1T5HX 5LMNC 3AY0A 3A9VA 3VNSA 4R0MA 2QVYX 2VSQA 3EERA 2AYAA 1XMOC 1QM4A 5IT9D 2WD9A 2YX1A 1PA4A 1UKKA 2NCLA 3GPCA 3E7WA 1HNXC 2BH1X 1MDFA 3PROC 4K0BA 5IWAC 3H2TA 2D28C 1YJ7A 4KTTA 2UXDC 4FTFA 1M6XC 4IZ6A 4KTVA 2DHMA 3I07A 4YHHC 4DV3C 1BA3A 4G36A 4R1LA 2XR1A 4DCUA 3R9XA 1IBMC 2D27A 4L7IA 1PG4A 4X64C 2Y27A 4DV5C 4RLFA 1P7LA 3JAMD 2OPLA 1KKGA 4L2ZA 5A1GA 3VNQA 3TDEA 4LFAC 3UX3A 3J81D 3NYQA 1USPA 2VQFC 3CW9A 5ADZA 1P4EA 4D4GA 1XMQC 4GKKC 4BBYA 4WS9A 3GR1A 4D57A 3DHVA 2E0GA 2E8FA 1IBLC 2QL8A 4DV1C 3NYRA 1FJGC 2P20A 4DUZC 5BR8C 4PHTA 2VQEC 4ZLPA 4B3SC 1XS3A 1T5DX 1XNQC 3I08A 3GR0A 2JNVA 5BURA 3CW8X 1NY8A 2KDNA 2BJOA 3DLPX 1N2FA 4X65C 2ZM6C 5BSVA 3NPDA 1N34C 4D4IA 1UWDA 4D56A 1O93A 3S82A 3VNRA 4DG8A 4DR1C 3L8CA 5KEIA 1PU1A 3DAYA 3LNVA 2UXBC 2UUBC 4ODJA 4JI1C 1FUGA 2E7GA 5BSRA 5BSWA 3LAXA 3O2EA 4PUGA 4MH4A 1O92A 1YGTA 2VZEA 2MM9A 1XRCA 4IR7A 3N54B 1M6XA 4JI6C 3EQ6A 4DUYC 3SO4A 5CZXA 3TR3A 2F4VC 2QW0X 1FLOA 1N33C 2EGTA 2UUAC 4PUIA 5BSMA 5JRHA 4DV6C 1MXCA 1TH5A 3L95X 5E7QA 3A4IA 1WCJA 2QVXX 2ASBA 4DV2C 4OXIA 4DCSA 4LE5A 2D1QA 3KXWA 2ZZMA 4DV4C 4JI3C 3K6RA 4I9FA 2ONFA 1HNZC 3PESA 3E7XA 2ZZNA 3RG2A 4JI7C 3J80D 4LFCC 4NXNC 1L2FA 1AMUA 2D7VA 3CQ1A 2Y4NA 3PBKA 5BUSA 1ML8A 2CXCA 4LF7C 1HNWC 3T1HC 3R44A 2D1SA 1XDXA 1NYEA 4FUQA 4DR5C 5A2QD 4RM2A 4GKJC 4NDNA 4HPVA 5KYTA 2P02A 3IEUA 4G1IA 4LF9C 4OX9C 3A26A 2KZFA 1WH9A 4JI2C 4JYAC 4JM1A 2DPLA 2P2BA 2E8CA 5K8FA 3CQ2A 2UU9C 4DCVA 4TPSB 2D1RA 5LCIA 5T8TA 4NOZA 1QWIA 4XX2A 2KZ0A 4LFBC 3IMLA 4ISBA 3UEBA 4LF5C 4RVNA 3NI2A 3OTOC 4WV3A 3R9WA 4MTNA 1MDBA 2PN2A 2HJGA 4OYCA 2OPLB 4RM3A 3FM7A 4B3MC 3LNOA 2P2MA 3RV2A 3GKUA 4DCTA 4R1MA 3T1YC 4JI5C 2P2FA 2PT7G 5DV9A 4FUTA 4DV7C 3UX2A 2P2JA 2UUCC 3TQIA 2OO4A 2PROA 3UZ0A 2ZTBA 3FCEA 3C5EA 4I9GA 2YWCA 4DR7C 1VEHA 1O90A 2HHHC 5A1IA 1RY2A 2D1TA 1LQLA 5K85A 5FLXD 2MCQA 2WP0C 4L4QA 1JOSA 2QVZX 5KYVA 1N32C 3AF5A 3LGXA 2Y4OA 4JI4C 5BUQA 3A9UA 3AF6A 5GTDA 1N36C 4DR4C 1VLAA 4NXMC 1XHJA 3TUFA 1MXAA 3CQ3A 1EGAA 3B7WA 4RVOA 4JI0C 4BCAA 1IBKC 4LF4C 2PG1E 4DR2C 4DR6C 2E8EA 3G7SA 4JV5C 2ATWA 4G37A 1XNRC 3A25A 2M5OA 5AE1A 5T8SA 3CJEA 1I94C 3IPLA 4GS5A 5A19A 1V25A 4DR3C 1V60A 1HR0C 2OBVA 4PZPA 1MD9A 4BC7A 1XRAA 2UXCC 5BSTA 2E5LC 4B3TC 4KHPC 1LCIA 3LUSA 1ZB8A 4BSZA 1ULTA 2YWBA 5BSUA 1XRBA 5CZVA 1MKYA 1RG9A 4GXQA 4DG9A 5IFIA 5H9UA 3ETOA 1HH2P 1IB8A 2CU6A 2MMAB 3ETCA 1ZB9A 4GXRA 1J5EC 4PUHA 1WF3A 1PG3A 2YCBA 4RMNA 5AE3A 2JMPA 4X62C 4X66C 4AQYC 4BC9A 5AE2A 5LMUC 4B3RC 4DV0C 1GPMA 4EATA 2M5HA 4PROC 4RLQA 1P4EC 1O9TA 1MXBA 1K0RA 2Z51A 4U5YD 4JI8C 4LF6C 3UOWA 3FCCA 3IEVA 3J7AD 2CY1A 4ZJZA 4LF8C 4K0KC 1USPB 4YY3C 1V26A 2P2QA 2DYJA 2V7BA
chains in the Genus database with same CATH topology
3N2QA 1T5HX 5LMNC 3A9VA 3VNSA 4R0MA 2QVYX 2VSQA 3EERA 2AYAA 1XMOC 1QM4A 5IT9D 2WD9A 1PA4A 1UKKA 3GPCA 3E7WA 1HNXC 2BH1X 1MDFA 3PROC 4K0BA 5IWAC 3H2TA 2D28C 1YJ7A 4KTTA 2UXDC 4FTFA 4IZ6A 4KTVA 3I07A 4YHHC 4DV3C 1BA3A 4G36A 4R1LA 2XR1A 4DCUA 3R9XA 1IBMC 2D27A 4L7IA 1PG4A 4X64C 2Y27A 4DV5C 4RLFA 1P7LA 3JAMD 2OPLA 1KKGA 4L2ZA 5A1GA 3VNQA 3TDEA 4LFAC 3J81D 3NYQA 1USPA 2VQFC 3CW9A 5ADZA 4D4GA 1XMQC 4GKKC 4BBYA 4WS9A 3GR1A 4D57A 3DHVA 2E0GA 2E8FA 1IBLC 2QL8A 4DV1C 3NYRA 1FJGC 2P20A 4DUZC 5BR8C 4PHTA 2VQEC 4ZLPA 4B3SC 1T5DX 1XNQC 3I08A 3GR0A 5BURA 3CW8X 2BJOA 3DLPX 1N2FA 4X65C 2ZM6C 5BSVA 3NPDA 1N34C 4D4IA 4D56A 1O93A 3S82A 3VNRA 4DG8A 4DR1C 3L8CA 5KEIA 3DAYA 3LNVA 2UXBC 2UUBC 4ODJA 4JI1C 1FUGA 2E7GA 5BSRA 5BSWA 3LAXA 4MH4A 1O92A 2VZEA 1XRCA 4IR7A 3N54B 4JI6C 3EQ6A 4DUYC 3SO4A 5CZXA 2F4VC 2QW0X 1N33C 2EGTA 2UUAC 5BSMA 5JRHA 4DV6C 1MXCA 3L95X 5E7QA 3A4IA 2QVXX 2ASBA 4DV2C 4OXIA 4DCSA 4LE5A 2D1QA 3KXWA 4DV4C 4JI3C 4I9FA 2ONFA 1HNZC 3PESA 3E7XA 3RG2A 4JI7C 3J80D 4LFCC 4NXNC 1L2FA 1AMUA 2D7VA 2Y4NA 3PBKA 5BUSA 1ML8A 2CXCA 4LF7C 1HNWC 3T1HC 3R44A 2D1SA 1NYEA 4FUQA 4DR5C 5A2QD 4RM2A 4GKJC 4NDNA 4HPVA 5KYTA 2P02A 3IEUA 4G1IA 4LF9C 4OX9C 2KZFA 1WH9A 4JI2C 4JYAC 4JM1A 2DPLA 2P2BA 2E8CA 5K8FA 2UU9C 4DCVA 4TPSB 2D1RA 5T8TA 4NOZA 1QWIA 4XX2A 4LFBC 3IMLA 4ISBA 4LF5C 4RVNA 3NI2A 3OTOC 4WV3A 3R9WA 4MTNA 1MDBA 2PN2A 2HJGA 4OYCA 2OPLB 4RM3A 4B3MC 2P2MA 3RV2A 3GKUA 4DCTA 4R1MA 3T1YC 4JI5C 2P2FA 2PT7G 5DV9A 4FUTA 4DV7C 2P2JA 2UUCC 3TQIA 2OO4A 2PROA 3UZ0A 3FCEA 3C5EA 4I9GA 2YWCA 4DR7C 1O90A 2HHHC 5A1IA 1RY2A 2D1TA 1LQLA 5K85A 5FLXD 2WP0C 4L4QA 1JOSA 2QVZX 5KYVA 1N32C 3AF5A 3LGXA 2Y4OA 4JI4C 5BUQA 3A9UA 3AF6A 5GTDA 1N36C 4DR4C 1VLAA 4NXMC 3TUFA 1MXAA 1EGAA 3B7WA 4RVOA 4JI0C 4BCAA 1IBKC 4LF4C 4DR2C 4DR6C 2E8EA 3G7SA 4JV5C 2ATWA 4G37A 1XNRC 5AE1A 5T8SA 3CJEA 1I94C 3IPLA 4GS5A 5A19A 1V25A 4DR3C 1HR0C 2OBVA 4PZPA 1MD9A 4BC7A 1XRAA 2UXCC 5BSTA 2E5LC 4B3TC 4KHPC 1LCIA 3LUSA 1ZB8A 4BSZA 1ULTA 2YWBA 5BSUA 1XRBA 5CZVA 1MKYA 1RG9A 4GXQA 4DG9A 5IFIA 5H9UA 3ETOA 1HH2P 3ETCA 1ZB9A 4GXRA 1J5EC 1WF3A 1PG3A 2YCBA 4RMNA 5AE3A 2JMPA 4X62C 4X66C 4AQYC 4BC9A 5AE2A 5LMUC 4B3RC 4DV0C 1GPMA 4EATA 4PROC 4RLQA 1O9TA 1MXBA 1K0RA 4U5YD 4JI8C 4LF6C 3UOWA 3FCCA 3IEVA 3J7AD 2CY1A 4ZJZA 4LF8C 4K0KC 1USPB 4YY3C 1V26A 2P2QA 2DYJA 2V7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN C;  1XNQ C;  1N32 C;  3AF5 A;  1ML8 A;  2CXC A;  4JI4 C;  3AF6 A;  1N36 C;  4DR4 C;  4LF7 C;  1HNW C;  3T1H C;  2BJO A;  1N2F A;  1VLA A;  4X65 C;  4NXM C;  2ZM6 C;  1NYE A;  1N34 C;  1EGA A;  4JI0 C;  1IBK C;  4LF4 C;  4DR2 C;  4DR5 C;  2E8E A;  4DR1 C;  3EER A;  5A2Q D;  4DR6 C;  4GKJ C;  1XMO C;  3IEU A;  5IT9 D;  2UXB C;  2UUB C;  4JV5 C;  4LF9 C;  4JI1 C;  4OX9 C;  2ATW A;  1XNR C;  2KZF A;  1PA4 A;  1WH9 A;  2E7G A;  1UKK A;  3CJE A;  1I94 C;  4JI2 C;  4JYA C;  1HNX C;  4MH4 A;  2E8C A;  4DR3 C;  2UU9 C;  4DCV A;  5IWA C;  1HR0 C;  4NOZ A;  1QWI A;  4XX2 A;  4LFB C;  2UXD C;  4JI6 C;  2E5L C;  2UXC C;  4B3T C;  4DUY C;  4KHP C;  3I07 A;  3LUS A;  1ZB8 A;  4BSZ A;  4LF5 C;  4YHH C;  4DV3 C;  1MKY A;  3OTO C;  2XR1 A;  1N33 C;  4DCU A;  3R9X A;  3R9W A;  2EGT A;  1IBM C;  4MTN A;  2UUA C;  2PN2 A;  2HJG A;  1HH2 P;  4X64 C;  2OPL B;  4DV6 C;  4DV5 C;  1ZB9 A;  4B3M C;  1J5E C;  1WF3 A;  3GKU A;  4DCT A;  3JAM D;  2YCB A;  3T1Y C;  4JI5 C;  2OPL A;  2PT7 G;  2JMP A;  1KKG A;  4X62 C;  4DV7 C;  4X66 C;  4AQY C;  4LFA C;  3J81 D;  2UUC C;  2ASB A;  1USP A;  5LMU C;  4B3R C;  4DV0 C;  4DV2 C;  2VQF C;  4DCS A;  1XMQ C;  4GKK C;  1K0R A;  4DR7 C;  4JI8 C;  4DV4 C;  4JI3 C;  2HHH C;  4LF6 C;  2ONF A;  2E8F A;  3IEV A;  1LQL A;  3J7A D;  1IBL C;  1HNZ C;  2CY1 A;  2QL8 A;  4DV1 C;  4LF8 C;  4K0K C;  1FJG C;  5FLX D;  1USP B;  5BR8 C;  3J80 D;  4DUZ C;  1L2F A;  4YY3 C;  4JI7 C;  4LFC C;  2VQE C;  4NXN C;  2D7V A;  4B3S C;  1JOS A;  2DYJ A;  2F4V C; 
#chains in the Genus database with same CATH topology
 3N2Q A;  1T5H X;  5LMN C;  3AY0 A;  3A9V A;  3VNS A;  4R0M A;  2QVY X;  2VSQ A;  3EER A;  2AYA A;  1XMO C;  1QM4 A;  5IT9 D;  2WD9 A;  2YX1 A;  1PA4 A;  1UKK A;  2NCL A;  3GPC A;  3E7W A;  1HNX C;  2BH1 X;  1MDF A;  3PRO C;  4K0B A;  5IWA C;  3H2T A;  2D28 C;  1YJ7 A;  4KTT A;  2UXD C;  4FTF A;  1M6X C;  4IZ6 A;  4KTV A;  2DHM A;  3I07 A;  4YHH C;  4DV3 C;  1BA3 A;  4G36 A;  4R1L A;  2XR1 A;  4DCU A;  3R9X A;  1IBM C;  2D27 A;  4L7I A;  1PG4 A;  4X64 C;  2Y27 A;  4DV5 C;  4RLF A;  1P7L A;  3JAM D;  2OPL A;  1KKG A;  4L2Z A;  5A1G A;  3VNQ A;  3TDE A;  4LFA C;  3UX3 A;  3J81 D;  3NYQ A;  1USP A;  2VQF C;  3CW9 A;  5ADZ A;  1P4E A;  4D4G A;  1XMQ C;  4GKK C;  4BBY A;  4WS9 A;  3GR1 A;  4D57 A;  3DHV A;  2E0G A;  2E8F A;  1IBL C;  2QL8 A;  4DV1 C;  3NYR A;  1FJG C;  2P20 A;  4DUZ C;  5BR8 C;  4PHT A;  2VQE C;  4ZLP A;  4B3S C;  1XS3 A;  1T5D X;  1XNQ C;  3I08 A;  3GR0 A;  2JNV A;  5BUR A;  3CW8 X;  1NY8 A;  2KDN A;  2BJO A;  3DLP X;  1N2F A;  4X65 C;  2ZM6 C;  5BSV A;  3NPD A;  1N34 C;  4D4I A;  1UWD A;  4D56 A;  1O93 A;  3S82 A;  3VNR A;  4DG8 A;  4DR1 C;  3L8C A;  5KEI A;  1PU1 A;  3DAY A;  3LNV A;  2UXB C;  2UUB C;  4ODJ A;  4JI1 C;  1FUG A;  2E7G A;  5BSR A;  5BSW A;  3LAX A;  3O2E A;  4PUG A;  4MH4 A;  1O92 A;  1YGT A;  2VZE A;  2MM9 A;  1XRC A;  4IR7 A;  3N54 B;  1M6X A;  4JI6 C;  3EQ6 A;  4DUY C;  3SO4 A;  5CZX A;  3TR3 A;  2F4V C;  2QW0 X;  1FLO A;  1N33 C;  2EGT A;  2UUA C;  4PUI A;  5BSM A;  5JRH A;  4DV6 C;  1MXC A;  1TH5 A;  3L95 X;  5E7Q A;  3A4I A;  1WCJ A;  2QVX X;  2ASB A;  4DV2 C;  4OXI A;  4DCS A;  4LE5 A;  2D1Q A;  3KXW A;  2ZZM A;  4DV4 C;  4JI3 C;  3K6R A;  4I9F A;  2ONF A;  1HNZ C;  3PES A;  3E7X A;  2ZZN A;  3RG2 A;  4JI7 C;  3J80 D;  4LFC C;  4NXN C;  1L2F A;  1AMU A;  2D7V A;  3CQ1 A;  2Y4N A;  3PBK A;  5BUS A;  1ML8 A;  2CXC A;  4LF7 C;  1HNW C;  3T1H C;  3R44 A;  2D1S A;  1XDX A;  1NYE A;  4FUQ A;  4DR5 C;  5A2Q D;  4RM2 A;  4GKJ C;  4NDN A;  4HPV A;  5KYT A;  2P02 A;  3IEU A;  4G1I A;  4LF9 C;  4OX9 C;  3A26 A;  2KZF A;  1WH9 A;  4JI2 C;  4JYA C;  4JM1 A;  2DPL A;  2P2B A;  2E8C A;  5K8F A;  3CQ2 A;  2UU9 C;  4DCV A;  4TPS B;  2D1R A;  5LCI A;  5T8T A;  4NOZ A;  1QWI A;  4XX2 A;  2KZ0 A;  4LFB C;  3IML A;  4ISB A;  3UEB A;  4LF5 C;  4RVN A;  3NI2 A;  3OTO C;  4WV3 A;  3R9W A;  4MTN A;  1MDB A;  2PN2 A;  2HJG A;  4OYC A;  2OPL B;  4RM3 A;  3FM7 A;  4B3M C;  3LNO A;  2P2M A;  3RV2 A;  3GKU A;  4DCT A;  4R1M A;  3T1Y C;  4JI5 C;  2P2F A;  2PT7 G;  5DV9 A;  4FUT A;  4DV7 C;  3UX2 A;  2P2J A;  2UUC C;  3TQI A;  2OO4 A;  2PRO A;  3UZ0 A;  2ZTB A;  3FCE A;  3C5E A;  4I9G A;  2YWC A;  4DR7 C;  1VEH A;  1O90 A;  2HHH C;  5A1I A;  1RY2 A;  2D1T A;  1LQL A;  5K85 A;  5FLX D;  2MCQ A;  2WP0 C;  4L4Q A;  1JOS A;  2QVZ X;  5KYV A;  1N32 C;  3AF5 A;  3LGX A;  2Y4O A;  4JI4 C;  5BUQ A;  3A9U A;  3AF6 A;  5GTD A;  1N36 C;  4DR4 C;  1VLA A;  4NXM C;  1XHJ A;  3TUF A;  1MXA A;  3CQ3 A;  1EGA A;  3B7W A;  4RVO A;  4JI0 C;  4BCA A;  1IBK C;  4LF4 C;  2PG1 E;  4DR2 C;  4DR6 C;  2E8E A;  3G7S A;  4JV5 C;  2ATW A;  4G37 A;  1XNR C;  3A25 A;  2M5O A;  5AE1 A;  5T8S A;  3CJE A;  1I94 C;  3IPL A;  4GS5 A;  5A19 A;  1V25 A;  4DR3 C;  1V60 A;  1HR0 C;  2OBV A;  4PZP A;  1MD9 A;  4BC7 A;  1XRA A;  2UXC C;  5BST A;  2E5L C;  4B3T C;  4KHP C;  1LCI A;  3LUS A;  1ZB8 A;  4BSZ A;  1ULT A;  2YWB A;  5BSU A;  1XRB A;  5CZV A;  1MKY A;  1RG9 A;  4GXQ A;  4DG9 A;  5IFI A;  5H9U A;  3ETO A;  1HH2 P;  1IB8 A;  2CU6 A;  2MMA B;  3ETC A;  1ZB9 A;  4GXR A;  1J5E C;  4PUH A;  1WF3 A;  1PG3 A;  2YCB A;  4RMN A;  5AE3 A;  2JMP A;  4X62 C;  4X66 C;  4AQY C;  4BC9 A;  5AE2 A;  5LMU C;  4B3R C;  4DV0 C;  1GPM A;  4EAT A;  2M5H A;  4PRO C;  4RLQ A;  1P4E C;  1O9T A;  1MXB A;  1K0R A;  2Z51 A;  4U5Y D;  4JI8 C;  4LF6 C;  3UOW A;  3FCC A;  3IEV A;  3J7A D;  2CY1 A;  4ZJZ A;  4LF8 C;  4K0K C;  1USP B;  4YY3 C;  1V26 A;  2P2Q A;  2DYJ A;  2V7B A; 
#chains in the Genus database with same CATH homology
 3N2Q A;  1T5H X;  5LMN C;  3A9V A;  3VNS A;  4R0M A;  2QVY X;  2VSQ A;  3EER A;  2AYA A;  1XMO C;  1QM4 A;  5IT9 D;  2WD9 A;  1PA4 A;  1UKK A;  3GPC A;  3E7W A;  1HNX C;  2BH1 X;  1MDF A;  3PRO C;  4K0B A;  5IWA C;  3H2T A;  2D28 C;  1YJ7 A;  4KTT A;  2UXD C;  4FTF A;  4IZ6 A;  4KTV A;  3I07 A;  4YHH C;  4DV3 C;  1BA3 A;  4G36 A;  4R1L A;  2XR1 A;  4DCU A;  3R9X A;  1IBM C;  2D27 A;  4L7I A;  1PG4 A;  4X64 C;  2Y27 A;  4DV5 C;  4RLF A;  1P7L A;  3JAM D;  2OPL A;  1KKG A;  4L2Z A;  5A1G A;  3VNQ A;  3TDE A;  4LFA C;  3J81 D;  3NYQ A;  1USP A;  2VQF C;  3CW9 A;  5ADZ A;  4D4G A;  1XMQ C;  4GKK C;  4BBY A;  4WS9 A;  3GR1 A;  4D57 A;  3DHV A;  2E0G A;  2E8F A;  1IBL C;  2QL8 A;  4DV1 C;  3NYR A;  1FJG C;  2P20 A;  4DUZ C;  5BR8 C;  4PHT A;  2VQE C;  4ZLP A;  4B3S C;  1T5D X;  1XNQ C;  3I08 A;  3GR0 A;  5BUR A;  3CW8 X;  2BJO A;  3DLP X;  1N2F A;  4X65 C;  2ZM6 C;  5BSV A;  3NPD A;  1N34 C;  4D4I A;  4D56 A;  1O93 A;  3S82 A;  3VNR A;  4DG8 A;  4DR1 C;  3L8C A;  5KEI A;  3DAY A;  3LNV A;  2UXB C;  2UUB C;  4ODJ A;  4JI1 C;  1FUG A;  2E7G A;  5BSR A;  5BSW A;  3LAX A;  4MH4 A;  1O92 A;  2VZE A;  1XRC A;  4IR7 A;  3N54 B;  4JI6 C;  3EQ6 A;  4DUY C;  3SO4 A;  5CZX A;  2F4V C;  2QW0 X;  1N33 C;  2EGT A;  2UUA C;  5BSM A;  5JRH A;  4DV6 C;  1MXC A;  3L95 X;  5E7Q A;  3A4I A;  2QVX X;  2ASB A;  4DV2 C;  4OXI A;  4DCS A;  4LE5 A;  2D1Q A;  3KXW A;  4DV4 C;  4JI3 C;  4I9F A;  2ONF A;  1HNZ C;  3PES A;  3E7X A;  3RG2 A;  4JI7 C;  3J80 D;  4LFC C;  4NXN C;  1L2F A;  1AMU A;  2D7V A;  2Y4N A;  3PBK A;  5BUS A;  1ML8 A;  2CXC A;  4LF7 C;  1HNW C;  3T1H C;  3R44 A;  2D1S A;  1NYE A;  4FUQ A;  4DR5 C;  5A2Q D;  4RM2 A;  4GKJ C;  4NDN A;  4HPV A;  5KYT A;  2P02 A;  3IEU A;  4G1I A;  4LF9 C;  4OX9 C;  2KZF A;  1WH9 A;  4JI2 C;  4JYA C;  4JM1 A;  2DPL A;  2P2B A;  2E8C A;  5K8F A;  2UU9 C;  4DCV A;  4TPS B;  2D1R A;  5T8T A;  4NOZ A;  1QWI A;  4XX2 A;  4LFB C;  3IML A;  4ISB A;  4LF5 C;  4RVN A;  3NI2 A;  3OTO C;  4WV3 A;  3R9W A;  4MTN A;  1MDB A;  2PN2 A;  2HJG A;  4OYC A;  2OPL B;  4RM3 A;  4B3M C;  2P2M A;  3RV2 A;  3GKU A;  4DCT A;  4R1M A;  3T1Y C;  4JI5 C;  2P2F A;  2PT7 G;  5DV9 A;  4FUT A;  4DV7 C;  2P2J A;  2UUC C;  3TQI A;  2OO4 A;  2PRO A;  3UZ0 A;  3FCE A;  3C5E A;  4I9G A;  2YWC A;  4DR7 C;  1O90 A;  2HHH C;  5A1I A;  1RY2 A;  2D1T A;  1LQL A;  5K85 A;  5FLX D;  2WP0 C;  4L4Q A;  1JOS A;  2QVZ X;  5KYV A;  1N32 C;  3AF5 A;  3LGX A;  2Y4O A;  4JI4 C;  5BUQ A;  3A9U A;  3AF6 A;  5GTD A;  1N36 C;  4DR4 C;  1VLA A;  4NXM C;  3TUF A;  1MXA A;  1EGA A;  3B7W A;  4RVO A;  4JI0 C;  4BCA A;  1IBK C;  4LF4 C;  4DR2 C;  4DR6 C;  2E8E A;  3G7S A;  4JV5 C;  2ATW A;  4G37 A;  1XNR C;  5AE1 A;  5T8S A;  3CJE A;  1I94 C;  3IPL A;  4GS5 A;  5A19 A;  1V25 A;  4DR3 C;  1HR0 C;  2OBV A;  4PZP A;  1MD9 A;  4BC7 A;  1XRA A;  2UXC C;  5BST A;  2E5L C;  4B3T C;  4KHP C;  1LCI A;  3LUS A;  1ZB8 A;  4BSZ A;  1ULT A;  2YWB A;  5BSU A;  1XRB A;  5CZV A;  1MKY A;  1RG9 A;  4GXQ A;  4DG9 A;  5IFI A;  5H9U A;  3ETO A;  1HH2 P;  3ETC A;  1ZB9 A;  4GXR A;  1J5E C;  1WF3 A;  1PG3 A;  2YCB A;  4RMN A;  5AE3 A;  2JMP A;  4X62 C;  4X66 C;  4AQY C;  4BC9 A;  5AE2 A;  5LMU C;  4B3R C;  4DV0 C;  1GPM A;  4EAT A;  4PRO C;  4RLQ A;  1O9T A;  1MXB A;  1K0R A;  4U5Y D;  4JI8 C;  4LF6 C;  3UOW A;  3FCC A;  3IEV A;  3J7A D;  2CY1 A;  4ZJZ A;  4LF8 C;  4K0K C;  1USP B;  4YY3 C;  1V26 A;  2P2Q A;  2DYJ A;  2V7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...