4JYAC

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jyaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4jyaC02
5A2QD 1ML8A 4YY3C 2YCBA 4JI7C 2CY1A 1JOSA 1USPB 4NXMC 4LF8C 3T1YC 4X64C 4JI2C 2BJOA 4JI1C 5LMUC 4BSZA 1N34C 4LF4C 4DV1C 3I07A 4LF9C 2HJGA 3CJEA 1VLAA 2E8FA 1LQLA 4DR1C 1XMOC 2HHHC 1EGAA 1ZB9A 4LF6C 4DR2C 4DCSA 2D7VA 1PA4A 4NOZA 4LFCC 1QWIA 2F4VC 2ASBA 3JAMD 3LUSA 1IBLC 4DUZC 1I94C 2VQEC 1N2FA 2ONFA 4DCUA 1XMQC 1HNWC 2QL8A 5FLXD 1FJGC 3IEUA 1HNXC 2UU9C 3AF6A 4JV5C 4JI3C 1XNQC 3J80D 4GKJC 1NYEA 4MH4A 2UUAC 3R9WA 1WH9A 4JI5C 4GKKC 4LF7C 4JI8C 3OTOC 3J81D 2OPLA 1N36C 1WF3A 2UUCC 4DR3C 4DV3C 4JI4C 1USPA 1IBMC 4AQYC 5BR8C 4MTNA 2E7GA 4DR6C 2DYJA 2VQFC 4DCVA 1KKGA 1ZB8A 4DV4C 5LMNC 2OPLB 4DV7C 5IT9D 2EGTA 3J7AD 1UKKA 4B3SC 3R9XA 2UXCC 2KZFA 4DR4C 4KHPC 2UXBC 4LFAC 3EERA 3AF5A 2UUBC 4LFBC 4JYAC 4X66C 4YHHC 2UXDC 4JI6C 2ZM6C 2E8CA 1IBKC 3GKUA 1N33C 4JI0C 1HNZC 4B3RC 2PT7G 4DR5C 4DUYC 4DV6C 4K0KC 4DCTA 1MKYA 2PN2A 1K0RA 4DR7C 1HR0C 1HH2P 4DV5C 2JMPA 5IWAC 4B3TC 3IEVA 4LF5C 4B3MC 4X65C 4NXNC 1J5EC 2ATWA 4X62C 1N32C 4XX2A 4DV0C 1L2FA 1XNRC 2CXCA 2E8EA 2XR1A 3T1HC 4OX9C 2E5LC 4DV2C
chains in the Genus database with same CATH superfamily
5A2QD 5T8SA 5BUQA 2YCBA 2Y4OA 5BSRA 2CY1A 3T1YC 4FUQA 4BC7A 5LMUC 2MMAB 1ULTA 4LF9C 3CJEA 3R44A 4L2ZA 2WD9A 2E8FA 3RV2A 1XMOC 2HHHC 4LF6C 1PA4A 4WS9A 4U5YD 1QWIA 2F4VC 1IBLC 2BH1X 5A19A 3ETCA 1XS3A 1RY2A 3CW8X 2VQEC 2QW0X 4D4IA 5FLXD 5AE2A 1VEHA 2ZZMA 5AE1A 4JI3C 3J80D 1PU1A 4GKJC 4MH4A 3R9WA 3O2EA 4FTFA 4LF7C 3OTOC 5BURA 3J81D 2Y27A 1N36C 1WF3A 4DR3C 3DLPX 1USPA 3A9VA 4G36A 2ZTBA 1MDBA 2VQFC 5LMNC 5KEIA 3DHVA 3VNRA 4KTTA 1MXBA 2YWCA 1UKKA 4B3SC 3GR1A 3R9XA 2M5OA 1PG4A 2P2BA 2UUBC 2P2QA 4JI6C 2E8CA 3GKUA 4B3RC 4PUHA 4DR5C 4DUYC 1MKYA 4RVNA 3E7WA 1M6XC 5ADZA 2DPLA 1HH2P 4GS5A 4DV5C 2JMPA 2NCLA 2P2JA 4LF5C 5KYVA 2V7BA 3B7WA 1NY8A 1TH5A 4DV0C 2YX1A 1O93A 4RLQA 3T1HC 3FM7A 4OX9C 1IB8A 1O92A 4D4GA 4RMNA 4DV2C 1YGTA 3NPDA 4LF8C 2BJOA 4JI1C 4BSZA 4LF4C 4DV1C 3I07A 2HJGA 1VLAA 4PUIA 2YWBA 3LNVA 2D7VA 3L8CA 4BCAA 1P4EA 4JM1A 3LNOA 3K6RA 3UX3A 2QVXX 2KDNA 3JAMD 4PHTA 4FUTA 1I94C 3TDEA 3EQ6A 5H9UA 1HNWC 5BSVA 5CZXA 3UEBA 4WV3A 3FCEA 2P2FA 3TQIA 5K8FA 1FLOA 2UU9C 4D57A 5AE3A 1XNQC 3LGXA 5BUSA 1T5DX 1M6XA 4GKKC 4PZPA 4JI8C 2D1RA 1V26A 2OPLA 3KXWA 1O90A 5DV9A 4ZLPA 4ISBA 1LCIA 4G1IA 4ZJZA 2DYJA 2AYAA 2VSQA 2E0GA 2Z51A 4RVOA 4ODJA 2PG1E 4BC9A 5T8TA 4DR4C 4G37A 4KHPC 2UXBC 3EERA 4JYAC 4LFBC 4PROC 3LAXA 3A25A 4I9FA 1N33C 3CQ3A 4JI0C 1WCJA 1AMUA 2Y4NA 4K0KC 3NYRA 2MCQA 1P4EC 1MXAA 4DG9A 1HR0C 4GXRA 1UWDA 4B3TC 2DHMA 3I08A 4NXNC 5JRHA 1XHJA 4X62C 4IR7A 3A26A 2CXCA 2XR1A 5KYTA 2P02A 1XDXA 4RM3A 4YY3C 4BBYA 4JI7C 5E7QA 4NDNA 4JI2C 2P20A 4GXQA 1N34C 4KTVA 5BSWA 1P7LA 3UOWA 4DR1C 1ZB9A 2VZEA 4DG8A 4LFCC 2ASBA 4L4QA 3LUSA 1T5HX 2D1SA 1XMQC 2QVZX 3VNQA 1FJGC 1HNXC 3AF6A 1YJ7A 2QVYX 2UUAC 1WH9A 4JI5C 1MD9A 2ZZNA 1RG9A 4DV3C 4JI4C 1XRBA 5BSMA 2D27A 5BR8C 4AQYC 2E7GA 4DR6C 2D1QA 1MDFA 5LCIA 2WP0C 1KKGA 5IFIA 1ZB8A 3PESA 4DV4C 3A9UA 1QM4A 1V25A 1XRCA 5IT9D 3J7AD 3N2QA 4R0MA 2UXCC 2KZFA 3AF5A 4RLFA 4LE5A 2UXDC 4L7IA 3SO4A 3AY0A 1IBKC 2OBVA 1HNZC 3TUFA 4TPSB 2PN2A 2D1TA 3C5EA 4DR7C 4I9GA 3A4IA 3NYQA 5IWAC 3IEVA 4D56A 5GTDA 3DAYA 1GPMA 1FUGA 1N32C 4XX2A 2CU6A 1XNRC 3FCCA 4IZ6A 4R1LA 2E5LC 3NI2A 4K0BA 3UX2A 5A1GA 1ML8A 2D28C 1JOSA 1O9TA 1USPB 4NXMC 3S82A 4X64C 3VNSA 3GPCA 5K85A 1LQLA 1EGAA 4DR2C 4DCSA 4NOZA 3CW9A 5A1IA 5BSUA 4DUZC 1N2FA 2ONFA 4OYCA 4DCUA 2QL8A 3G7SA 2MM9A 5BSTA 3IEUA 3L95X 2PROA 4JV5C 3N54B 4PUGA 1NYEA 2M5HA 4R1MA 1V60A 3TR3A 2JNVA 2UUCC 3PROC 4HPVA 1MXCA 1IBMC 3CQ2A 3IMLA 4MTNA 2P2MA 4DCVA 2KZ0A 4EATA 2OPLB 4DV7C 2EGTA 3GR0A 4LFAC 3RG2A 3E7XA 4X66C 4YHHC 1XRAA 3CQ1A 1PG3A 2ZM6C 2PT7G 4DV6C 5CZVA 4DCTA 3H2TA 1K0RA 3PBKA 3IPLA 2OO4A 4B3MC 4X65C 1J5EC 2ATWA 1L2FA 2E8EA 3UZ0A 3ETOA 1BA3A 4RM2A 4OXIA
chains in the Genus database with same CATH topology
5A2QD 5T8SA 5BUQA 2YCBA 2Y4OA 5BSRA 2CY1A 3T1YC 4FUQA 4BC7A 5LMUC 1ULTA 4LF9C 3CJEA 3R44A 4L2ZA 2WD9A 2E8FA 3RV2A 1XMOC 2HHHC 4LF6C 1PA4A 4WS9A 4U5YD 1QWIA 2F4VC 1IBLC 2BH1X 5A19A 3ETCA 1RY2A 3CW8X 2VQEC 2QW0X 4D4IA 5FLXD 5AE2A 5AE1A 4JI3C 3J80D 4GKJC 4MH4A 3R9WA 4FTFA 4LF7C 3OTOC 5BURA 3J81D 2Y27A 1N36C 1WF3A 4DR3C 3DLPX 1USPA 3A9VA 4G36A 1MDBA 2VQFC 5LMNC 5KEIA 3DHVA 3VNRA 4KTTA 1MXBA 2YWCA 1UKKA 4B3SC 3GR1A 3R9XA 1PG4A 2P2BA 2UUBC 2P2QA 4JI6C 2E8CA 3GKUA 4B3RC 4DR5C 4DUYC 1MKYA 4RVNA 3E7WA 5ADZA 2DPLA 1HH2P 4GS5A 4DV5C 2JMPA 2P2JA 4LF5C 5KYVA 2V7BA 3B7WA 4DV0C 1O93A 4RLQA 3T1HC 4OX9C 1O92A 4D4GA 4RMNA 4DV2C 3NPDA 4LF8C 2BJOA 4JI1C 4BSZA 4LF4C 4DV1C 3I07A 2HJGA 1VLAA 2YWBA 3LNVA 2D7VA 3L8CA 4BCAA 4JM1A 2QVXX 3JAMD 4PHTA 4FUTA 1I94C 3TDEA 3EQ6A 5H9UA 1HNWC 5BSVA 5CZXA 4WV3A 3FCEA 2P2FA 3TQIA 5K8FA 2UU9C 4D57A 5AE3A 1XNQC 3LGXA 5BUSA 1T5DX 4GKKC 4PZPA 4JI8C 2D1RA 1V26A 2OPLA 3KXWA 1O90A 5DV9A 4ZLPA 4ISBA 1LCIA 4G1IA 4ZJZA 2DYJA 2AYAA 2VSQA 2E0GA 4RVOA 4ODJA 4BC9A 5T8TA 4DR4C 4G37A 4KHPC 2UXBC 3EERA 4JYAC 4LFBC 4PROC 3LAXA 4I9FA 1N33C 4JI0C 1AMUA 2Y4NA 4K0KC 3NYRA 1MXAA 4DG9A 1HR0C 4GXRA 4B3TC 3I08A 4NXNC 5JRHA 4X62C 4IR7A 2CXCA 2XR1A 5KYTA 2P02A 4RM3A 4YY3C 4BBYA 4JI7C 5E7QA 4NDNA 4JI2C 2P20A 4GXQA 1N34C 4KTVA 5BSWA 1P7LA 3UOWA 4DR1C 1ZB9A 2VZEA 4DG8A 4LFCC 2ASBA 4L4QA 3LUSA 1T5HX 2D1SA 1XMQC 2QVZX 3VNQA 1FJGC 1HNXC 3AF6A 1YJ7A 2QVYX 2UUAC 1WH9A 4JI5C 1MD9A 1RG9A 4DV3C 4JI4C 1XRBA 5BSMA 2D27A 5BR8C 4AQYC 2E7GA 4DR6C 2D1QA 1MDFA 2WP0C 1KKGA 5IFIA 1ZB8A 3PESA 4DV4C 3A9UA 1QM4A 1V25A 1XRCA 5IT9D 3J7AD 3N2QA 4R0MA 2UXCC 2KZFA 3AF5A 4RLFA 4LE5A 2UXDC 4L7IA 3SO4A 1IBKC 2OBVA 1HNZC 3TUFA 4TPSB 2PN2A 2D1TA 3C5EA 4DR7C 4I9GA 3A4IA 3NYQA 5IWAC 3IEVA 4D56A 5GTDA 3DAYA 1GPMA 1FUGA 1N32C 4XX2A 1XNRC 3FCCA 4IZ6A 4R1LA 2E5LC 3NI2A 4K0BA 5A1GA 1ML8A 2D28C 1JOSA 1O9TA 1USPB 4NXMC 3S82A 4X64C 3VNSA 3GPCA 5K85A 1LQLA 1EGAA 4DR2C 4DCSA 4NOZA 3CW9A 5A1IA 5BSUA 4DUZC 1N2FA 2ONFA 4OYCA 4DCUA 2QL8A 3G7SA 5BSTA 3IEUA 3L95X 2PROA 4JV5C 3N54B 1NYEA 4R1MA 2UUCC 3PROC 4HPVA 1MXCA 1IBMC 3IMLA 4MTNA 2P2MA 4DCVA 4EATA 2OPLB 4DV7C 2EGTA 3GR0A 4LFAC 3RG2A 3E7XA 4X66C 4YHHC 1XRAA 1PG3A 2ZM6C 2PT7G 4DV6C 5CZVA 4DCTA 3H2TA 1K0RA 3PBKA 3IPLA 2OO4A 4B3MC 4X65C 1J5EC 2ATWA 1L2FA 2E8EA 3UZ0A 3ETOA 1BA3A 4RM2A 4OXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q D;  1ML8 A;  4YY3 C;  2YCB A;  4JI7 C;  2CY1 A;  1JOS A;  1USP B;  4NXM C;  4LF8 C;  3T1Y C;  4X64 C;  4JI2 C;  2BJO A;  4JI1 C;  5LMU C;  4BSZ A;  1N34 C;  4LF4 C;  4DV1 C;  3I07 A;  4LF9 C;  2HJG A;  3CJE A;  1VLA A;  2E8F A;  1LQL A;  4DR1 C;  1XMO C;  2HHH C;  1EGA A;  1ZB9 A;  4LF6 C;  4DR2 C;  4DCS A;  2D7V A;  1PA4 A;  4NOZ A;  4LFC C;  1QWI A;  2F4V C;  2ASB A;  3JAM D;  3LUS A;  1IBL C;  4DUZ C;  1I94 C;  2VQE C;  1N2F A;  2ONF A;  4DCU A;  1XMQ C;  1HNW C;  2QL8 A;  5FLX D;  1FJG C;  3IEU A;  1HNX C;  2UU9 C;  3AF6 A;  4JV5 C;  4JI3 C;  1XNQ C;  3J80 D;  4GKJ C;  1NYE A;  4MH4 A;  2UUA C;  3R9W A;  1WH9 A;  4JI5 C;  4GKK C;  4LF7 C;  4JI8 C;  3OTO C;  3J81 D;  2OPL A;  1N36 C;  1WF3 A;  2UUC C;  4DR3 C;  4DV3 C;  4JI4 C;  1USP A;  1IBM C;  4AQY C;  5BR8 C;  4MTN A;  2E7G A;  4DR6 C;  2DYJ A;  2VQF C;  4DCV A;  1KKG A;  1ZB8 A;  4DV4 C;  5LMN C;  2OPL B;  4DV7 C;  5IT9 D;  2EGT A;  3J7A D;  1UKK A;  4B3S C;  3R9X A;  2UXC C;  2KZF A;  4DR4 C;  4KHP C;  2UXB C;  4LFA C;  3EER A;  3AF5 A;  2UUB C;  4LFB C;  4JYA C;  4X66 C;  4YHH C;  2UXD C;  4JI6 C;  2ZM6 C;  2E8C A;  1IBK C;  3GKU A;  1N33 C;  4JI0 C;  1HNZ C;  4B3R C;  2PT7 G;  4DR5 C;  4DUY C;  4DV6 C;  4K0K C;  4DCT A;  1MKY A;  2PN2 A;  1K0R A;  4DR7 C;  1HR0 C;  1HH2 P;  4DV5 C;  2JMP A;  5IWA C;  4B3T C;  3IEV A;  4LF5 C;  4B3M C;  4X65 C;  4NXN C;  1J5E C;  2ATW A;  4X62 C;  1N32 C;  4XX2 A;  4DV0 C;  1L2F A;  1XNR C;  2CXC A;  2E8E A;  2XR1 A;  3T1H C;  4OX9 C;  2E5L C;  4DV2 C; 
#chains in the Genus database with same CATH topology
 5A2Q D;  5T8S A;  5BUQ A;  2YCB A;  2Y4O A;  5BSR A;  2CY1 A;  3T1Y C;  4FUQ A;  4BC7 A;  5LMU C;  2MMA B;  1ULT A;  4LF9 C;  3CJE A;  3R44 A;  4L2Z A;  2WD9 A;  2E8F A;  3RV2 A;  1XMO C;  2HHH C;  4LF6 C;  1PA4 A;  4WS9 A;  4U5Y D;  1QWI A;  2F4V C;  1IBL C;  2BH1 X;  5A19 A;  3ETC A;  1XS3 A;  1RY2 A;  3CW8 X;  2VQE C;  2QW0 X;  4D4I A;  5FLX D;  5AE2 A;  1VEH A;  2ZZM A;  5AE1 A;  4JI3 C;  3J80 D;  1PU1 A;  4GKJ C;  4MH4 A;  3R9W A;  3O2E A;  4FTF A;  4LF7 C;  3OTO C;  5BUR A;  3J81 D;  2Y27 A;  1N36 C;  1WF3 A;  4DR3 C;  3DLP X;  1USP A;  3A9V A;  4G36 A;  2ZTB A;  1MDB A;  2VQF C;  5LMN C;  5KEI A;  3DHV A;  3VNR A;  4KTT A;  1MXB A;  2YWC A;  1UKK A;  4B3S C;  3GR1 A;  3R9X A;  2M5O A;  1PG4 A;  2P2B A;  2UUB C;  2P2Q A;  4JI6 C;  2E8C A;  3GKU A;  4B3R C;  4PUH A;  4DR5 C;  4DUY C;  1MKY A;  4RVN A;  3E7W A;  1M6X C;  5ADZ A;  2DPL A;  1HH2 P;  4GS5 A;  4DV5 C;  2JMP A;  2NCL A;  2P2J A;  4LF5 C;  5KYV A;  2V7B A;  3B7W A;  1NY8 A;  1TH5 A;  4DV0 C;  2YX1 A;  1O93 A;  4RLQ A;  3T1H C;  3FM7 A;  4OX9 C;  1IB8 A;  1O92 A;  4D4G A;  4RMN A;  4DV2 C;  1YGT A;  3NPD A;  4LF8 C;  2BJO A;  4JI1 C;  4BSZ A;  4LF4 C;  4DV1 C;  3I07 A;  2HJG A;  1VLA A;  4PUI A;  2YWB A;  3LNV A;  2D7V A;  3L8C A;  4BCA A;  1P4E A;  4JM1 A;  3LNO A;  3K6R A;  3UX3 A;  2QVX X;  2KDN A;  3JAM D;  4PHT A;  4FUT A;  1I94 C;  3TDE A;  3EQ6 A;  5H9U A;  1HNW C;  5BSV A;  5CZX A;  3UEB A;  4WV3 A;  3FCE A;  2P2F A;  3TQI A;  5K8F A;  1FLO A;  2UU9 C;  4D57 A;  5AE3 A;  1XNQ C;  3LGX A;  5BUS A;  1T5D X;  1M6X A;  4GKK C;  4PZP A;  4JI8 C;  2D1R A;  1V26 A;  2OPL A;  3KXW A;  1O90 A;  5DV9 A;  4ZLP A;  4ISB A;  1LCI A;  4G1I A;  4ZJZ A;  2DYJ A;  2AYA A;  2VSQ A;  2E0G A;  2Z51 A;  4RVO A;  4ODJ A;  2PG1 E;  4BC9 A;  5T8T A;  4DR4 C;  4G37 A;  4KHP C;  2UXB C;  3EER A;  4JYA C;  4LFB C;  4PRO C;  3LAX A;  3A25 A;  4I9F A;  1N33 C;  3CQ3 A;  4JI0 C;  1WCJ A;  1AMU A;  2Y4N A;  4K0K C;  3NYR A;  2MCQ A;  1P4E C;  1MXA A;  4DG9 A;  1HR0 C;  4GXR A;  1UWD A;  4B3T C;  2DHM A;  3I08 A;  4NXN C;  5JRH A;  1XHJ A;  4X62 C;  4IR7 A;  3A26 A;  2CXC A;  2XR1 A;  5KYT A;  2P02 A;  1XDX A;  4RM3 A;  4YY3 C;  4BBY A;  4JI7 C;  5E7Q A;  4NDN A;  4JI2 C;  2P20 A;  4GXQ A;  1N34 C;  4KTV A;  5BSW A;  1P7L A;  3UOW A;  4DR1 C;  1ZB9 A;  2VZE A;  4DG8 A;  4LFC C;  2ASB A;  4L4Q A;  3LUS A;  1T5H X;  2D1S A;  1XMQ C;  2QVZ X;  3VNQ A;  1FJG C;  1HNX C;  3AF6 A;  1YJ7 A;  2QVY X;  2UUA C;  1WH9 A;  4JI5 C;  1MD9 A;  2ZZN A;  1RG9 A;  4DV3 C;  4JI4 C;  1XRB A;  5BSM A;  2D27 A;  5BR8 C;  4AQY C;  2E7G A;  4DR6 C;  2D1Q A;  1MDF A;  5LCI A;  2WP0 C;  1KKG A;  5IFI A;  1ZB8 A;  3PES A;  4DV4 C;  3A9U A;  1QM4 A;  1V25 A;  1XRC A;  5IT9 D;  3J7A D;  3N2Q A;  4R0M A;  2UXC C;  2KZF A;  3AF5 A;  4RLF A;  4LE5 A;  2UXD C;  4L7I A;  3SO4 A;  3AY0 A;  1IBK C;  2OBV A;  1HNZ C;  3TUF A;  4TPS B;  2PN2 A;  2D1T A;  3C5E A;  4DR7 C;  4I9G A;  3A4I A;  3NYQ A;  5IWA C;  3IEV A;  4D56 A;  5GTD A;  3DAY A;  1GPM A;  1FUG A;  1N32 C;  4XX2 A;  2CU6 A;  1XNR C;  3FCC A;  4IZ6 A;  4R1L A;  2E5L C;  3NI2 A;  4K0B A;  3UX2 A;  5A1G A;  1ML8 A;  2D28 C;  1JOS A;  1O9T A;  1USP B;  4NXM C;  3S82 A;  4X64 C;  3VNS A;  3GPC A;  5K85 A;  1LQL A;  1EGA A;  4DR2 C;  4DCS A;  4NOZ A;  3CW9 A;  5A1I A;  5BSU A;  4DUZ C;  1N2F A;  2ONF A;  4OYC A;  4DCU A;  2QL8 A;  3G7S A;  2MM9 A;  5BST A;  3IEU A;  3L95 X;  2PRO A;  4JV5 C;  3N54 B;  4PUG A;  1NYE A;  2M5H A;  4R1M A;  1V60 A;  3TR3 A;  2JNV A;  2UUC C;  3PRO C;  4HPV A;  1MXC A;  1IBM C;  3CQ2 A;  3IML A;  4MTN A;  2P2M A;  4DCV A;  2KZ0 A;  4EAT A;  2OPL B;  4DV7 C;  2EGT A;  3GR0 A;  4LFA C;  3RG2 A;  3E7X A;  4X66 C;  4YHH C;  1XRA A;  3CQ1 A;  1PG3 A;  2ZM6 C;  2PT7 G;  4DV6 C;  5CZV A;  4DCT A;  3H2T A;  1K0R A;  3PBK A;  3IPL A;  2OO4 A;  4B3M C;  4X65 C;  1J5E C;  2ATW A;  1L2F A;  2E8E A;  3UZ0 A;  3ETO A;  1BA3 A;  4RM2 A;  4OXI A; 
#chains in the Genus database with same CATH homology
 5A2Q D;  5T8S A;  5BUQ A;  2YCB A;  2Y4O A;  5BSR A;  2CY1 A;  3T1Y C;  4FUQ A;  4BC7 A;  5LMU C;  1ULT A;  4LF9 C;  3CJE A;  3R44 A;  4L2Z A;  2WD9 A;  2E8F A;  3RV2 A;  1XMO C;  2HHH C;  4LF6 C;  1PA4 A;  4WS9 A;  4U5Y D;  1QWI A;  2F4V C;  1IBL C;  2BH1 X;  5A19 A;  3ETC A;  1RY2 A;  3CW8 X;  2VQE C;  2QW0 X;  4D4I A;  5FLX D;  5AE2 A;  5AE1 A;  4JI3 C;  3J80 D;  4GKJ C;  4MH4 A;  3R9W A;  4FTF A;  4LF7 C;  3OTO C;  5BUR A;  3J81 D;  2Y27 A;  1N36 C;  1WF3 A;  4DR3 C;  3DLP X;  1USP A;  3A9V A;  4G36 A;  1MDB A;  2VQF C;  5LMN C;  5KEI A;  3DHV A;  3VNR A;  4KTT A;  1MXB A;  2YWC A;  1UKK A;  4B3S C;  3GR1 A;  3R9X A;  1PG4 A;  2P2B A;  2UUB C;  2P2Q A;  4JI6 C;  2E8C A;  3GKU A;  4B3R C;  4DR5 C;  4DUY C;  1MKY A;  4RVN A;  3E7W A;  5ADZ A;  2DPL A;  1HH2 P;  4GS5 A;  4DV5 C;  2JMP A;  2P2J A;  4LF5 C;  5KYV A;  2V7B A;  3B7W A;  4DV0 C;  1O93 A;  4RLQ A;  3T1H C;  4OX9 C;  1O92 A;  4D4G A;  4RMN A;  4DV2 C;  3NPD A;  4LF8 C;  2BJO A;  4JI1 C;  4BSZ A;  4LF4 C;  4DV1 C;  3I07 A;  2HJG A;  1VLA A;  2YWB A;  3LNV A;  2D7V A;  3L8C A;  4BCA A;  4JM1 A;  2QVX X;  3JAM D;  4PHT A;  4FUT A;  1I94 C;  3TDE A;  3EQ6 A;  5H9U A;  1HNW C;  5BSV A;  5CZX A;  4WV3 A;  3FCE A;  2P2F A;  3TQI A;  5K8F A;  2UU9 C;  4D57 A;  5AE3 A;  1XNQ C;  3LGX A;  5BUS A;  1T5D X;  4GKK C;  4PZP A;  4JI8 C;  2D1R A;  1V26 A;  2OPL A;  3KXW A;  1O90 A;  5DV9 A;  4ZLP A;  4ISB A;  1LCI A;  4G1I A;  4ZJZ A;  2DYJ A;  2AYA A;  2VSQ A;  2E0G A;  4RVO A;  4ODJ A;  4BC9 A;  5T8T A;  4DR4 C;  4G37 A;  4KHP C;  2UXB C;  3EER A;  4JYA C;  4LFB C;  4PRO C;  3LAX A;  4I9F A;  1N33 C;  4JI0 C;  1AMU A;  2Y4N A;  4K0K C;  3NYR A;  1MXA A;  4DG9 A;  1HR0 C;  4GXR A;  4B3T C;  3I08 A;  4NXN C;  5JRH A;  4X62 C;  4IR7 A;  2CXC A;  2XR1 A;  5KYT A;  2P02 A;  4RM3 A;  4YY3 C;  4BBY A;  4JI7 C;  5E7Q A;  4NDN A;  4JI2 C;  2P20 A;  4GXQ A;  1N34 C;  4KTV A;  5BSW A;  1P7L A;  3UOW A;  4DR1 C;  1ZB9 A;  2VZE A;  4DG8 A;  4LFC C;  2ASB A;  4L4Q A;  3LUS A;  1T5H X;  2D1S A;  1XMQ C;  2QVZ X;  3VNQ A;  1FJG C;  1HNX C;  3AF6 A;  1YJ7 A;  2QVY X;  2UUA C;  1WH9 A;  4JI5 C;  1MD9 A;  1RG9 A;  4DV3 C;  4JI4 C;  1XRB A;  5BSM A;  2D27 A;  5BR8 C;  4AQY C;  2E7G A;  4DR6 C;  2D1Q A;  1MDF A;  2WP0 C;  1KKG A;  5IFI A;  1ZB8 A;  3PES A;  4DV4 C;  3A9U A;  1QM4 A;  1V25 A;  1XRC A;  5IT9 D;  3J7A D;  3N2Q A;  4R0M A;  2UXC C;  2KZF A;  3AF5 A;  4RLF A;  4LE5 A;  2UXD C;  4L7I A;  3SO4 A;  1IBK C;  2OBV A;  1HNZ C;  3TUF A;  4TPS B;  2PN2 A;  2D1T A;  3C5E A;  4DR7 C;  4I9G A;  3A4I A;  3NYQ A;  5IWA C;  3IEV A;  4D56 A;  5GTD A;  3DAY A;  1GPM A;  1FUG A;  1N32 C;  4XX2 A;  1XNR C;  3FCC A;  4IZ6 A;  4R1L A;  2E5L C;  3NI2 A;  4K0B A;  5A1G A;  1ML8 A;  2D28 C;  1JOS A;  1O9T A;  1USP B;  4NXM C;  3S82 A;  4X64 C;  3VNS A;  3GPC A;  5K85 A;  1LQL A;  1EGA A;  4DR2 C;  4DCS A;  4NOZ A;  3CW9 A;  5A1I A;  5BSU A;  4DUZ C;  1N2F A;  2ONF A;  4OYC A;  4DCU A;  2QL8 A;  3G7S A;  5BST A;  3IEU A;  3L95 X;  2PRO A;  4JV5 C;  3N54 B;  1NYE A;  4R1M A;  2UUC C;  3PRO C;  4HPV A;  1MXC A;  1IBM C;  3IML A;  4MTN A;  2P2M A;  4DCV A;  4EAT A;  2OPL B;  4DV7 C;  2EGT A;  3GR0 A;  4LFA C;  3RG2 A;  3E7X A;  4X66 C;  4YHH C;  1XRA A;  1PG3 A;  2ZM6 C;  2PT7 G;  4DV6 C;  5CZV A;  4DCT A;  3H2T A;  1K0R A;  3PBK A;  3IPL A;  2OO4 A;  4B3M C;  4X65 C;  1J5E C;  2ATW A;  1L2F A;  2E8E A;  3UZ0 A;  3ETO A;  1BA3 A;  4RM2 A;  4OXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...