4DUZC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duzC02
4OX9C 2OPLB 4X65C 4LF6C 1N33C 5IT9D 3J7AD 2XR1A 2DYJA 4NOZA 2CY1A 5IWAC 4AQYC 1USPB 4DCSA 4DV0C 1N36C 3T1HC 3IEVA 5LMNC 4DUYC 4B3SC 1EGAA 1XMQC 3J81D 4DUZC 4JI5C 2E7GA 1I94C 1MKYA 1XNQC 3JAMD 1ZB9A 2E8EA 4NXMC 4BSZA 1N2FA 1HNZC 4KHPC 4LFAC 2QL8A 5FLXD 4LF9C 1XMOC 4JI6C 1WF3A 1VLAA 2OPLA 4YHHC 2ASBA 4JI7C 1ZB8A 4DV6C 4DR4C 2ZM6C 2E8CA 3OTOC 4DR2C 4DR6C 4JI8C 2VQFC 2UXDC 2JMPA 4JI4C 2PT7G 4LF4C 4GKJC 2UXCC 1USPA 5BR8C 3R9XA 4JI2C 1UKKA 4DR5C 2HHHC 1N32C 1LQLA 3AF6A 4JI0C 1QWIA 5LMUC 1IBMC 2BJOA 2PN2A 2YCBA 4JV5C 3EERA 4DV1C 1NYEA 2E8FA 1K0RA 5A2QD 2UUBC 4B3RC 3GKUA 3I07A 4NXNC 1ML8A 2D7VA 4X66C 4B3MC 4LF7C 1HH2P 4DV3C 1WH9A 1HR0C 1KKGA 2ATWA 1JOSA 2UUAC 4XX2A 4JI1C 4DV7C 3LUSA 4JI3C 3IEUA 4YY3C 1J5EC 3R9WA 2KZFA 2UXBC 4B3TC 3AF5A 3CJEA 1IBKC 4LF8C 4DR1C 4DCTA 4LF5C 2EGTA 1HNWC 4MTNA 4X64C 4JYAC 4DCVA 4DR7C 4K0KC 4DV2C 3T1YC 1XNRC 4LFCC 4DR3C 4MH4A 2UUCC 4X62C 2CXCA 4LFBC 1HNXC 4DV5C 1L2FA 1IBLC 2HJGA 3J80D 1N34C 2UU9C 2F4VC 1FJGC 4GKKC 2E5LC 4DCUA 4DV4C 1PA4A 2VQEC 2ONFA
chains in the Genus database with same CATH superfamily
3TUFA 3C5EA 1LCIA 2XR1A 2P02A 2DYJA 1XRAA 2P2BA 2YWCA 4RM3A 1M6XA 4OYCA 1USPB 1XRBA 2MM9A 3ETCA 1N36C 1GPMA 3T1HC 3TDEA 2M5HA 4B3SC 1V60A 2D1QA 3G7SA 3J81D 3DHVA 4PUIA 1ZB9A 4LFAC 2QL8A 2VZEA 1WF3A 3RV2A 2OPLA 1MXBA 1IB8A 3LNOA 2ASBA 4JI7C 4DV6C 4DR4C 2ZM6C 2UXDC 2VQFC 3ETOA 2JMPA 4GKJC 2ZTBA 4RVOA 1PG4A 1O90A 3RG2A 1UKKA 4DR5C 4JI2C 1N32C 4PUGA 1LQLA 4PUHA 3A25A 2JNVA 5LMUC 2BH1X 2Y4OA 1P4EA 4L2ZA 3GKUA 1AMUA 2KDNA 1TH5A 1HH2P 1HR0C 2D1TA 3IMLA 5E7QA 2UUAC 4JI1C 1T5HX 4PROC 1MDFA 1NY8A 3IEUA 4R1MA 3R9WA 4RLQA 2KZ0A 5A19A 2Z51A 3UEBA 1T5DX 4DCTA 3GR1A 1HNWC 4DCVA 4K0KC 4G1IA 3A4IA 3VNSA 3T1YC 4L4QA 4I9GA 3FM7A 2MCQA 3IPLA 1O9TA 2CXCA 4LFBC 1IBLC 3J80D 2QW0X 4JM1A 2MMAB 4DV4C 5T8SA 3CW8X 3J7AD 4AQYC 2NCLA 3LAXA 3CQ1A 4DCSA 4DV0C 3L95X 3IEVA 5LMNC 3A9UA 5CZXA 4DUZC 2P2MA 2OO4A 1O92A 4BSZA 1N2FA 3CQ2A 3FCEA 3PESA 1HNZC 2P2JA 1YJ7A 4KHPC 4LF9C 3GPCA 4JI6C 2YWBA 3A9VA 4KTVA 4R1LA 1ZB8A 1MDBA 2D1SA 4RM2A 2E8CA 3OTOC 4DR2C 1M6XC 5BSTA 3LNVA 1V26A 4D4GA 3AF6A 4WS9A 4ISBA 4TPSB 1WCJA 2BJOA 4DV1C 4FUTA 1K0RA 3L8CA 3LGXA 2P20A 3I07A 4NXNC 4X66C 2D7VA 4DV3C 3TR3A 3LUSA 2QVXX 4YY3C 1J5EC 2KZFA 2UXBC 4EATA 1IBKC 2E0GA 5AE2A 4MTNA 4JYAC 1XRCA 5BURA 1XNRC 4MH4A 2UUCC 3AY0A 5K85A 1HNXC 4PHTA 3NYRA 1L2FA 2DPLA 4GKKC 2E5LC 3R44A 4DCUA 1P4EC 2VQEC 2ONFA 4LF5C 2OPLB 4OX9C 1MXAA 2OBVA 4X65C 4LF6C 1N33C 1V25A 2CY1A 4BBYA 5IWAC 2M5OA 4HPVA 3E7XA 5AE3A 3PROC 1MD9A 4DUYC 1EGAA 3VNRA 5AE1A 1XMQC 4PZPA 4BC9A 2E7GA 1I94C 1XNQC 3PBKA 3JAMD 2PG1E 2Y27A 3VNQA 2E8EA 4NXMC 1FUGA 3UZ0A 4WV3A 5FLXD 2PROA 2DHMA 1VLAA 4YHHC 4IR7A 5LCIA 4JI4C 5BSMA 5A1GA 1USPA 5BSWA 1MXCA 4U5YD 4FUQA 2HHHC 4K0BA 2YCBA 3EERA 3N54B 1NYEA 4DG8A 3N2QA 2E8FA 2UUBC 5CZVA 5BUQA 1BA3A 1ML8A 4B3MC 2AYAA 4LF7C 1PG3A 4DG9A 1WH9A 5KEIA 1KKGA 2D27A 1JOSA 2QVYX 4JI3C 4OXIA 5T8TA 5JRHA 2WP0C 3SO4A 4LF8C 4GS5A 4D56A 1XDXA 4L7IA 2EGTA 4X64C 3NI2A 4DR7C 5K8FA 4DV2C 4D4IA 4DR3C 5ADZA 3I08A 3UX2A 2WD9A 4X62C 2V7BA 4GXQA 4G37A 2HJGA 3EQ6A 1N34C 3B7WA 2UU9C 2F4VC 3CW9A 3CQ3A 5IT9D 2YX1A 5DV9A 2ZZNA 3NYQA 5H9UA 4NOZA 4I9FA 4RLFA 4RMNA 5GTDA 4RVNA 3K6RA 3UX3A 3S82A 5BSUA 3DLPX 4JI5C 4R0MA 1MKYA 1XMOC 1P7LA 3TQIA 4ODJA 1FLOA 2CU6A 5KYTA 4DR6C 1O93A 4JI8C 2PT7G 2D1RA 4LF4C 2UXCC 5KYVA 4FTFA 5BR8C 3R9XA 1ULTA 3E7WA 3A26A 1QM4A 2Y4NA 4JI0C 4ZJZA 1QWIA 1IBMC 2PN2A 4JV5C 4LE5A 2P2FA 4BC7A 1XS3A 5A2QD 4B3RC 4D57A 3GR0A 3KXWA 4ZLPA 3UOWA 4BCAA 1UWDA 2D28C 2ATWA 3NPDA 4GXRA 2ZZMA 4XX2A 4DV7C 2P2QA 5IFIA 4B3TC 5A1IA 3AF5A 3CJEA 4G36A 4DR1C 1XHJA 5BUSA 3DAYA 4IZ6A 4NDNA 4LFCC 5BSVA 1VEHA 1RY2A 3FCCA 1RG9A 4DV5C 5BSRA 1YGTA 1FJGC 3O2EA 4KTTA 2VSQA 1PU1A 1PA4A 2QVZX 3H2TA
chains in the Genus database with same CATH topology
3TUFA 3C5EA 1LCIA 2XR1A 2P02A 2DYJA 1XRAA 2P2BA 2YWCA 4RM3A 4OYCA 1USPB 1XRBA 3ETCA 1N36C 1GPMA 3T1HC 3TDEA 4B3SC 2D1QA 3G7SA 3J81D 3DHVA 1ZB9A 4LFAC 2QL8A 2VZEA 1WF3A 3RV2A 2OPLA 1MXBA 2ASBA 4JI7C 4DV6C 4DR4C 2ZM6C 2UXDC 2VQFC 3ETOA 2JMPA 4GKJC 4RVOA 1PG4A 1O90A 3RG2A 1UKKA 4DR5C 4JI2C 1N32C 1LQLA 5LMUC 2BH1X 2Y4OA 4L2ZA 3GKUA 1AMUA 1HH2P 1HR0C 2D1TA 3IMLA 5E7QA 2UUAC 4JI1C 1T5HX 4PROC 1MDFA 3IEUA 4R1MA 3R9WA 4RLQA 5A19A 4DCTA 1T5DX 3GR1A 1HNWC 4DCVA 4K0KC 4G1IA 3A4IA 3VNSA 3T1YC 4L4QA 4I9GA 3IPLA 1O9TA 2CXCA 4LFBC 1IBLC 3J80D 2QW0X 4JM1A 4DV4C 5T8SA 3CW8X 3J7AD 4AQYC 3LAXA 4DCSA 4DV0C 3L95X 3IEVA 5LMNC 3A9UA 5CZXA 4DUZC 2P2MA 2OO4A 1O92A 4BSZA 1N2FA 3FCEA 1HNZC 3PESA 2P2JA 1YJ7A 4KHPC 4LF9C 3GPCA 4JI6C 2YWBA 3A9VA 4KTVA 4R1LA 1ZB8A 1MDBA 2D1SA 4RM2A 2E8CA 3OTOC 4DR2C 5BSTA 3LNVA 1V26A 4D4GA 3AF6A 4WS9A 4ISBA 4TPSB 2BJOA 4DV1C 4FUTA 1K0RA 3L8CA 3LGXA 2P20A 3I07A 4NXNC 4X66C 2D7VA 4DV3C 3LUSA 2QVXX 4YY3C 1J5EC 2KZFA 2UXBC 4EATA 1IBKC 2E0GA 5AE2A 4MTNA 4JYAC 1XRCA 5BURA 1XNRC 4MH4A 2UUCC 5K85A 1HNXC 4PHTA 3NYRA 1L2FA 2DPLA 4GKKC 2E5LC 3R44A 4DCUA 2VQEC 2ONFA 4LF5C 2OPLB 4OX9C 1MXAA 2OBVA 4X65C 4LF6C 1N33C 1V25A 2CY1A 4BBYA 5IWAC 4HPVA 3E7XA 5AE3A 3PROC 1MD9A 4DUYC 1EGAA 3VNRA 5AE1A 1XMQC 4PZPA 4BC9A 2E7GA 1I94C 1XNQC 3PBKA 3JAMD 2Y27A 3VNQA 2E8EA 4NXMC 1FUGA 3UZ0A 4WV3A 5FLXD 2PROA 1VLAA 4YHHC 4IR7A 4JI4C 5BSMA 5A1GA 1USPA 5BSWA 1MXCA 4U5YD 4FUQA 2HHHC 4K0BA 2YCBA 3EERA 3N54B 1NYEA 4DG8A 3N2QA 2E8FA 2UUBC 5CZVA 5BUQA 1BA3A 1ML8A 4B3MC 2AYAA 4LF7C 1PG3A 4DG9A 1WH9A 5KEIA 1KKGA 2D27A 1JOSA 2QVYX 4JI3C 4OXIA 5T8TA 5JRHA 2WP0C 3SO4A 4LF8C 4GS5A 4D56A 4L7IA 2EGTA 4X64C 3NI2A 4DR7C 5K8FA 4DV2C 4D4IA 4DR3C 5ADZA 3I08A 2WD9A 4X62C 2V7BA 4GXQA 4G37A 2HJGA 3EQ6A 1N34C 3B7WA 2UU9C 2F4VC 3CW9A 5IT9D 5DV9A 3NYQA 5H9UA 4NOZA 4I9FA 4RLFA 4RMNA 5GTDA 4RVNA 3S82A 5BSUA 3DLPX 4JI5C 4R0MA 1MKYA 1XMOC 1P7LA 3TQIA 4ODJA 5KYTA 4DR6C 1O93A 4JI8C 2PT7G 2D1RA 4LF4C 2UXCC 5KYVA 4FTFA 5BR8C 3R9XA 1ULTA 3E7WA 1QM4A 2Y4NA 4JI0C 4ZJZA 1QWIA 1IBMC 2PN2A 4JV5C 4LE5A 2P2FA 4BC7A 5A2QD 4B3RC 4D57A 3GR0A 3KXWA 4ZLPA 3UOWA 4BCAA 2D28C 2ATWA 3NPDA 4GXRA 4XX2A 4DV7C 2P2QA 5IFIA 4B3TC 5A1IA 3AF5A 3CJEA 4G36A 4DR1C 5BUSA 3DAYA 4IZ6A 4NDNA 4LFCC 5BSVA 1RY2A 3FCCA 1RG9A 4DV5C 5BSRA 1FJGC 4KTTA 2VSQA 1PA4A 2QVZX 3H2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 C;  2OPL B;  4X65 C;  4LF6 C;  1N33 C;  5IT9 D;  3J7A D;  2XR1 A;  2DYJ A;  4NOZ A;  2CY1 A;  5IWA C;  4AQY C;  1USP B;  4DCS A;  4DV0 C;  1N36 C;  3T1H C;  3IEV A;  5LMN C;  4DUY C;  4B3S C;  1EGA A;  1XMQ C;  3J81 D;  4DUZ C;  4JI5 C;  2E7G A;  1I94 C;  1MKY A;  1XNQ C;  3JAM D;  1ZB9 A;  2E8E A;  4NXM C;  4BSZ A;  1N2F A;  1HNZ C;  4KHP C;  4LFA C;  2QL8 A;  5FLX D;  4LF9 C;  1XMO C;  4JI6 C;  1WF3 A;  1VLA A;  2OPL A;  4YHH C;  2ASB A;  4JI7 C;  1ZB8 A;  4DV6 C;  4DR4 C;  2ZM6 C;  2E8C A;  3OTO C;  4DR2 C;  4DR6 C;  4JI8 C;  2VQF C;  2UXD C;  2JMP A;  4JI4 C;  2PT7 G;  4LF4 C;  4GKJ C;  2UXC C;  1USP A;  5BR8 C;  3R9X A;  4JI2 C;  1UKK A;  4DR5 C;  2HHH C;  1N32 C;  1LQL A;  3AF6 A;  4JI0 C;  1QWI A;  5LMU C;  1IBM C;  2BJO A;  2PN2 A;  2YCB A;  4JV5 C;  3EER A;  4DV1 C;  1NYE A;  2E8F A;  1K0R A;  5A2Q D;  2UUB C;  4B3R C;  3GKU A;  3I07 A;  4NXN C;  1ML8 A;  2D7V A;  4X66 C;  4B3M C;  4LF7 C;  1HH2 P;  4DV3 C;  1WH9 A;  1HR0 C;  1KKG A;  2ATW A;  1JOS A;  2UUA C;  4XX2 A;  4JI1 C;  4DV7 C;  3LUS A;  4JI3 C;  3IEU A;  4YY3 C;  1J5E C;  3R9W A;  2KZF A;  2UXB C;  4B3T C;  3AF5 A;  3CJE A;  1IBK C;  4LF8 C;  4DR1 C;  4DCT A;  4LF5 C;  2EGT A;  1HNW C;  4MTN A;  4X64 C;  4JYA C;  4DCV A;  4DR7 C;  4K0K C;  4DV2 C;  3T1Y C;  1XNR C;  4LFC C;  4DR3 C;  4MH4 A;  2UUC C;  4X62 C;  2CXC A;  4LFB C;  1HNX C;  4DV5 C;  1L2F A;  1IBL C;  2HJG A;  3J80 D;  1N34 C;  2UU9 C;  2F4V C;  1FJG C;  4GKK C;  2E5L C;  4DCU A;  4DV4 C;  1PA4 A;  2VQE C;  2ONF A; 
#chains in the Genus database with same CATH topology
 3TUF A;  3C5E A;  1LCI A;  2XR1 A;  2P02 A;  2DYJ A;  1XRA A;  2P2B A;  2YWC A;  4RM3 A;  1M6X A;  4OYC A;  1USP B;  1XRB A;  2MM9 A;  3ETC A;  1N36 C;  1GPM A;  3T1H C;  3TDE A;  2M5H A;  4B3S C;  1V60 A;  2D1Q A;  3G7S A;  3J81 D;  3DHV A;  4PUI A;  1ZB9 A;  4LFA C;  2QL8 A;  2VZE A;  1WF3 A;  3RV2 A;  2OPL A;  1MXB A;  1IB8 A;  3LNO A;  2ASB A;  4JI7 C;  4DV6 C;  4DR4 C;  2ZM6 C;  2UXD C;  2VQF C;  3ETO A;  2JMP A;  4GKJ C;  2ZTB A;  4RVO A;  1PG4 A;  1O90 A;  3RG2 A;  1UKK A;  4DR5 C;  4JI2 C;  1N32 C;  4PUG A;  1LQL A;  4PUH A;  3A25 A;  2JNV A;  5LMU C;  2BH1 X;  2Y4O A;  1P4E A;  4L2Z A;  3GKU A;  1AMU A;  2KDN A;  1TH5 A;  1HH2 P;  1HR0 C;  2D1T A;  3IML A;  5E7Q A;  2UUA C;  4JI1 C;  1T5H X;  4PRO C;  1MDF A;  1NY8 A;  3IEU A;  4R1M A;  3R9W A;  4RLQ A;  2KZ0 A;  5A19 A;  2Z51 A;  3UEB A;  1T5D X;  4DCT A;  3GR1 A;  1HNW C;  4DCV A;  4K0K C;  4G1I A;  3A4I A;  3VNS A;  3T1Y C;  4L4Q A;  4I9G A;  3FM7 A;  2MCQ A;  3IPL A;  1O9T A;  2CXC A;  4LFB C;  1IBL C;  3J80 D;  2QW0 X;  4JM1 A;  2MMA B;  4DV4 C;  5T8S A;  3CW8 X;  3J7A D;  4AQY C;  2NCL A;  3LAX A;  3CQ1 A;  4DCS A;  4DV0 C;  3L95 X;  3IEV A;  5LMN C;  3A9U A;  5CZX A;  4DUZ C;  2P2M A;  2OO4 A;  1O92 A;  4BSZ A;  1N2F A;  3CQ2 A;  3FCE A;  3PES A;  1HNZ C;  2P2J A;  1YJ7 A;  4KHP C;  4LF9 C;  3GPC A;  4JI6 C;  2YWB A;  3A9V A;  4KTV A;  4R1L A;  1ZB8 A;  1MDB A;  2D1S A;  4RM2 A;  2E8C A;  3OTO C;  4DR2 C;  1M6X C;  5BST A;  3LNV A;  1V26 A;  4D4G A;  3AF6 A;  4WS9 A;  4ISB A;  4TPS B;  1WCJ A;  2BJO A;  4DV1 C;  4FUT A;  1K0R A;  3L8C A;  3LGX A;  2P20 A;  3I07 A;  4NXN C;  4X66 C;  2D7V A;  4DV3 C;  3TR3 A;  3LUS A;  2QVX X;  4YY3 C;  1J5E C;  2KZF A;  2UXB C;  4EAT A;  1IBK C;  2E0G A;  5AE2 A;  4MTN A;  4JYA C;  1XRC A;  5BUR A;  1XNR C;  4MH4 A;  2UUC C;  3AY0 A;  5K85 A;  1HNX C;  4PHT A;  3NYR A;  1L2F A;  2DPL A;  4GKK C;  2E5L C;  3R44 A;  4DCU A;  1P4E C;  2VQE C;  2ONF A;  4LF5 C;  2OPL B;  4OX9 C;  1MXA A;  2OBV A;  4X65 C;  4LF6 C;  1N33 C;  1V25 A;  2CY1 A;  4BBY A;  5IWA C;  2M5O A;  4HPV A;  3E7X A;  5AE3 A;  3PRO C;  1MD9 A;  4DUY C;  1EGA A;  3VNR A;  5AE1 A;  1XMQ C;  4PZP A;  4BC9 A;  2E7G A;  1I94 C;  1XNQ C;  3PBK A;  3JAM D;  2PG1 E;  2Y27 A;  3VNQ A;  2E8E A;  4NXM C;  1FUG A;  3UZ0 A;  4WV3 A;  5FLX D;  2PRO A;  2DHM A;  1VLA A;  4YHH C;  4IR7 A;  5LCI A;  4JI4 C;  5BSM A;  5A1G A;  1USP A;  5BSW A;  1MXC A;  4U5Y D;  4FUQ A;  2HHH C;  4K0B A;  2YCB A;  3EER A;  3N54 B;  1NYE A;  4DG8 A;  3N2Q A;  2E8F A;  2UUB C;  5CZV A;  5BUQ A;  1BA3 A;  1ML8 A;  4B3M C;  2AYA A;  4LF7 C;  1PG3 A;  4DG9 A;  1WH9 A;  5KEI A;  1KKG A;  2D27 A;  1JOS A;  2QVY X;  4JI3 C;  4OXI A;  5T8T A;  5JRH A;  2WP0 C;  3SO4 A;  4LF8 C;  4GS5 A;  4D56 A;  1XDX A;  4L7I A;  2EGT A;  4X64 C;  3NI2 A;  4DR7 C;  5K8F A;  4DV2 C;  4D4I A;  4DR3 C;  5ADZ A;  3I08 A;  3UX2 A;  2WD9 A;  4X62 C;  2V7B A;  4GXQ A;  4G37 A;  2HJG A;  3EQ6 A;  1N34 C;  3B7W A;  2UU9 C;  2F4V C;  3CW9 A;  3CQ3 A;  5IT9 D;  2YX1 A;  5DV9 A;  2ZZN A;  3NYQ A;  5H9U A;  4NOZ A;  4I9F A;  4RLF A;  4RMN A;  5GTD A;  4RVN A;  3K6R A;  3UX3 A;  3S82 A;  5BSU A;  3DLP X;  4JI5 C;  4R0M A;  1MKY A;  1XMO C;  1P7L A;  3TQI A;  4ODJ A;  1FLO A;  2CU6 A;  5KYT A;  4DR6 C;  1O93 A;  4JI8 C;  2PT7 G;  2D1R A;  4LF4 C;  2UXC C;  5KYV A;  4FTF A;  5BR8 C;  3R9X A;  1ULT A;  3E7W A;  3A26 A;  1QM4 A;  2Y4N A;  4JI0 C;  4ZJZ A;  1QWI A;  1IBM C;  2PN2 A;  4JV5 C;  4LE5 A;  2P2F A;  4BC7 A;  1XS3 A;  5A2Q D;  4B3R C;  4D57 A;  3GR0 A;  3KXW A;  4ZLP A;  3UOW A;  4BCA A;  1UWD A;  2D28 C;  2ATW A;  3NPD A;  4GXR A;  2ZZM A;  4XX2 A;  4DV7 C;  2P2Q A;  5IFI A;  4B3T C;  5A1I A;  3AF5 A;  3CJE A;  4G36 A;  4DR1 C;  1XHJ A;  5BUS A;  3DAY A;  4IZ6 A;  4NDN A;  4LFC C;  5BSV A;  1VEH A;  1RY2 A;  3FCC A;  1RG9 A;  4DV5 C;  5BSR A;  1YGT A;  1FJG C;  3O2E A;  4KTT A;  2VSQ A;  1PU1 A;  1PA4 A;  2QVZ X;  3H2T A; 
#chains in the Genus database with same CATH homology
 3TUF A;  3C5E A;  1LCI A;  2XR1 A;  2P02 A;  2DYJ A;  1XRA A;  2P2B A;  2YWC A;  4RM3 A;  4OYC A;  1USP B;  1XRB A;  3ETC A;  1N36 C;  1GPM A;  3T1H C;  3TDE A;  4B3S C;  2D1Q A;  3G7S A;  3J81 D;  3DHV A;  1ZB9 A;  4LFA C;  2QL8 A;  2VZE A;  1WF3 A;  3RV2 A;  2OPL A;  1MXB A;  2ASB A;  4JI7 C;  4DV6 C;  4DR4 C;  2ZM6 C;  2UXD C;  2VQF C;  3ETO A;  2JMP A;  4GKJ C;  4RVO A;  1PG4 A;  1O90 A;  3RG2 A;  1UKK A;  4DR5 C;  4JI2 C;  1N32 C;  1LQL A;  5LMU C;  2BH1 X;  2Y4O A;  4L2Z A;  3GKU A;  1AMU A;  1HH2 P;  1HR0 C;  2D1T A;  3IML A;  5E7Q A;  2UUA C;  4JI1 C;  1T5H X;  4PRO C;  1MDF A;  3IEU A;  4R1M A;  3R9W A;  4RLQ A;  5A19 A;  4DCT A;  1T5D X;  3GR1 A;  1HNW C;  4DCV A;  4K0K C;  4G1I A;  3A4I A;  3VNS A;  3T1Y C;  4L4Q A;  4I9G A;  3IPL A;  1O9T A;  2CXC A;  4LFB C;  1IBL C;  3J80 D;  2QW0 X;  4JM1 A;  4DV4 C;  5T8S A;  3CW8 X;  3J7A D;  4AQY C;  3LAX A;  4DCS A;  4DV0 C;  3L95 X;  3IEV A;  5LMN C;  3A9U A;  5CZX A;  4DUZ C;  2P2M A;  2OO4 A;  1O92 A;  4BSZ A;  1N2F A;  3FCE A;  1HNZ C;  3PES A;  2P2J A;  1YJ7 A;  4KHP C;  4LF9 C;  3GPC A;  4JI6 C;  2YWB A;  3A9V A;  4KTV A;  4R1L A;  1ZB8 A;  1MDB A;  2D1S A;  4RM2 A;  2E8C A;  3OTO C;  4DR2 C;  5BST A;  3LNV A;  1V26 A;  4D4G A;  3AF6 A;  4WS9 A;  4ISB A;  4TPS B;  2BJO A;  4DV1 C;  4FUT A;  1K0R A;  3L8C A;  3LGX A;  2P20 A;  3I07 A;  4NXN C;  4X66 C;  2D7V A;  4DV3 C;  3LUS A;  2QVX X;  4YY3 C;  1J5E C;  2KZF A;  2UXB C;  4EAT A;  1IBK C;  2E0G A;  5AE2 A;  4MTN A;  4JYA C;  1XRC A;  5BUR A;  1XNR C;  4MH4 A;  2UUC C;  5K85 A;  1HNX C;  4PHT A;  3NYR A;  1L2F A;  2DPL A;  4GKK C;  2E5L C;  3R44 A;  4DCU A;  2VQE C;  2ONF A;  4LF5 C;  2OPL B;  4OX9 C;  1MXA A;  2OBV A;  4X65 C;  4LF6 C;  1N33 C;  1V25 A;  2CY1 A;  4BBY A;  5IWA C;  4HPV A;  3E7X A;  5AE3 A;  3PRO C;  1MD9 A;  4DUY C;  1EGA A;  3VNR A;  5AE1 A;  1XMQ C;  4PZP A;  4BC9 A;  2E7G A;  1I94 C;  1XNQ C;  3PBK A;  3JAM D;  2Y27 A;  3VNQ A;  2E8E A;  4NXM C;  1FUG A;  3UZ0 A;  4WV3 A;  5FLX D;  2PRO A;  1VLA A;  4YHH C;  4IR7 A;  4JI4 C;  5BSM A;  5A1G A;  1USP A;  5BSW A;  1MXC A;  4U5Y D;  4FUQ A;  2HHH C;  4K0B A;  2YCB A;  3EER A;  3N54 B;  1NYE A;  4DG8 A;  3N2Q A;  2E8F A;  2UUB C;  5CZV A;  5BUQ A;  1BA3 A;  1ML8 A;  4B3M C;  2AYA A;  4LF7 C;  1PG3 A;  4DG9 A;  1WH9 A;  5KEI A;  1KKG A;  2D27 A;  1JOS A;  2QVY X;  4JI3 C;  4OXI A;  5T8T A;  5JRH A;  2WP0 C;  3SO4 A;  4LF8 C;  4GS5 A;  4D56 A;  4L7I A;  2EGT A;  4X64 C;  3NI2 A;  4DR7 C;  5K8F A;  4DV2 C;  4D4I A;  4DR3 C;  5ADZ A;  3I08 A;  2WD9 A;  4X62 C;  2V7B A;  4GXQ A;  4G37 A;  2HJG A;  3EQ6 A;  1N34 C;  3B7W A;  2UU9 C;  2F4V C;  3CW9 A;  5IT9 D;  5DV9 A;  3NYQ A;  5H9U A;  4NOZ A;  4I9F A;  4RLF A;  4RMN A;  5GTD A;  4RVN A;  3S82 A;  5BSU A;  3DLP X;  4JI5 C;  4R0M A;  1MKY A;  1XMO C;  1P7L A;  3TQI A;  4ODJ A;  5KYT A;  4DR6 C;  1O93 A;  4JI8 C;  2PT7 G;  2D1R A;  4LF4 C;  2UXC C;  5KYV A;  4FTF A;  5BR8 C;  3R9X A;  1ULT A;  3E7W A;  1QM4 A;  2Y4N A;  4JI0 C;  4ZJZ A;  1QWI A;  1IBM C;  2PN2 A;  4JV5 C;  4LE5 A;  2P2F A;  4BC7 A;  5A2Q D;  4B3R C;  4D57 A;  3GR0 A;  3KXW A;  4ZLP A;  3UOW A;  4BCA A;  2D28 C;  2ATW A;  3NPD A;  4GXR A;  4XX2 A;  4DV7 C;  2P2Q A;  5IFI A;  4B3T C;  5A1I A;  3AF5 A;  3CJE A;  4G36 A;  4DR1 C;  5BUS A;  3DAY A;  4IZ6 A;  4NDN A;  4LFC C;  5BSV A;  1RY2 A;  3FCC A;  1RG9 A;  4DV5 C;  5BSR A;  1FJG C;  4KTT A;  2VSQ A;  1PA4 A;  2QVZ X;  3H2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...