4DUZC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duzC02
3LUSA 4DCSA 4AQYC 3R9WA 3J7AD 1FJGC 5A2QD 5LMNC 1USPA 4X64C 2UU9C 3CJEA 4YY3C 4DR5C 2F4VC 1N2FA 2ONFA 1IBLC 1N34C 5IWAC 4KHPC 4DUZC 4JYAC 1HR0C 1HH2P 4DR6C 1XMOC 4DCTA 4DCUA 1HNZC 2HHHC 4LFCC 4DR2C 1EGAA 3T1HC 2UUAC 2CXCA 4LF7C 2UUBC 4X65C 2CY1A 2E8CA 2KZFA 3J80D 4K0KC 4DV6C 1ZB8A 4JI6C 1WF3A 4DR7C 4JI8C 5FLXD 1K0RA 3R9XA 4JI3C 2EGTA 2OPLA 4JI7C 2QL8A 3IEVA 1JOSA 2YCBA 1IBKC 4X66C 1ML8A 1ZB9A 4GKJC 4DV3C 4MH4A 4DR3C 1PA4A 3J81D 5BR8C 2D7VA 4MTNA 2E8EA 2HJGA 4JI5C 2OPLB 4DUYC 4JI2C 4LF8C 4LF5C 1XNRC 3I07A 3IEUA 1QWIA 1L2FA 1VLAA 1HNWC 4YHHC 4DV5C 1XMQC 3JAMD 1UKKA 4B3SC 4DCVA 1MKYA 2XR1A 1IBMC 3T1YC 2ZM6C 4B3RC 1WH9A 1J5EC 1HNXC 2VQFC 2E5LC 2ASBA 4LFBC 1N33C 4DR4C 2UXCC 4LF4C 4XX2A 2E8FA 2VQEC 4BSZA 4X62C 2ATWA 2UXBC 1N36C 4B3TC 1I94C 2BJOA 2PT7G 4JI4C 3EERA 3GKUA 4JV5C 4DV4C 4B3MC 3AF5A 3AF6A 4LFAC 1NYEA 1XNQC 2PN2A 1KKGA 2UUCC 4GKKC 4JI1C 5IT9D 4LF6C 4DV0C 2UXDC 2E7GA 4LF9C 1LQLA 4DV7C 4OX9C 1USPB 4JI0C 4DR1C 4NOZA 4DV2C 2DYJA 4NXMC 2JMPA 4NXNC 5LMUC 4DV1C 1N32C 3OTOC
chains in the Genus database with same CATH superfamily
4DCSA 1FJGC 5A2QD 5LMNC 2VZEA 5KYVA 4U5YD 4ZJZA 2F4VC 3NPDA 2DHMA 5IWAC 4DUZC 1HR0C 3L95X 1V25A 3UX3A 1EGAA 1MD9A 3G7SA 4D56A 5KYTA 4EATA 3J80D 4K0KC 2QVZX 5FLXD 4JI3C 2KZ0A 4K0BA 2QL8A 4BCAA 4ZLPA 2E0GA 1P4EC 2OO4A 1IBKC 4R0MA 1MXBA 1IB8A 2Y27A 4DR3C 5CZXA 1FUGA 5BR8C 3ETCA 2OPLB 2QW0X 3PROC 1XNRC 3DAYA 3IEUA 1L2FA 3KXWA 5K85A 1M6XC 1XMQC 1IBMC 2D1SA 1AMUA 2DPLA 2YWBA 4DG8A 3T1YC 1WH9A 4ISBA 2YWCA 4WS9A 3RV2A 2ASBA 3GR0A 4PHTA 1PU1A 3A26A 1LCIA 4B3TC 2PT7G 4JI4C 5BSUA 4DV4C 3CW9A 5T8TA 3AF5A 4G36A 2V7BA 4JI1C 1XRAA 1O9TA 3UEBA 5BUQA 1LQLA 4DV7C 4OX9C 1USPB 3TR3A 4BBYA 4FUQA 4OYCA 3UOWA 4NXNC 1N32C 1GPMA 4I9GA 2D1QA 3CQ3A 2OBVA 2P2QA 4L2ZA 1FLOA 2UU9C 1XRBA 4IR7A 4IZ6A 1O92A 1IBLC 4RLQA 1N34C 5BSRA 2D1RA 3NI2A 4KHPC 2MCQA 1HH2P 1HNZC 3A25A 2YX1A 4LF7C 2UUAC 2CXCA 1O93A 4RVNA 1ZB8A 3IPLA 4JI6C 1MDFA 3AY0A 3TUFA 5K8FA 4TPSB 1K0RA 3R9XA 1T5DX 2OPLA 1JOSA 3O2EA 1P4EA 1ML8A 1ZB9A 3LNVA 4MH4A 3J81D 4HPVA 5DV9A 4MTNA 3GPCA 4JI2C 2NCLA 3I07A 2P2MA 1QWIA 1VLAA 3NYQA 4DV5C 4PZPA 1M6XA 4B3SC 1MKYA 2ZTBA 2ZZMA 4G37A 5LCIA 3LNOA 2ZM6C 1J5EC 3H2TA 1N33C 2WD9A 2P2FA 2E8FA 3LAXA 3B7WA 1N36C 1PG3A 3EERA 4B3MC 4LFAC 2P02A 2M5HA 2PN2A 3E7WA 1BA3A 5IT9D 4LF6C 5AE1A 4DV0C 2E7GA 2MMAB 1P7LA 2P20A 4DR1C 1T5HX 5A1GA 2DYJA 4RLFA 3OTOC 3J7AD 3IMLA 4X64C 3CJEA 4DR5C 2ONFA 3UZ0A 2MM9A 4JYAC 4DR6C 4DCTA 4DCUA 4BC7A 5AE3A 3T1HC 2E8CA 5A19A 4KTVA 3VNRA 4PUGA 4JI7C 2D28C 4FUTA 3IEVA 5IFIA 1RY2A 1V60A 4GKJC 4DV3C 1XDXA 3S82A 1PG4A 2E8EA 1UWDA 4DUYC 4LF5C 4RM2A 4GS5A 4OXIA 1HNWC 4YHHC 4GXRA 4DCVA 2M5OA 4JM1A 4KTTA 2KDNA 2WP0C 3DHVA 4G1IA 2VQFC 4DG9A 4LFBC 2UXCC 2PROA 4BSZA 4X62C 2UXBC 2VSQA 3VNSA 3GKUA 4JV5C 5BURA 1ULTA 5AE2A 4RMNA 1XNQC 1YGTA 1KKGA 2UUCC 4RVOA 2UXDC 3E7XA 5BSWA 3SO4A 3TDEA 1NY8A 3A9UA 3EQ6A 3ETOA 5T8SA 1XRCA 4NXMC 3K6RA 2JMPA 3TQIA 5LMUC 1RG9A 4DV1C 3LUSA 4L4QA 2P2JA 5CZVA 4AQYC 3R9WA 3VNQA 3NYRA 3N2QA 1USPA 3C5EA 3PBKA 4YY3C 2QVYX 1N2FA 3CW8X 2AYAA 4RM3A 1XHJA 4PUHA 4NDNA 3A9VA 5BSMA 2Z51A 1XMOC 2HHHC 4LFCC 4DR2C 4R1LA 2UUBC 4X65C 1TH5A 2CY1A 2KZFA 3A4IA 3FCEA 4GXQA 3PESA 4DV6C 2PG1E 3RG2A 4R1MA 1WF3A 4DR7C 4JI8C 3UX2A 2ZZNA 2EGTA 5H9UA 1QM4A 2CU6A 2YCBA 1VEHA 4BC9A 4X66C 4PROC 5A1IA 2Y4NA 3FCCA 1PA4A 3DLPX 5KEIA 2D7VA 2HJGA 4JI5C 2JNVA 4LF8C 5BSTA 4D4IA 1MDBA 3CQ2A 3JAMD 1UKKA 2P2BA 2XR1A 4LE5A 5BUSA 4I9FA 4D4GA 4B3RC 1HNXC 1V26A 3CQ1A 2BH1X 1XS3A 4WV3A 5BSVA 3GR1A 1MXAA 2E5LC 4L7IA 4DR4C 4LF4C 4XX2A 4D57A 5ADZA 4FTFA 1MXCA 5GTDA 2VQEC 2ATWA 1O90A 3LGXA 1I94C 2BJOA 1WCJA 2QVXX 3R44A 4ODJA 2Y4OA 3AF6A 1NYEA 4GKKC 4LF9C 2D27A 5JRHA 4JI0C 4NOZA 3N54B 4DV2C 4PUIA 3I08A 3L8CA 2D1TA 5E7QA 3FM7A 1YJ7A
chains in the Genus database with same CATH topology
4DCSA 1FJGC 5A2QD 5LMNC 2VZEA 5KYVA 4U5YD 4ZJZA 2F4VC 3NPDA 5IWAC 4DUZC 1HR0C 3L95X 1V25A 1EGAA 1MD9A 3G7SA 4D56A 5KYTA 4EATA 3J80D 4K0KC 2QVZX 5FLXD 4JI3C 4K0BA 2QL8A 4BCAA 4ZLPA 2E0GA 2OO4A 1IBKC 4R0MA 1MXBA 2Y27A 4DR3C 5CZXA 1FUGA 5BR8C 3ETCA 2OPLB 2QW0X 3PROC 1XNRC 3DAYA 3IEUA 1L2FA 3KXWA 5K85A 1XMQC 1IBMC 2D1SA 1AMUA 2DPLA 2YWBA 4DG8A 3T1YC 1WH9A 4ISBA 2YWCA 4WS9A 3RV2A 2ASBA 3GR0A 4PHTA 1LCIA 4B3TC 2PT7G 4JI4C 5BSUA 4DV4C 3CW9A 5T8TA 3AF5A 4G36A 2V7BA 4JI1C 1XRAA 1O9TA 5BUQA 1LQLA 4DV7C 4OX9C 1USPB 4BBYA 4FUQA 4OYCA 3UOWA 4NXNC 1N32C 1GPMA 4I9GA 2D1QA 2OBVA 2P2QA 4L2ZA 2UU9C 1XRBA 4IR7A 4IZ6A 1O92A 1IBLC 4RLQA 1N34C 5BSRA 2D1RA 3NI2A 4KHPC 1HH2P 1HNZC 4LF7C 2UUAC 2CXCA 1O93A 4RVNA 1ZB8A 3IPLA 4JI6C 1MDFA 3TUFA 5K8FA 4TPSB 1K0RA 3R9XA 1T5DX 2OPLA 1JOSA 1ML8A 1ZB9A 3LNVA 4MH4A 3J81D 4HPVA 5DV9A 4MTNA 3GPCA 4JI2C 3I07A 2P2MA 1QWIA 1VLAA 3NYQA 4DV5C 4PZPA 4B3SC 1MKYA 4G37A 2ZM6C 1J5EC 3H2TA 1N33C 2WD9A 2P2FA 2E8FA 3LAXA 3B7WA 1N36C 1PG3A 3EERA 4B3MC 4LFAC 2P02A 2PN2A 3E7WA 1BA3A 5IT9D 4LF6C 5AE1A 4DV0C 2E7GA 1P7LA 2P20A 4DR1C 1T5HX 5A1GA 2DYJA 4RLFA 3OTOC 3J7AD 3IMLA 4X64C 3CJEA 4DR5C 2ONFA 3UZ0A 4JYAC 4DR6C 4DCTA 4DCUA 4BC7A 5AE3A 3T1HC 2E8CA 5A19A 4KTVA 3VNRA 4JI7C 2D28C 4FUTA 3IEVA 5IFIA 1RY2A 4GKJC 4DV3C 3S82A 1PG4A 2E8EA 4DUYC 4LF5C 4RM2A 4GS5A 4OXIA 1HNWC 4YHHC 4GXRA 4DCVA 4JM1A 4KTTA 2WP0C 3DHVA 4G1IA 2VQFC 4DG9A 4LFBC 2UXCC 2PROA 4BSZA 4X62C 2UXBC 2VSQA 3VNSA 3GKUA 4JV5C 5BURA 1ULTA 5AE2A 4RMNA 1XNQC 1KKGA 2UUCC 4RVOA 2UXDC 3E7XA 5BSWA 3SO4A 3TDEA 3A9UA 3EQ6A 3ETOA 5T8SA 1XRCA 4NXMC 2JMPA 3TQIA 5LMUC 1RG9A 4DV1C 3LUSA 4L4QA 2P2JA 5CZVA 4AQYC 3R9WA 3VNQA 3NYRA 3N2QA 1USPA 3C5EA 3PBKA 4YY3C 2QVYX 1N2FA 3CW8X 2AYAA 4RM3A 4NDNA 3A9VA 5BSMA 1XMOC 2HHHC 4LFCC 4DR2C 4R1LA 2UUBC 4X65C 3A4IA 2CY1A 2KZFA 3FCEA 4GXQA 3PESA 4DV6C 3RG2A 4R1MA 1WF3A 4DR7C 4JI8C 2EGTA 5H9UA 1QM4A 2YCBA 4BC9A 4X66C 4PROC 5A1IA 2Y4NA 3FCCA 1PA4A 3DLPX 5KEIA 2D7VA 2HJGA 4JI5C 4LF8C 5BSTA 4D4IA 1MDBA 3JAMD 1UKKA 2P2BA 2XR1A 4LE5A 5BUSA 4I9FA 4D4GA 4B3RC 1HNXC 1V26A 2BH1X 4WV3A 5BSVA 3GR1A 1MXAA 2E5LC 4L7IA 4DR4C 4LF4C 4XX2A 4D57A 5ADZA 4FTFA 1MXCA 5GTDA 2VQEC 2ATWA 1O90A 3LGXA 1I94C 2BJOA 2QVXX 3R44A 4ODJA 2Y4OA 3AF6A 1NYEA 4GKKC 4LF9C 2D27A 5JRHA 4JI0C 4NOZA 3N54B 4DV2C 3I08A 3L8CA 2D1TA 5E7QA 1YJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUS A;  4DCS A;  4AQY C;  3R9W A;  3J7A D;  1FJG C;  5A2Q D;  5LMN C;  1USP A;  4X64 C;  2UU9 C;  3CJE A;  4YY3 C;  4DR5 C;  2F4V C;  1N2F A;  2ONF A;  1IBL C;  1N34 C;  5IWA C;  4KHP C;  4DUZ C;  4JYA C;  1HR0 C;  1HH2 P;  4DR6 C;  1XMO C;  4DCT A;  4DCU A;  1HNZ C;  2HHH C;  4LFC C;  4DR2 C;  1EGA A;  3T1H C;  2UUA C;  2CXC A;  4LF7 C;  2UUB C;  4X65 C;  2CY1 A;  2E8C A;  2KZF A;  3J80 D;  4K0K C;  4DV6 C;  1ZB8 A;  4JI6 C;  1WF3 A;  4DR7 C;  4JI8 C;  5FLX D;  1K0R A;  3R9X A;  4JI3 C;  2EGT A;  2OPL A;  4JI7 C;  2QL8 A;  3IEV A;  1JOS A;  2YCB A;  1IBK C;  4X66 C;  1ML8 A;  1ZB9 A;  4GKJ C;  4DV3 C;  4MH4 A;  4DR3 C;  1PA4 A;  3J81 D;  5BR8 C;  2D7V A;  4MTN A;  2E8E A;  2HJG A;  4JI5 C;  2OPL B;  4DUY C;  4JI2 C;  4LF8 C;  4LF5 C;  1XNR C;  3I07 A;  3IEU A;  1QWI A;  1L2F A;  1VLA A;  1HNW C;  4YHH C;  4DV5 C;  1XMQ C;  3JAM D;  1UKK A;  4B3S C;  4DCV A;  1MKY A;  2XR1 A;  1IBM C;  3T1Y C;  2ZM6 C;  4B3R C;  1WH9 A;  1J5E C;  1HNX C;  2VQF C;  2E5L C;  2ASB A;  4LFB C;  1N33 C;  4DR4 C;  2UXC C;  4LF4 C;  4XX2 A;  2E8F A;  2VQE C;  4BSZ A;  4X62 C;  2ATW A;  2UXB C;  1N36 C;  4B3T C;  1I94 C;  2BJO A;  2PT7 G;  4JI4 C;  3EER A;  3GKU A;  4JV5 C;  4DV4 C;  4B3M C;  3AF5 A;  3AF6 A;  4LFA C;  1NYE A;  1XNQ C;  2PN2 A;  1KKG A;  2UUC C;  4GKK C;  4JI1 C;  5IT9 D;  4LF6 C;  4DV0 C;  2UXD C;  2E7G A;  4LF9 C;  1LQL A;  4DV7 C;  4OX9 C;  1USP B;  4JI0 C;  4DR1 C;  4NOZ A;  4DV2 C;  2DYJ A;  4NXM C;  2JMP A;  4NXN C;  5LMU C;  4DV1 C;  1N32 C;  3OTO C; 
#chains in the Genus database with same CATH topology
 4DCS A;  1FJG C;  5A2Q D;  5LMN C;  2VZE A;  5KYV A;  4U5Y D;  4ZJZ A;  2F4V C;  3NPD A;  2DHM A;  5IWA C;  4DUZ C;  1HR0 C;  3L95 X;  1V25 A;  3UX3 A;  1EGA A;  1MD9 A;  3G7S A;  4D56 A;  5KYT A;  4EAT A;  3J80 D;  4K0K C;  2QVZ X;  5FLX D;  4JI3 C;  2KZ0 A;  4K0B A;  2QL8 A;  4BCA A;  4ZLP A;  2E0G A;  1P4E C;  2OO4 A;  1IBK C;  4R0M A;  1MXB A;  1IB8 A;  2Y27 A;  4DR3 C;  5CZX A;  1FUG A;  5BR8 C;  3ETC A;  2OPL B;  2QW0 X;  3PRO C;  1XNR C;  3DAY A;  3IEU A;  1L2F A;  3KXW A;  5K85 A;  1M6X C;  1XMQ C;  1IBM C;  2D1S A;  1AMU A;  2DPL A;  2YWB A;  4DG8 A;  3T1Y C;  1WH9 A;  4ISB A;  2YWC A;  4WS9 A;  3RV2 A;  2ASB A;  3GR0 A;  4PHT A;  1PU1 A;  3A26 A;  1LCI A;  4B3T C;  2PT7 G;  4JI4 C;  5BSU A;  4DV4 C;  3CW9 A;  5T8T A;  3AF5 A;  4G36 A;  2V7B A;  4JI1 C;  1XRA A;  1O9T A;  3UEB A;  5BUQ A;  1LQL A;  4DV7 C;  4OX9 C;  1USP B;  3TR3 A;  4BBY A;  4FUQ A;  4OYC A;  3UOW A;  4NXN C;  1N32 C;  1GPM A;  4I9G A;  2D1Q A;  3CQ3 A;  2OBV A;  2P2Q A;  4L2Z A;  1FLO A;  2UU9 C;  1XRB A;  4IR7 A;  4IZ6 A;  1O92 A;  1IBL C;  4RLQ A;  1N34 C;  5BSR A;  2D1R A;  3NI2 A;  4KHP C;  2MCQ A;  1HH2 P;  1HNZ C;  3A25 A;  2YX1 A;  4LF7 C;  2UUA C;  2CXC A;  1O93 A;  4RVN A;  1ZB8 A;  3IPL A;  4JI6 C;  1MDF A;  3AY0 A;  3TUF A;  5K8F A;  4TPS B;  1K0R A;  3R9X A;  1T5D X;  2OPL A;  1JOS A;  3O2E A;  1P4E A;  1ML8 A;  1ZB9 A;  3LNV A;  4MH4 A;  3J81 D;  4HPV A;  5DV9 A;  4MTN A;  3GPC A;  4JI2 C;  2NCL A;  3I07 A;  2P2M A;  1QWI A;  1VLA A;  3NYQ A;  4DV5 C;  4PZP A;  1M6X A;  4B3S C;  1MKY A;  2ZTB A;  2ZZM A;  4G37 A;  5LCI A;  3LNO A;  2ZM6 C;  1J5E C;  3H2T A;  1N33 C;  2WD9 A;  2P2F A;  2E8F A;  3LAX A;  3B7W A;  1N36 C;  1PG3 A;  3EER A;  4B3M C;  4LFA C;  2P02 A;  2M5H A;  2PN2 A;  3E7W A;  1BA3 A;  5IT9 D;  4LF6 C;  5AE1 A;  4DV0 C;  2E7G A;  2MMA B;  1P7L A;  2P20 A;  4DR1 C;  1T5H X;  5A1G A;  2DYJ A;  4RLF A;  3OTO C;  3J7A D;  3IML A;  4X64 C;  3CJE A;  4DR5 C;  2ONF A;  3UZ0 A;  2MM9 A;  4JYA C;  4DR6 C;  4DCT A;  4DCU A;  4BC7 A;  5AE3 A;  3T1H C;  2E8C A;  5A19 A;  4KTV A;  3VNR A;  4PUG A;  4JI7 C;  2D28 C;  4FUT A;  3IEV A;  5IFI A;  1RY2 A;  1V60 A;  4GKJ C;  4DV3 C;  1XDX A;  3S82 A;  1PG4 A;  2E8E A;  1UWD A;  4DUY C;  4LF5 C;  4RM2 A;  4GS5 A;  4OXI A;  1HNW C;  4YHH C;  4GXR A;  4DCV A;  2M5O A;  4JM1 A;  4KTT A;  2KDN A;  2WP0 C;  3DHV A;  4G1I A;  2VQF C;  4DG9 A;  4LFB C;  2UXC C;  2PRO A;  4BSZ A;  4X62 C;  2UXB C;  2VSQ A;  3VNS A;  3GKU A;  4JV5 C;  5BUR A;  1ULT A;  5AE2 A;  4RMN A;  1XNQ C;  1YGT A;  1KKG A;  2UUC C;  4RVO A;  2UXD C;  3E7X A;  5BSW A;  3SO4 A;  3TDE A;  1NY8 A;  3A9U A;  3EQ6 A;  3ETO A;  5T8S A;  1XRC A;  4NXM C;  3K6R A;  2JMP A;  3TQI A;  5LMU C;  1RG9 A;  4DV1 C;  3LUS A;  4L4Q A;  2P2J A;  5CZV A;  4AQY C;  3R9W A;  3VNQ A;  3NYR A;  3N2Q A;  1USP A;  3C5E A;  3PBK A;  4YY3 C;  2QVY X;  1N2F A;  3CW8 X;  2AYA A;  4RM3 A;  1XHJ A;  4PUH A;  4NDN A;  3A9V A;  5BSM A;  2Z51 A;  1XMO C;  2HHH C;  4LFC C;  4DR2 C;  4R1L A;  2UUB C;  4X65 C;  1TH5 A;  2CY1 A;  2KZF A;  3A4I A;  3FCE A;  4GXQ A;  3PES A;  4DV6 C;  2PG1 E;  3RG2 A;  4R1M A;  1WF3 A;  4DR7 C;  4JI8 C;  3UX2 A;  2ZZN A;  2EGT A;  5H9U A;  1QM4 A;  2CU6 A;  2YCB A;  1VEH A;  4BC9 A;  4X66 C;  4PRO C;  5A1I A;  2Y4N A;  3FCC A;  1PA4 A;  3DLP X;  5KEI A;  2D7V A;  2HJG A;  4JI5 C;  2JNV A;  4LF8 C;  5BST A;  4D4I A;  1MDB A;  3CQ2 A;  3JAM D;  1UKK A;  2P2B A;  2XR1 A;  4LE5 A;  5BUS A;  4I9F A;  4D4G A;  4B3R C;  1HNX C;  1V26 A;  3CQ1 A;  2BH1 X;  1XS3 A;  4WV3 A;  5BSV A;  3GR1 A;  1MXA A;  2E5L C;  4L7I A;  4DR4 C;  4LF4 C;  4XX2 A;  4D57 A;  5ADZ A;  4FTF A;  1MXC A;  5GTD A;  2VQE C;  2ATW A;  1O90 A;  3LGX A;  1I94 C;  2BJO A;  1WCJ A;  2QVX X;  3R44 A;  4ODJ A;  2Y4O A;  3AF6 A;  1NYE A;  4GKK C;  4LF9 C;  2D27 A;  5JRH A;  4JI0 C;  4NOZ A;  3N54 B;  4DV2 C;  4PUI A;  3I08 A;  3L8C A;  2D1T A;  5E7Q A;  3FM7 A;  1YJ7 A; 
#chains in the Genus database with same CATH homology
 4DCS A;  1FJG C;  5A2Q D;  5LMN C;  2VZE A;  5KYV A;  4U5Y D;  4ZJZ A;  2F4V C;  3NPD A;  5IWA C;  4DUZ C;  1HR0 C;  3L95 X;  1V25 A;  1EGA A;  1MD9 A;  3G7S A;  4D56 A;  5KYT A;  4EAT A;  3J80 D;  4K0K C;  2QVZ X;  5FLX D;  4JI3 C;  4K0B A;  2QL8 A;  4BCA A;  4ZLP A;  2E0G A;  2OO4 A;  1IBK C;  4R0M A;  1MXB A;  2Y27 A;  4DR3 C;  5CZX A;  1FUG A;  5BR8 C;  3ETC A;  2OPL B;  2QW0 X;  3PRO C;  1XNR C;  3DAY A;  3IEU A;  1L2F A;  3KXW A;  5K85 A;  1XMQ C;  1IBM C;  2D1S A;  1AMU A;  2DPL A;  2YWB A;  4DG8 A;  3T1Y C;  1WH9 A;  4ISB A;  2YWC A;  4WS9 A;  3RV2 A;  2ASB A;  3GR0 A;  4PHT A;  1LCI A;  4B3T C;  2PT7 G;  4JI4 C;  5BSU A;  4DV4 C;  3CW9 A;  5T8T A;  3AF5 A;  4G36 A;  2V7B A;  4JI1 C;  1XRA A;  1O9T A;  5BUQ A;  1LQL A;  4DV7 C;  4OX9 C;  1USP B;  4BBY A;  4FUQ A;  4OYC A;  3UOW A;  4NXN C;  1N32 C;  1GPM A;  4I9G A;  2D1Q A;  2OBV A;  2P2Q A;  4L2Z A;  2UU9 C;  1XRB A;  4IR7 A;  4IZ6 A;  1O92 A;  1IBL C;  4RLQ A;  1N34 C;  5BSR A;  2D1R A;  3NI2 A;  4KHP C;  1HH2 P;  1HNZ C;  4LF7 C;  2UUA C;  2CXC A;  1O93 A;  4RVN A;  1ZB8 A;  3IPL A;  4JI6 C;  1MDF A;  3TUF A;  5K8F A;  4TPS B;  1K0R A;  3R9X A;  1T5D X;  2OPL A;  1JOS A;  1ML8 A;  1ZB9 A;  3LNV A;  4MH4 A;  3J81 D;  4HPV A;  5DV9 A;  4MTN A;  3GPC A;  4JI2 C;  3I07 A;  2P2M A;  1QWI A;  1VLA A;  3NYQ A;  4DV5 C;  4PZP A;  4B3S C;  1MKY A;  4G37 A;  2ZM6 C;  1J5E C;  3H2T A;  1N33 C;  2WD9 A;  2P2F A;  2E8F A;  3LAX A;  3B7W A;  1N36 C;  1PG3 A;  3EER A;  4B3M C;  4LFA C;  2P02 A;  2PN2 A;  3E7W A;  1BA3 A;  5IT9 D;  4LF6 C;  5AE1 A;  4DV0 C;  2E7G A;  1P7L A;  2P20 A;  4DR1 C;  1T5H X;  5A1G A;  2DYJ A;  4RLF A;  3OTO C;  3J7A D;  3IML A;  4X64 C;  3CJE A;  4DR5 C;  2ONF A;  3UZ0 A;  4JYA C;  4DR6 C;  4DCT A;  4DCU A;  4BC7 A;  5AE3 A;  3T1H C;  2E8C A;  5A19 A;  4KTV A;  3VNR A;  4JI7 C;  2D28 C;  4FUT A;  3IEV A;  5IFI A;  1RY2 A;  4GKJ C;  4DV3 C;  3S82 A;  1PG4 A;  2E8E A;  4DUY C;  4LF5 C;  4RM2 A;  4GS5 A;  4OXI A;  1HNW C;  4YHH C;  4GXR A;  4DCV A;  4JM1 A;  4KTT A;  2WP0 C;  3DHV A;  4G1I A;  2VQF C;  4DG9 A;  4LFB C;  2UXC C;  2PRO A;  4BSZ A;  4X62 C;  2UXB C;  2VSQ A;  3VNS A;  3GKU A;  4JV5 C;  5BUR A;  1ULT A;  5AE2 A;  4RMN A;  1XNQ C;  1KKG A;  2UUC C;  4RVO A;  2UXD C;  3E7X A;  5BSW A;  3SO4 A;  3TDE A;  3A9U A;  3EQ6 A;  3ETO A;  5T8S A;  1XRC A;  4NXM C;  2JMP A;  3TQI A;  5LMU C;  1RG9 A;  4DV1 C;  3LUS A;  4L4Q A;  2P2J A;  5CZV A;  4AQY C;  3R9W A;  3VNQ A;  3NYR A;  3N2Q A;  1USP A;  3C5E A;  3PBK A;  4YY3 C;  2QVY X;  1N2F A;  3CW8 X;  2AYA A;  4RM3 A;  4NDN A;  3A9V A;  5BSM A;  1XMO C;  2HHH C;  4LFC C;  4DR2 C;  4R1L A;  2UUB C;  4X65 C;  3A4I A;  2CY1 A;  2KZF A;  3FCE A;  4GXQ A;  3PES A;  4DV6 C;  3RG2 A;  4R1M A;  1WF3 A;  4DR7 C;  4JI8 C;  2EGT A;  5H9U A;  1QM4 A;  2YCB A;  4BC9 A;  4X66 C;  4PRO C;  5A1I A;  2Y4N A;  3FCC A;  1PA4 A;  3DLP X;  5KEI A;  2D7V A;  2HJG A;  4JI5 C;  4LF8 C;  5BST A;  4D4I A;  1MDB A;  3JAM D;  1UKK A;  2P2B A;  2XR1 A;  4LE5 A;  5BUS A;  4I9F A;  4D4G A;  4B3R C;  1HNX C;  1V26 A;  2BH1 X;  4WV3 A;  5BSV A;  3GR1 A;  1MXA A;  2E5L C;  4L7I A;  4DR4 C;  4LF4 C;  4XX2 A;  4D57 A;  5ADZ A;  4FTF A;  1MXC A;  5GTD A;  2VQE C;  2ATW A;  1O90 A;  3LGX A;  1I94 C;  2BJO A;  2QVX X;  3R44 A;  4ODJ A;  2Y4O A;  3AF6 A;  1NYE A;  4GKK C;  4LF9 C;  2D27 A;  5JRH A;  4JI0 C;  4NOZ A;  3N54 B;  4DV2 C;  3I08 A;  3L8C A;  2D1T A;  5E7Q A;  1YJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...