4DUZC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duzC02
1IBKC 1NYEA 4X62C 2PN2A 4MH4A 3AF5A 2E7GA 2E5LC 4X64C 1QWIA 1JOSA 1ML8A 2E8FA 3T1YC 4DR4C 4LFAC 4B3MC 4B3RC 4JI0C 1N32C 1XMQC 2UUBC 1PA4A 4B3TC 4DCVA 2VQEC 2UUCC 2QL8A 4JI3C 1USPA 5FLXD 4DV0C 5BR8C 2ASBA 1WF3A 5LMNC 4X65C 3T1HC 2UUAC 1IBMC 2HJGA 2CXCA 3LUSA 2OPLA 4LF5C 4DV1C 2UXBC 1USPB 1L2FA 2HHHC 1KKGA 1I94C 4DV7C 4XX2A 4GKJC 4JV5C 2E8CA 4JI4C 2UU9C 1XNQC 1N2FA 4JI5C 2XR1A 4DR2C 4JI6C 2E8EA 4JYAC 4JI7C 4DV4C 1HNWC 1XNRC 3IEVA 1K0RA 1IBLC 4B3SC 4DV6C 3IEUA 4NXMC 5IT9D 4LF6C 4KHPC 4K0KC 4YY3C 3JAMD 4NOZA 4DCTA 4JI1C 2DYJA 1HH2P 1WH9A 4DR5C 2ONFA 5LMUC 4LFCC 5A2QD 5IWAC 4GKKC 2VQFC 4DR1C 4JI2C 4LF4C 1N36C 2PT7G 2YCBA 4LF9C 3R9WA 4DR7C 3GKUA 2EGTA 3J7AD 1N33C 3J81D 4NXNC 3AF6A 4AQYC 3R9XA 4BSZA 1J5EC 2F4VC 4DV2C 2OPLB 1HR0C 1XMOC 1LQLA 4DR6C 4DUYC 1HNXC 3J80D 4LF8C 3OTOC 4MTNA 4DR3C 1VLAA 1N34C 4LF7C 1HNZC 2UXCC 2D7VA 1MKYA 1FJGC 2BJOA 4DUZC 1ZB8A 3CJEA 4DCUA 3I07A 2KZFA 4JI8C 1ZB9A 2UXDC 4DV3C 2ATWA 4DCSA 1UKKA 4LFBC 3EERA 2CY1A 2JMPA 4YHHC 4OX9C 1EGAA 2ZM6C 4DV5C 4X66C
chains in the Genus database with same CATH superfamily
5DV9A 2E5LC 1QWIA 2D1TA 1JOSA 4B3MC 4ZJZA 3TDEA 2UUBC 1PA4A 3FCCA 3VNRA 1O92A 5LCIA 3CQ2A 1YGTA 1WF3A 2JNVA 5LMNC 3E7WA 1O9TA 4DG9A 4DV1C 1USPB 1I94C 4GKJC 3H2TA 1P4EA 2D28C 1MDFA 3L95X 2M5HA 2E8EA 3UEBA 3VNQA 3C5EA 4WV3A 5IFIA 3GPCA 3IEVA 4RMNA 3N2QA 3NYQA 2QVYX 3IEUA 3S82A 4NOZA 4JI1C 2DYJA 4NDNA 3SO4A 4LFCC 1RG9A 2BH1X 3TUFA 4RVNA 2NCLA 2PT7G 4PHTA 3CW9A 2YCBA 3R9WA 3RG2A 4BC9A 4OYCA 4RLQA 3R9XA 2P2JA 3L8CA 1BA3A 2F4VC 4PUGA 5KEIA 2OPLB 2WD9A 4RM3A 1N34C 4LF7C 2UXCC 1UWDA 3CJEA 3TR3A 2ZZNA 3I07A 5BSTA 5A1GA 3KXWA 2ATWA 4DCSA 3EERA 4GXQA 2JMPA 4YHHC 4DV5C 5BSWA 4KTTA 4X62C 3LGXA 2Y4NA 4R0MA 3AF5A 1P7LA 1MD9A 3I08A 1ML8A 2E8FA 2P02A 3PBKA 4FUTA 3T1YC 4BC7A 1N32C 4D4GA 2UUCC 2QL8A 3A25A 3A26A 1USPA 3UOWA 3E7XA 5BR8C 2ASBA 1GPMA 1XRBA 3DLPX 4R1MA 2CXCA 1M6XA 4LF5C 4GXRA 2UXBC 3LAXA 1L2FA 2HHHC 4EATA 4DG8A 4ZLPA 3NI2A 4JI6C 4JI7C 2P2BA 1HNWC 1XNRC 3GR1A 2Z51A 4DV6C 4NXMC 4KHPC 4K0KC 4YY3C 3JAMD 1WH9A 3A4IA 5A19A 4WS9A 4GKKC 5ADZA 4L7IA 1XHJA 4JI2C 2P2QA 3ETOA 1XDXA 3J81D 4ODJA 2QVZX 1PG3A 4BSZA 2CU6A 1J5EC 1YJ7A 5AE1A 1HR0C 1XMOC 1LQLA 5JRHA 4LF8C 3PESA 4MTNA 4DR3C 1HNZC 1VEHA 4RLFA 2MM9A 2OBVA 3N54B 4L2ZA 1MXBA 3TQIA 1XS3A 1ZB8A 2VZEA 1V25A 3CQ3A 3O2EA 4I9GA 1UKKA 4IZ6A 4LFBC 2M5OA 3NPDA 1FJGC 2ZM6C 4IR7A 2PN2A 4MH4A 2E7GA 4X64C 5T8SA 1V60A 4DR4C 4B3RC 4JI0C 1XMQC 4PUHA 5BSMA 4DCVA 4JI3C 4DV0C 1NY8A 1RY2A 4X65C 3T1HC 2KZ0A 2ZZMA 3AY0A 2HJGA 4FTFA 3VNSA 1ULTA 3LUSA 2D1SA 1TH5A 3GR0A 3K6RA 4JM1A 4G37A 4D4IA 1KKGA 4DV7C 4XX2A 5KYTA 4JI4C 2UU9C 2V7BA 5K8FA 5BSRA 4JI5C 2XR1A 2OO4A 4PROC 5H9UA 4DR2C 2D27A 2DHMA 2QW0X 3CW8X 4KTVA 4PUIA 1O90A 4HPVA 5CZVA 5BUSA 4LF6C 5IT9D 2Y27A 1V26A 2E0GA 1HH2P 3LNVA 5KYVA 5T8TA 1O93A 3UX2A 2VQFC 4DR1C 4G1IA 3GKUA 4G36A 4L4QA 2EGTA 3J7AD 1T5DX 2MCQA 2MMAB 3AF6A 4AQYC 2KDNA 1MDBA 4R1LA 4BCAA 4DR6C 3NYRA 3J80D 2QVXX 5AE3A 2PG1E 1AMUA 1XRAA 2BJOA 3A9VA 4DCUA 2YWCA 4RM2A 2KZFA 1ZB9A 3IMLA 2CY1A 5GTDA 4OX9C 1PU1A 3A9UA 2AYAA 1IBKC 1NYEA 4D57A 1MXAA 4ISBA 1PG4A 4LFAC 2VSQA 4GS5A 4RVOA 3B7WA 1MXCA 4B3TC 2P2FA 2VQEC 3EQ6A 5FLXD 5A1IA 2P2MA 2UUAC 2PROA 5BSVA 1IBMC 2YWBA 2OPLA 5BURA 5E7QA 1T5HX 4OXIA 5AE2A 4U5YD 4JV5C 2E8CA 1XNQC 4I9FA 1N2FA 2D1RA 1XRCA 1P4EC 2Y4OA 3UZ0A 4JYAC 4DV4C 2WP0C 1K0RA 1IBLC 4B3SC 5BSUA 3PROC 2YX1A 4LE5A 4DCTA 4DR5C 2ONFA 5LMUC 1FUGA 2D1QA 5A2QD 4K0BA 1M6XC 5IWAC 3LNOA 1WCJA 3FM7A 3IPLA 4LF4C 1N36C 4PZPA 4LF9C 4DR7C 3FCEA 1N33C 4TPSB 5K85A 3CQ1A 3UX3A 1FLOA 4NXNC 3ETCA 3RV2A 3DHVA 2ZTBA 2DPLA 4DV2C 4DUYC 1HNXC 3OTOC 1LCIA 1VLAA 1IB8A 2D7VA 1MKYA 1QM4A 3DAYA 3G7SA 4DUZC 4FUQA 4D56A 3R44A 5CZXA 4BBYA 2P20A 4JI8C 5BUQA 2UXDC 4DV3C 1EGAA 4X66C
chains in the Genus database with same CATH topology
5DV9A 2E5LC 1QWIA 2D1TA 1JOSA 4B3MC 4ZJZA 3TDEA 2UUBC 1PA4A 3FCCA 3VNRA 1O92A 1WF3A 5LMNC 3E7WA 1O9TA 4DG9A 4DV1C 1USPB 1I94C 4GKJC 3H2TA 2D28C 1MDFA 3L95X 2E8EA 3VNQA 3C5EA 4WV3A 5IFIA 3GPCA 3IEVA 4RMNA 3N2QA 3NYQA 2QVYX 3IEUA 3S82A 4NOZA 4JI1C 2DYJA 4NDNA 3SO4A 4LFCC 1RG9A 2BH1X 3TUFA 4RVNA 2PT7G 4PHTA 3CW9A 2YCBA 3R9WA 3RG2A 4BC9A 4OYCA 4RLQA 3R9XA 2P2JA 3L8CA 1BA3A 2F4VC 5KEIA 2OPLB 2WD9A 4RM3A 1N34C 4LF7C 2UXCC 3CJEA 3I07A 5BSTA 5A1GA 3KXWA 2ATWA 4DCSA 3EERA 4GXQA 2JMPA 4YHHC 4DV5C 5BSWA 4KTTA 4X62C 3LGXA 2Y4NA 4R0MA 3AF5A 1P7LA 1MD9A 3I08A 1ML8A 2E8FA 2P02A 3PBKA 4FUTA 3T1YC 4BC7A 1N32C 4D4GA 2UUCC 2QL8A 1USPA 3UOWA 3E7XA 5BR8C 2ASBA 1GPMA 1XRBA 3DLPX 4R1MA 2CXCA 4LF5C 4GXRA 2UXBC 3LAXA 1L2FA 2HHHC 4EATA 4DG8A 4ZLPA 3NI2A 4JI6C 4JI7C 2P2BA 1HNWC 1XNRC 3GR1A 4DV6C 4NXMC 4KHPC 4K0KC 4YY3C 3JAMD 1WH9A 3A4IA 5A19A 4WS9A 4GKKC 5ADZA 4L7IA 4JI2C 2P2QA 3ETOA 3J81D 4ODJA 2QVZX 1PG3A 4BSZA 1J5EC 1YJ7A 5AE1A 1HR0C 1XMOC 1LQLA 5JRHA 4LF8C 3PESA 4MTNA 4DR3C 1HNZC 4RLFA 2OBVA 3N54B 4L2ZA 1MXBA 3TQIA 1ZB8A 2VZEA 1V25A 4I9GA 1UKKA 4IZ6A 4LFBC 3NPDA 1FJGC 2ZM6C 4IR7A 2PN2A 4MH4A 2E7GA 4X64C 5T8SA 4DR4C 4B3RC 4JI0C 1XMQC 5BSMA 4DCVA 4JI3C 4DV0C 1RY2A 4X65C 3T1HC 2HJGA 4FTFA 3VNSA 1ULTA 3LUSA 2D1SA 3GR0A 4JM1A 4G37A 4D4IA 1KKGA 4DV7C 4XX2A 5KYTA 4JI4C 2UU9C 2V7BA 5K8FA 5BSRA 4JI5C 2XR1A 2OO4A 4PROC 5H9UA 4DR2C 2D27A 3CW8X 2QW0X 4KTVA 1O90A 4HPVA 5CZVA 5BUSA 4LF6C 5IT9D 2Y27A 1V26A 2E0GA 1HH2P 3LNVA 5KYVA 5T8TA 1O93A 2VQFC 4DR1C 4G1IA 3GKUA 4G36A 4L4QA 2EGTA 3J7AD 1T5DX 3AF6A 4AQYC 1MDBA 4R1LA 4BCAA 4DR6C 3NYRA 3J80D 2QVXX 5AE3A 1AMUA 1XRAA 2BJOA 3A9VA 4DCUA 2YWCA 4RM2A 2KZFA 1ZB9A 3IMLA 2CY1A 5GTDA 4OX9C 3A9UA 2AYAA 1IBKC 1NYEA 4D57A 1MXAA 4ISBA 1PG4A 4LFAC 2VSQA 4GS5A 4RVOA 3B7WA 1MXCA 4B3TC 2P2FA 2VQEC 3EQ6A 5FLXD 5A1IA 2P2MA 2UUAC 2PROA 5BSVA 1IBMC 2YWBA 2OPLA 5BURA 5E7QA 1T5HX 4OXIA 5AE2A 4U5YD 4JV5C 2E8CA 1XNQC 4I9FA 1N2FA 2D1RA 1XRCA 2Y4OA 3UZ0A 4JYAC 4DV4C 2WP0C 1K0RA 1IBLC 4B3SC 5BSUA 3PROC 4LE5A 4DCTA 4DR5C 2ONFA 5LMUC 1FUGA 2D1QA 5A2QD 4K0BA 5IWAC 3IPLA 4LF4C 1N36C 4PZPA 4LF9C 4DR7C 3FCEA 1N33C 4TPSB 5K85A 4NXNC 3ETCA 3RV2A 3DHVA 2DPLA 4DV2C 4DUYC 1HNXC 3OTOC 1LCIA 1VLAA 2D7VA 1MKYA 1QM4A 3DAYA 3G7SA 4DUZC 4FUQA 4D56A 3R44A 5CZXA 4BBYA 2P20A 4JI8C 5BUQA 2UXDC 4DV3C 1EGAA 4X66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK C;  1NYE A;  4X62 C;  2PN2 A;  4MH4 A;  3AF5 A;  2E7G A;  2E5L C;  4X64 C;  1QWI A;  1JOS A;  1ML8 A;  2E8F A;  3T1Y C;  4DR4 C;  4LFA C;  4B3M C;  4B3R C;  4JI0 C;  1N32 C;  1XMQ C;  2UUB C;  1PA4 A;  4B3T C;  4DCV A;  2VQE C;  2UUC C;  2QL8 A;  4JI3 C;  1USP A;  5FLX D;  4DV0 C;  5BR8 C;  2ASB A;  1WF3 A;  5LMN C;  4X65 C;  3T1H C;  2UUA C;  1IBM C;  2HJG A;  2CXC A;  3LUS A;  2OPL A;  4LF5 C;  4DV1 C;  2UXB C;  1USP B;  1L2F A;  2HHH C;  1KKG A;  1I94 C;  4DV7 C;  4XX2 A;  4GKJ C;  4JV5 C;  2E8C A;  4JI4 C;  2UU9 C;  1XNQ C;  1N2F A;  4JI5 C;  2XR1 A;  4DR2 C;  4JI6 C;  2E8E A;  4JYA C;  4JI7 C;  4DV4 C;  1HNW C;  1XNR C;  3IEV A;  1K0R A;  1IBL C;  4B3S C;  4DV6 C;  3IEU A;  4NXM C;  5IT9 D;  4LF6 C;  4KHP C;  4K0K C;  4YY3 C;  3JAM D;  4NOZ A;  4DCT A;  4JI1 C;  2DYJ A;  1HH2 P;  1WH9 A;  4DR5 C;  2ONF A;  5LMU C;  4LFC C;  5A2Q D;  5IWA C;  4GKK C;  2VQF C;  4DR1 C;  4JI2 C;  4LF4 C;  1N36 C;  2PT7 G;  2YCB A;  4LF9 C;  3R9W A;  4DR7 C;  3GKU A;  2EGT A;  3J7A D;  1N33 C;  3J81 D;  4NXN C;  3AF6 A;  4AQY C;  3R9X A;  4BSZ A;  1J5E C;  2F4V C;  4DV2 C;  2OPL B;  1HR0 C;  1XMO C;  1LQL A;  4DR6 C;  4DUY C;  1HNX C;  3J80 D;  4LF8 C;  3OTO C;  4MTN A;  4DR3 C;  1VLA A;  1N34 C;  4LF7 C;  1HNZ C;  2UXC C;  2D7V A;  1MKY A;  1FJG C;  2BJO A;  4DUZ C;  1ZB8 A;  3CJE A;  4DCU A;  3I07 A;  2KZF A;  4JI8 C;  1ZB9 A;  2UXD C;  4DV3 C;  2ATW A;  4DCS A;  1UKK A;  4LFB C;  3EER A;  2CY1 A;  2JMP A;  4YHH C;  4OX9 C;  1EGA A;  2ZM6 C;  4DV5 C;  4X66 C; 
#chains in the Genus database with same CATH topology
 5DV9 A;  2E5L C;  1QWI A;  2D1T A;  1JOS A;  4B3M C;  4ZJZ A;  3TDE A;  2UUB C;  1PA4 A;  3FCC A;  3VNR A;  1O92 A;  5LCI A;  3CQ2 A;  1YGT A;  1WF3 A;  2JNV A;  5LMN C;  3E7W A;  1O9T A;  4DG9 A;  4DV1 C;  1USP B;  1I94 C;  4GKJ C;  3H2T A;  1P4E A;  2D28 C;  1MDF A;  3L95 X;  2M5H A;  2E8E A;  3UEB A;  3VNQ A;  3C5E A;  4WV3 A;  5IFI A;  3GPC A;  3IEV A;  4RMN A;  3N2Q A;  3NYQ A;  2QVY X;  3IEU A;  3S82 A;  4NOZ A;  4JI1 C;  2DYJ A;  4NDN A;  3SO4 A;  4LFC C;  1RG9 A;  2BH1 X;  3TUF A;  4RVN A;  2NCL A;  2PT7 G;  4PHT A;  3CW9 A;  2YCB A;  3R9W A;  3RG2 A;  4BC9 A;  4OYC A;  4RLQ A;  3R9X A;  2P2J A;  3L8C A;  1BA3 A;  2F4V C;  4PUG A;  5KEI A;  2OPL B;  2WD9 A;  4RM3 A;  1N34 C;  4LF7 C;  2UXC C;  1UWD A;  3CJE A;  3TR3 A;  2ZZN A;  3I07 A;  5BST A;  5A1G A;  3KXW A;  2ATW A;  4DCS A;  3EER A;  4GXQ A;  2JMP A;  4YHH C;  4DV5 C;  5BSW A;  4KTT A;  4X62 C;  3LGX A;  2Y4N A;  4R0M A;  3AF5 A;  1P7L A;  1MD9 A;  3I08 A;  1ML8 A;  2E8F A;  2P02 A;  3PBK A;  4FUT A;  3T1Y C;  4BC7 A;  1N32 C;  4D4G A;  2UUC C;  2QL8 A;  3A25 A;  3A26 A;  1USP A;  3UOW A;  3E7X A;  5BR8 C;  2ASB A;  1GPM A;  1XRB A;  3DLP X;  4R1M A;  2CXC A;  1M6X A;  4LF5 C;  4GXR A;  2UXB C;  3LAX A;  1L2F A;  2HHH C;  4EAT A;  4DG8 A;  4ZLP A;  3NI2 A;  4JI6 C;  4JI7 C;  2P2B A;  1HNW C;  1XNR C;  3GR1 A;  2Z51 A;  4DV6 C;  4NXM C;  4KHP C;  4K0K C;  4YY3 C;  3JAM D;  1WH9 A;  3A4I A;  5A19 A;  4WS9 A;  4GKK C;  5ADZ A;  4L7I A;  1XHJ A;  4JI2 C;  2P2Q A;  3ETO A;  1XDX A;  3J81 D;  4ODJ A;  2QVZ X;  1PG3 A;  4BSZ A;  2CU6 A;  1J5E C;  1YJ7 A;  5AE1 A;  1HR0 C;  1XMO C;  1LQL A;  5JRH A;  4LF8 C;  3PES A;  4MTN A;  4DR3 C;  1HNZ C;  1VEH A;  4RLF A;  2MM9 A;  2OBV A;  3N54 B;  4L2Z A;  1MXB A;  3TQI A;  1XS3 A;  1ZB8 A;  2VZE A;  1V25 A;  3CQ3 A;  3O2E A;  4I9G A;  1UKK A;  4IZ6 A;  4LFB C;  2M5O A;  3NPD A;  1FJG C;  2ZM6 C;  4IR7 A;  2PN2 A;  4MH4 A;  2E7G A;  4X64 C;  5T8S A;  1V60 A;  4DR4 C;  4B3R C;  4JI0 C;  1XMQ C;  4PUH A;  5BSM A;  4DCV A;  4JI3 C;  4DV0 C;  1NY8 A;  1RY2 A;  4X65 C;  3T1H C;  2KZ0 A;  2ZZM A;  3AY0 A;  2HJG A;  4FTF A;  3VNS A;  1ULT A;  3LUS A;  2D1S A;  1TH5 A;  3GR0 A;  3K6R A;  4JM1 A;  4G37 A;  4D4I A;  1KKG A;  4DV7 C;  4XX2 A;  5KYT A;  4JI4 C;  2UU9 C;  2V7B A;  5K8F A;  5BSR A;  4JI5 C;  2XR1 A;  2OO4 A;  4PRO C;  5H9U A;  4DR2 C;  2D27 A;  2DHM A;  2QW0 X;  3CW8 X;  4KTV A;  4PUI A;  1O90 A;  4HPV A;  5CZV A;  5BUS A;  4LF6 C;  5IT9 D;  2Y27 A;  1V26 A;  2E0G A;  1HH2 P;  3LNV A;  5KYV A;  5T8T A;  1O93 A;  3UX2 A;  2VQF C;  4DR1 C;  4G1I A;  3GKU A;  4G36 A;  4L4Q A;  2EGT A;  3J7A D;  1T5D X;  2MCQ A;  2MMA B;  3AF6 A;  4AQY C;  2KDN A;  1MDB A;  4R1L A;  4BCA A;  4DR6 C;  3NYR A;  3J80 D;  2QVX X;  5AE3 A;  2PG1 E;  1AMU A;  1XRA A;  2BJO A;  3A9V A;  4DCU A;  2YWC A;  4RM2 A;  2KZF A;  1ZB9 A;  3IML A;  2CY1 A;  5GTD A;  4OX9 C;  1PU1 A;  3A9U A;  2AYA A;  1IBK C;  1NYE A;  4D57 A;  1MXA A;  4ISB A;  1PG4 A;  4LFA C;  2VSQ A;  4GS5 A;  4RVO A;  3B7W A;  1MXC A;  4B3T C;  2P2F A;  2VQE C;  3EQ6 A;  5FLX D;  5A1I A;  2P2M A;  2UUA C;  2PRO A;  5BSV A;  1IBM C;  2YWB A;  2OPL A;  5BUR A;  5E7Q A;  1T5H X;  4OXI A;  5AE2 A;  4U5Y D;  4JV5 C;  2E8C A;  1XNQ C;  4I9F A;  1N2F A;  2D1R A;  1XRC A;  1P4E C;  2Y4O A;  3UZ0 A;  4JYA C;  4DV4 C;  2WP0 C;  1K0R A;  1IBL C;  4B3S C;  5BSU A;  3PRO C;  2YX1 A;  4LE5 A;  4DCT A;  4DR5 C;  2ONF A;  5LMU C;  1FUG A;  2D1Q A;  5A2Q D;  4K0B A;  1M6X C;  5IWA C;  3LNO A;  1WCJ A;  3FM7 A;  3IPL A;  4LF4 C;  1N36 C;  4PZP A;  4LF9 C;  4DR7 C;  3FCE A;  1N33 C;  4TPS B;  5K85 A;  3CQ1 A;  3UX3 A;  1FLO A;  4NXN C;  3ETC A;  3RV2 A;  3DHV A;  2ZTB A;  2DPL A;  4DV2 C;  4DUY C;  1HNX C;  3OTO C;  1LCI A;  1VLA A;  1IB8 A;  2D7V A;  1MKY A;  1QM4 A;  3DAY A;  3G7S A;  4DUZ C;  4FUQ A;  4D56 A;  3R44 A;  5CZX A;  4BBY A;  2P20 A;  4JI8 C;  5BUQ A;  2UXD C;  4DV3 C;  1EGA A;  4X66 C; 
#chains in the Genus database with same CATH homology
 5DV9 A;  2E5L C;  1QWI A;  2D1T A;  1JOS A;  4B3M C;  4ZJZ A;  3TDE A;  2UUB C;  1PA4 A;  3FCC A;  3VNR A;  1O92 A;  1WF3 A;  5LMN C;  3E7W A;  1O9T A;  4DG9 A;  4DV1 C;  1USP B;  1I94 C;  4GKJ C;  3H2T A;  2D28 C;  1MDF A;  3L95 X;  2E8E A;  3VNQ A;  3C5E A;  4WV3 A;  5IFI A;  3GPC A;  3IEV A;  4RMN A;  3N2Q A;  3NYQ A;  2QVY X;  3IEU A;  3S82 A;  4NOZ A;  4JI1 C;  2DYJ A;  4NDN A;  3SO4 A;  4LFC C;  1RG9 A;  2BH1 X;  3TUF A;  4RVN A;  2PT7 G;  4PHT A;  3CW9 A;  2YCB A;  3R9W A;  3RG2 A;  4BC9 A;  4OYC A;  4RLQ A;  3R9X A;  2P2J A;  3L8C A;  1BA3 A;  2F4V C;  5KEI A;  2OPL B;  2WD9 A;  4RM3 A;  1N34 C;  4LF7 C;  2UXC C;  3CJE A;  3I07 A;  5BST A;  5A1G A;  3KXW A;  2ATW A;  4DCS A;  3EER A;  4GXQ A;  2JMP A;  4YHH C;  4DV5 C;  5BSW A;  4KTT A;  4X62 C;  3LGX A;  2Y4N A;  4R0M A;  3AF5 A;  1P7L A;  1MD9 A;  3I08 A;  1ML8 A;  2E8F A;  2P02 A;  3PBK A;  4FUT A;  3T1Y C;  4BC7 A;  1N32 C;  4D4G A;  2UUC C;  2QL8 A;  1USP A;  3UOW A;  3E7X A;  5BR8 C;  2ASB A;  1GPM A;  1XRB A;  3DLP X;  4R1M A;  2CXC A;  4LF5 C;  4GXR A;  2UXB C;  3LAX A;  1L2F A;  2HHH C;  4EAT A;  4DG8 A;  4ZLP A;  3NI2 A;  4JI6 C;  4JI7 C;  2P2B A;  1HNW C;  1XNR C;  3GR1 A;  4DV6 C;  4NXM C;  4KHP C;  4K0K C;  4YY3 C;  3JAM D;  1WH9 A;  3A4I A;  5A19 A;  4WS9 A;  4GKK C;  5ADZ A;  4L7I A;  4JI2 C;  2P2Q A;  3ETO A;  3J81 D;  4ODJ A;  2QVZ X;  1PG3 A;  4BSZ A;  1J5E C;  1YJ7 A;  5AE1 A;  1HR0 C;  1XMO C;  1LQL A;  5JRH A;  4LF8 C;  3PES A;  4MTN A;  4DR3 C;  1HNZ C;  4RLF A;  2OBV A;  3N54 B;  4L2Z A;  1MXB A;  3TQI A;  1ZB8 A;  2VZE A;  1V25 A;  4I9G A;  1UKK A;  4IZ6 A;  4LFB C;  3NPD A;  1FJG C;  2ZM6 C;  4IR7 A;  2PN2 A;  4MH4 A;  2E7G A;  4X64 C;  5T8S A;  4DR4 C;  4B3R C;  4JI0 C;  1XMQ C;  5BSM A;  4DCV A;  4JI3 C;  4DV0 C;  1RY2 A;  4X65 C;  3T1H C;  2HJG A;  4FTF A;  3VNS A;  1ULT A;  3LUS A;  2D1S A;  3GR0 A;  4JM1 A;  4G37 A;  4D4I A;  1KKG A;  4DV7 C;  4XX2 A;  5KYT A;  4JI4 C;  2UU9 C;  2V7B A;  5K8F A;  5BSR A;  4JI5 C;  2XR1 A;  2OO4 A;  4PRO C;  5H9U A;  4DR2 C;  2D27 A;  3CW8 X;  2QW0 X;  4KTV A;  1O90 A;  4HPV A;  5CZV A;  5BUS A;  4LF6 C;  5IT9 D;  2Y27 A;  1V26 A;  2E0G A;  1HH2 P;  3LNV A;  5KYV A;  5T8T A;  1O93 A;  2VQF C;  4DR1 C;  4G1I A;  3GKU A;  4G36 A;  4L4Q A;  2EGT A;  3J7A D;  1T5D X;  3AF6 A;  4AQY C;  1MDB A;  4R1L A;  4BCA A;  4DR6 C;  3NYR A;  3J80 D;  2QVX X;  5AE3 A;  1AMU A;  1XRA A;  2BJO A;  3A9V A;  4DCU A;  2YWC A;  4RM2 A;  2KZF A;  1ZB9 A;  3IML A;  2CY1 A;  5GTD A;  4OX9 C;  3A9U A;  2AYA A;  1IBK C;  1NYE A;  4D57 A;  1MXA A;  4ISB A;  1PG4 A;  4LFA C;  2VSQ A;  4GS5 A;  4RVO A;  3B7W A;  1MXC A;  4B3T C;  2P2F A;  2VQE C;  3EQ6 A;  5FLX D;  5A1I A;  2P2M A;  2UUA C;  2PRO A;  5BSV A;  1IBM C;  2YWB A;  2OPL A;  5BUR A;  5E7Q A;  1T5H X;  4OXI A;  5AE2 A;  4U5Y D;  4JV5 C;  2E8C A;  1XNQ C;  4I9F A;  1N2F A;  2D1R A;  1XRC A;  2Y4O A;  3UZ0 A;  4JYA C;  4DV4 C;  2WP0 C;  1K0R A;  1IBL C;  4B3S C;  5BSU A;  3PRO C;  4LE5 A;  4DCT A;  4DR5 C;  2ONF A;  5LMU C;  1FUG A;  2D1Q A;  5A2Q D;  4K0B A;  5IWA C;  3IPL A;  4LF4 C;  1N36 C;  4PZP A;  4LF9 C;  4DR7 C;  3FCE A;  1N33 C;  4TPS B;  5K85 A;  4NXN C;  3ETC A;  3RV2 A;  3DHV A;  2DPL A;  4DV2 C;  4DUY C;  1HNX C;  3OTO C;  1LCI A;  1VLA A;  2D7V A;  1MKY A;  1QM4 A;  3DAY A;  3G7S A;  4DUZ C;  4FUQ A;  4D56 A;  3R44 A;  5CZX A;  4BBY A;  2P20 A;  4JI8 C;  5BUQ A;  2UXD C;  4DV3 C;  1EGA A;  4X66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...