4DUZC

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 42
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4duzC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4duzC02
1JOSA 2UUBC 3J80D 4JI4C 4DCUA 4K0KC 4JI5C 2E7GA 4LFCC 1XMOC 5BR8C 3OTOC 1IBMC 1QWIA 2PN2A 3J7AD 4LF4C 4LF6C 4DR2C 1XMQC 4DR5C 1L2FA 3T1YC 4DV5C 4NOZA 4JI3C 4B3SC 2EGTA 2UU9C 4JI2C 3AF6A 1LQLA 1HNWC 2ZM6C 3AF5A 2VQEC 2HJGA 4DUYC 2UUAC 1KKGA 2XR1A 1FJGC 2CXCA 4LF8C 4LFBC 1N36C 4JI6C 3R9WA 1N2FA 2E8EA 4MTNA 3IEVA 5IWAC 4JI8C 4JV5C 1HR0C 4YY3C 3CJEA 2CY1A 1I94C 5LMUC 1N34C 4X64C 4DR6C 2YCBA 1XNQC 4LF7C 4LF9C 4MH4A 2HHHC 1WH9A 1IBKC 2OPLA 3LUSA 5FLXD 5LMNC 4B3MC 1WF3A 4GKJC 1N33C 2KZFA 4XX2A 5A2QD 4DR1C 2DYJA 4DV3C 1USPA 3EERA 4JI1C 2UXBC 4DR4C 1XNRC 3IEUA 5IT9D 2D7VA 1NYEA 2JMPA 3T1HC 1HH2P 1UKKA 4YHHC 4DV0C 1IBLC 2ONFA 2E8FA 4JI7C 3R9XA 4OX9C 1PA4A 4B3TC 2OPLB 4JYAC 4DR3C 1K0RA 4X62C 4X65C 2VQFC 1HNZC 4DUZC 3I07A 1VLAA 1ML8A 2UUCC 2E5LC 4LFAC 4NXMC 2UXCC 4NXNC 4JI0C 3JAMD 2BJOA 1USPB 4DR7C 4GKKC 4DV7C 1ZB8A 2E8CA 4DCTA 4LF5C 4DV2C 4DV6C 2QL8A 1J5EC 1N32C 1MKYA 1EGAA 4DCVA 4KHPC 2F4VC 4B3RC 4X66C 4DV1C 4BSZA 2ATWA 3GKUA 2PT7G 3J81D 1HNXC 1ZB9A 2ASBA 4DV4C 2UXDC 4DCSA 4AQYC
chains in the Genus database with same CATH superfamily
1GPMA 3UZ0A 5BSRA 4JI5C 4I9FA 1YJ7A 2OO4A 4ZLPA 3OTOC 3J7AD 4DR5C 4DV5C 4TPSB 1PG3A 3AF6A 3I08A 4RLFA 3N2QA 4LFBC 3B7WA 3LGXA 4NDNA 1N2FA 1IB8A 4JV5C 3CJEA 3CW8X 5KYVA 2NCLA 5H9UA 4KTTA 1XNQC 1WCJA 4MH4A 2M5HA 1IBKC 5FLXD 5LMNC 4B3MC 1N33C 3UX2A 2D1RA 2WD9A 1XDXA 2DYJA 3FCCA 2YWBA 4D56A 4JI1C 3DHVA 2D1TA 4RVNA 4DR4C 4BCAA 5IT9D 1MDFA 4RMNA 3UOWA 1UKKA 4DV0C 1IBLC 3A4IA 3R44A 5BUQA 2ZTBA 5BSTA 4B3TC 5A19A 4JYAC 2MCQA 3GR1A 1MD9A 4FUTA 1TH5A 2UUCC 4D4GA 4NXMC 4JI0C 2P2FA 2P20A 1MXBA 2WP0C 1USPB 2KDNA 4DCTA 4LF5C 2QL8A 4U5YD 3C5EA 3PESA 1EGAA 3H2TA 3E7XA 3IPLA 4KHPC 2F4VC 2QVYX 4DV1C 1AMUA 3J81D 1HNXC 3CQ3A 4DCSA 1P7LA 5BSUA 4PUIA 1JOSA 4EATA 2BH1X 3LNOA 3J80D 3ETOA 4JI4C 4K0KC 2P02A 3SO4A 1V26A 5BR8C 2PN2A 5DV9A 4RM2A 3E7WA 1L2FA 4GS5A 3G7SA 4OYCA 1LQLA 1HNWC 4L4QA 3AF5A 1KKGA 4BBYA 3A25A 3PROC 4LF8C 2VSQA 2DHMA 4WS9A 1N36C 3IEVA 4I9GA 4OXIA 1MXCA 3A9UA 2AYAA 1I94C 4IR7A 4PROC 1N34C 4LF7C 4LF9C 1BA3A 2HHHC 2OPLA 3RG2A 2KZ0A 4R1MA 5AE3A 1M6XA 4GKJC 4GXRA 4XX2A 1XRAA 4FUQA 3EERA 3UEBA 5BURA 3UX3A 1XRBA 2PROA 2V7BA 3T1HC 1HH2P 2ONFA 2E8FA 2MM9A 1PA4A 5K8FA 1ULTA 5A1IA 4DR3C 1MXAA 4JM1A 4DUZC 3NPDA 2E5LC 1RG9A 1MDBA 1T5DX 1PU1A 4DR7C 1ZB8A 2E8CA 4PUGA 1J5EC 3TQIA 4KTVA 4DCVA 4DG9A 2P2JA 3TUFA 3TR3A 4BSZA 3NI2A 3EQ6A 5K85A 4DV4C 3A26A 1XRCA 4AQYC 4ODJA 3TDEA 2UUBC 4DCUA 2E7GA 3CQ1A 3DLPX 2DPLA 4LFCC 4DG8A 1O93A 4IZ6A 1M6XC 4LF4C 2P2MA 3GR0A 2M5OA 4DR2C 5KEIA 3GPCA 3T1YC 4NOZA 4B3SC 2UU9C 4JI2C 4G36A 2ZM6C 4DUYC 2UUAC 5T8SA 3CQ2A 4BC9A 1UWDA 4GXQA 5A1GA 2JNVA 2E8EA 4MTNA 5IWAC 5T8TA 1P4EA 4L2ZA 2CY1A 4HPVA 4DR6C 2YCBA 4G1IA 3NYQA 1WH9A 5LCIA 1WF3A 3L8CA 5E7QA 3N54B 2P2BA 5A2QD 4K0BA 4DR1C 4R1LA 4DV3C 2UXBC 3IEUA 5AE1A 1NYEA 4YHHC 5GTDA 3R9XA 4OX9C 1QM4A 3VNSA 2PG1E 2OPLB 1T5HX 2D1QA 1K0RA 3S82A 4X65C 1O92A 2Y27A 1HNZC 4D57A 1ML8A 2MMAB 2ZZMA 5BSWA 4NXNC 3JAMD 2BJOA 4GKKC 4DV2C 4DV6C 1N32C 1XHJA 4X66C 4PZPA 2P2QA 2VZEA 2ATWA 5CZVA 1XS3A 3AY0A 2PT7G 2ASBA 3IMLA 5BUSA 1V25A 2UXDC 4LE5A 4RVOA 4R0MA 1P4EC 1XMOC 1NY8A 2E0GA 1IBMC 1QWIA 4ISBA 2D28C 4LF6C 3A9VA 1XMQC 4JI3C 4BC7A 1O90A 3DAYA 5BSMA 2EGTA 5CZXA 3CW9A 2VQEC 2HJGA 2XR1A 1FJGC 2CXCA 5BSVA 3K6RA 4JI6C 4L7IA 3R9WA 5IFIA 2ZZNA 5KYTA 4RLQA 2QVXX 2CU6A 4JI8C 4FTFA 1HR0C 4YY3C 5LMUC 4WV3A 3VNRA 4X64C 2Y4NA 4RM3A 3LUSA 1O9TA 2KZFA 1YGTA 1FUGA 4D4IA 3FCEA 2YX1A 2Y4OA 3LAXA 3O2EA 1V60A 1USPA 3LNVA 2D1SA 5AE2A 1XNRC 1VEHA 2D7VA 2JMPA 2QVZX 1FLOA 4JI7C 3KXWA 2D27A 5ADZA 3RV2A 4X62C 2Z51A 3VNQA 4ZJZA 2VQFC 3NYRA 3I07A 1RY2A 1VLAA 4LFAC 2UXCC 1LCIA 3FM7A 1PG4A 4DV7C 2OBVA 5JRHA 1MKYA 2QW0X 4B3RC 3ETCA 3GKUA 4PUHA 4G37A 1ZB9A 3PBKA 4PHTA 2YWCA 3L95X
chains in the Genus database with same CATH topology
1GPMA 3UZ0A 5BSRA 4JI5C 4I9FA 1YJ7A 2OO4A 4ZLPA 3OTOC 3J7AD 4DR5C 4DV5C 4TPSB 1PG3A 3AF6A 3I08A 4RLFA 3N2QA 4LFBC 3B7WA 3LGXA 4NDNA 1N2FA 4JV5C 3CJEA 3CW8X 5KYVA 5H9UA 4KTTA 1XNQC 4MH4A 1IBKC 5FLXD 5LMNC 4B3MC 1N33C 2D1RA 2WD9A 2DYJA 3FCCA 2YWBA 4D56A 4JI1C 3DHVA 2D1TA 4RVNA 4DR4C 4BCAA 5IT9D 1MDFA 4RMNA 3UOWA 1UKKA 4DV0C 1IBLC 3A4IA 3R44A 5BUQA 5BSTA 4B3TC 5A19A 4JYAC 3GR1A 1MD9A 4FUTA 2UUCC 4D4GA 4NXMC 4JI0C 2P2FA 2P20A 1MXBA 2WP0C 1USPB 4DCTA 4LF5C 2QL8A 4U5YD 3C5EA 3PESA 1EGAA 3H2TA 3E7XA 3IPLA 4KHPC 2F4VC 2QVYX 4DV1C 1AMUA 3J81D 1HNXC 4DCSA 1P7LA 5BSUA 1JOSA 4EATA 2BH1X 3J80D 3ETOA 4JI4C 4K0KC 2P02A 3SO4A 1V26A 5BR8C 2PN2A 5DV9A 4RM2A 3E7WA 1L2FA 4GS5A 3G7SA 4OYCA 1LQLA 1HNWC 4L4QA 3AF5A 1KKGA 4BBYA 3PROC 4LF8C 2VSQA 4WS9A 1N36C 3IEVA 4I9GA 4OXIA 1MXCA 3A9UA 2AYAA 1I94C 4IR7A 4PROC 1N34C 4LF7C 4LF9C 1BA3A 2HHHC 2OPLA 3RG2A 4R1MA 5AE3A 4GKJC 4GXRA 4XX2A 1XRAA 4FUQA 3EERA 5BURA 1XRBA 2PROA 2V7BA 3T1HC 1HH2P 2ONFA 2E8FA 1PA4A 5K8FA 1ULTA 5A1IA 4DR3C 1MXAA 4JM1A 4DUZC 3NPDA 2E5LC 1RG9A 1MDBA 1T5DX 4DR7C 1ZB8A 2E8CA 1J5EC 3TQIA 4KTVA 4DCVA 4DG9A 2P2JA 3TUFA 4BSZA 3NI2A 3EQ6A 5K85A 4DV4C 1XRCA 4AQYC 4ODJA 3TDEA 2UUBC 4DCUA 2E7GA 3DLPX 2DPLA 4LFCC 4DG8A 1O93A 4IZ6A 4LF4C 2P2MA 3GR0A 4DR2C 5KEIA 3GPCA 3T1YC 4NOZA 4B3SC 2UU9C 4JI2C 4G36A 2ZM6C 4DUYC 2UUAC 5T8SA 4BC9A 4GXQA 5A1GA 2E8EA 4MTNA 5IWAC 5T8TA 4L2ZA 2CY1A 4HPVA 4DR6C 2YCBA 4G1IA 3NYQA 1WH9A 1WF3A 3L8CA 5E7QA 3N54B 2P2BA 5A2QD 4K0BA 4DR1C 4R1LA 4DV3C 2UXBC 3IEUA 5AE1A 1NYEA 4YHHC 5GTDA 3R9XA 4OX9C 1QM4A 3VNSA 2OPLB 1T5HX 2D1QA 1K0RA 3S82A 4X65C 1O92A 2Y27A 1HNZC 4D57A 1ML8A 5BSWA 4NXNC 3JAMD 2BJOA 4GKKC 4DV2C 4DV6C 1N32C 4X66C 4PZPA 2P2QA 2VZEA 2ATWA 5CZVA 2PT7G 2ASBA 3IMLA 5BUSA 1V25A 2UXDC 4LE5A 4RVOA 4R0MA 1XMOC 2E0GA 1IBMC 1QWIA 4ISBA 2D28C 4LF6C 3A9VA 1XMQC 4JI3C 4BC7A 1O90A 3DAYA 5BSMA 2EGTA 5CZXA 3CW9A 2VQEC 2HJGA 2XR1A 1FJGC 2CXCA 5BSVA 4JI6C 4L7IA 3R9WA 5IFIA 5KYTA 4RLQA 2QVXX 4JI8C 4FTFA 1HR0C 4YY3C 5LMUC 4WV3A 3VNRA 4X64C 2Y4NA 4RM3A 3LUSA 1O9TA 2KZFA 1FUGA 4D4IA 3FCEA 2Y4OA 3LAXA 3LNVA 1USPA 2D1SA 5AE2A 1XNRC 2D7VA 2JMPA 2QVZX 4JI7C 3KXWA 2D27A 5ADZA 3RV2A 4X62C 3VNQA 4ZJZA 2VQFC 3NYRA 3I07A 1RY2A 1VLAA 4LFAC 2UXCC 1LCIA 1PG4A 4DV7C 2OBVA 5JRHA 1MKYA 2QW0X 4B3RC 3ETCA 3GKUA 4G37A 1ZB9A 3PBKA 4PHTA 2YWCA 3L95X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOS A;  2UUB C;  3J80 D;  4JI4 C;  4DCU A;  4K0K C;  4JI5 C;  2E7G A;  4LFC C;  1XMO C;  5BR8 C;  3OTO C;  1IBM C;  1QWI A;  2PN2 A;  3J7A D;  4LF4 C;  4LF6 C;  4DR2 C;  1XMQ C;  4DR5 C;  1L2F A;  3T1Y C;  4DV5 C;  4NOZ A;  4JI3 C;  4B3S C;  2EGT A;  2UU9 C;  4JI2 C;  3AF6 A;  1LQL A;  1HNW C;  2ZM6 C;  3AF5 A;  2VQE C;  2HJG A;  4DUY C;  2UUA C;  1KKG A;  2XR1 A;  1FJG C;  2CXC A;  4LF8 C;  4LFB C;  1N36 C;  4JI6 C;  3R9W A;  1N2F A;  2E8E A;  4MTN A;  3IEV A;  5IWA C;  4JI8 C;  4JV5 C;  1HR0 C;  4YY3 C;  3CJE A;  2CY1 A;  1I94 C;  5LMU C;  1N34 C;  4X64 C;  4DR6 C;  2YCB A;  1XNQ C;  4LF7 C;  4LF9 C;  4MH4 A;  2HHH C;  1WH9 A;  1IBK C;  2OPL A;  3LUS A;  5FLX D;  5LMN C;  4B3M C;  1WF3 A;  4GKJ C;  1N33 C;  2KZF A;  4XX2 A;  5A2Q D;  4DR1 C;  2DYJ A;  4DV3 C;  1USP A;  3EER A;  4JI1 C;  2UXB C;  4DR4 C;  1XNR C;  3IEU A;  5IT9 D;  2D7V A;  1NYE A;  2JMP A;  3T1H C;  1HH2 P;  1UKK A;  4YHH C;  4DV0 C;  1IBL C;  2ONF A;  2E8F A;  4JI7 C;  3R9X A;  4OX9 C;  1PA4 A;  4B3T C;  2OPL B;  4JYA C;  4DR3 C;  1K0R A;  4X62 C;  4X65 C;  2VQF C;  1HNZ C;  4DUZ C;  3I07 A;  1VLA A;  1ML8 A;  2UUC C;  2E5L C;  4LFA C;  4NXM C;  2UXC C;  4NXN C;  4JI0 C;  3JAM D;  2BJO A;  1USP B;  4DR7 C;  4GKK C;  4DV7 C;  1ZB8 A;  2E8C A;  4DCT A;  4LF5 C;  4DV2 C;  4DV6 C;  2QL8 A;  1J5E C;  1N32 C;  1MKY A;  1EGA A;  4DCV A;  4KHP C;  2F4V C;  4B3R C;  4X66 C;  4DV1 C;  4BSZ A;  2ATW A;  3GKU A;  2PT7 G;  3J81 D;  1HNX C;  1ZB9 A;  2ASB A;  4DV4 C;  2UXD C;  4DCS A;  4AQY C; 
#chains in the Genus database with same CATH topology
 1GPM A;  3UZ0 A;  5BSR A;  4JI5 C;  4I9F A;  1YJ7 A;  2OO4 A;  4ZLP A;  3OTO C;  3J7A D;  4DR5 C;  4DV5 C;  4TPS B;  1PG3 A;  3AF6 A;  3I08 A;  4RLF A;  3N2Q A;  4LFB C;  3B7W A;  3LGX A;  4NDN A;  1N2F A;  1IB8 A;  4JV5 C;  3CJE A;  3CW8 X;  5KYV A;  2NCL A;  5H9U A;  4KTT A;  1XNQ C;  1WCJ A;  4MH4 A;  2M5H A;  1IBK C;  5FLX D;  5LMN C;  4B3M C;  1N33 C;  3UX2 A;  2D1R A;  2WD9 A;  1XDX A;  2DYJ A;  3FCC A;  2YWB A;  4D56 A;  4JI1 C;  3DHV A;  2D1T A;  4RVN A;  4DR4 C;  4BCA A;  5IT9 D;  1MDF A;  4RMN A;  3UOW A;  1UKK A;  4DV0 C;  1IBL C;  3A4I A;  3R44 A;  5BUQ A;  2ZTB A;  5BST A;  4B3T C;  5A19 A;  4JYA C;  2MCQ A;  3GR1 A;  1MD9 A;  4FUT A;  1TH5 A;  2UUC C;  4D4G A;  4NXM C;  4JI0 C;  2P2F A;  2P20 A;  1MXB A;  2WP0 C;  1USP B;  2KDN A;  4DCT A;  4LF5 C;  2QL8 A;  4U5Y D;  3C5E A;  3PES A;  1EGA A;  3H2T A;  3E7X A;  3IPL A;  4KHP C;  2F4V C;  2QVY X;  4DV1 C;  1AMU A;  3J81 D;  1HNX C;  3CQ3 A;  4DCS A;  1P7L A;  5BSU A;  4PUI A;  1JOS A;  4EAT A;  2BH1 X;  3LNO A;  3J80 D;  3ETO A;  4JI4 C;  4K0K C;  2P02 A;  3SO4 A;  1V26 A;  5BR8 C;  2PN2 A;  5DV9 A;  4RM2 A;  3E7W A;  1L2F A;  4GS5 A;  3G7S A;  4OYC A;  1LQL A;  1HNW C;  4L4Q A;  3AF5 A;  1KKG A;  4BBY A;  3A25 A;  3PRO C;  4LF8 C;  2VSQ A;  2DHM A;  4WS9 A;  1N36 C;  3IEV A;  4I9G A;  4OXI A;  1MXC A;  3A9U A;  2AYA A;  1I94 C;  4IR7 A;  4PRO C;  1N34 C;  4LF7 C;  4LF9 C;  1BA3 A;  2HHH C;  2OPL A;  3RG2 A;  2KZ0 A;  4R1M A;  5AE3 A;  1M6X A;  4GKJ C;  4GXR A;  4XX2 A;  1XRA A;  4FUQ A;  3EER A;  3UEB A;  5BUR A;  3UX3 A;  1XRB A;  2PRO A;  2V7B A;  3T1H C;  1HH2 P;  2ONF A;  2E8F A;  2MM9 A;  1PA4 A;  5K8F A;  1ULT A;  5A1I A;  4DR3 C;  1MXA A;  4JM1 A;  4DUZ C;  3NPD A;  2E5L C;  1RG9 A;  1MDB A;  1T5D X;  1PU1 A;  4DR7 C;  1ZB8 A;  2E8C A;  4PUG A;  1J5E C;  3TQI A;  4KTV A;  4DCV A;  4DG9 A;  2P2J A;  3TUF A;  3TR3 A;  4BSZ A;  3NI2 A;  3EQ6 A;  5K85 A;  4DV4 C;  3A26 A;  1XRC A;  4AQY C;  4ODJ A;  3TDE A;  2UUB C;  4DCU A;  2E7G A;  3CQ1 A;  3DLP X;  2DPL A;  4LFC C;  4DG8 A;  1O93 A;  4IZ6 A;  1M6X C;  4LF4 C;  2P2M A;  3GR0 A;  2M5O A;  4DR2 C;  5KEI A;  3GPC A;  3T1Y C;  4NOZ A;  4B3S C;  2UU9 C;  4JI2 C;  4G36 A;  2ZM6 C;  4DUY C;  2UUA C;  5T8S A;  3CQ2 A;  4BC9 A;  1UWD A;  4GXQ A;  5A1G A;  2JNV A;  2E8E A;  4MTN A;  5IWA C;  5T8T A;  1P4E A;  4L2Z A;  2CY1 A;  4HPV A;  4DR6 C;  2YCB A;  4G1I A;  3NYQ A;  1WH9 A;  5LCI A;  1WF3 A;  3L8C A;  5E7Q A;  3N54 B;  2P2B A;  5A2Q D;  4K0B A;  4DR1 C;  4R1L A;  4DV3 C;  2UXB C;  3IEU A;  5AE1 A;  1NYE A;  4YHH C;  5GTD A;  3R9X A;  4OX9 C;  1QM4 A;  3VNS A;  2PG1 E;  2OPL B;  1T5H X;  2D1Q A;  1K0R A;  3S82 A;  4X65 C;  1O92 A;  2Y27 A;  1HNZ C;  4D57 A;  1ML8 A;  2MMA B;  2ZZM A;  5BSW A;  4NXN C;  3JAM D;  2BJO A;  4GKK C;  4DV2 C;  4DV6 C;  1N32 C;  1XHJ A;  4X66 C;  4PZP A;  2P2Q A;  2VZE A;  2ATW A;  5CZV A;  1XS3 A;  3AY0 A;  2PT7 G;  2ASB A;  3IML A;  5BUS A;  1V25 A;  2UXD C;  4LE5 A;  4RVO A;  4R0M A;  1P4E C;  1XMO C;  1NY8 A;  2E0G A;  1IBM C;  1QWI A;  4ISB A;  2D28 C;  4LF6 C;  3A9V A;  1XMQ C;  4JI3 C;  4BC7 A;  1O90 A;  3DAY A;  5BSM A;  2EGT A;  5CZX A;  3CW9 A;  2VQE C;  2HJG A;  2XR1 A;  1FJG C;  2CXC A;  5BSV A;  3K6R A;  4JI6 C;  4L7I A;  3R9W A;  5IFI A;  2ZZN A;  5KYT A;  4RLQ A;  2QVX X;  2CU6 A;  4JI8 C;  4FTF A;  1HR0 C;  4YY3 C;  5LMU C;  4WV3 A;  3VNR A;  4X64 C;  2Y4N A;  4RM3 A;  3LUS A;  1O9T A;  2KZF A;  1YGT A;  1FUG A;  4D4I A;  3FCE A;  2YX1 A;  2Y4O A;  3LAX A;  3O2E A;  1V60 A;  1USP A;  3LNV A;  2D1S A;  5AE2 A;  1XNR C;  1VEH A;  2D7V A;  2JMP A;  2QVZ X;  1FLO A;  4JI7 C;  3KXW A;  2D27 A;  5ADZ A;  3RV2 A;  4X62 C;  2Z51 A;  3VNQ A;  4ZJZ A;  2VQF C;  3NYR A;  3I07 A;  1RY2 A;  1VLA A;  4LFA C;  2UXC C;  1LCI A;  3FM7 A;  1PG4 A;  4DV7 C;  2OBV A;  5JRH A;  1MKY A;  2QW0 X;  4B3R C;  3ETC A;  3GKU A;  4PUH A;  4G37 A;  1ZB9 A;  3PBK A;  4PHT A;  2YWC A;  3L95 X; 
#chains in the Genus database with same CATH homology
 1GPM A;  3UZ0 A;  5BSR A;  4JI5 C;  4I9F A;  1YJ7 A;  2OO4 A;  4ZLP A;  3OTO C;  3J7A D;  4DR5 C;  4DV5 C;  4TPS B;  1PG3 A;  3AF6 A;  3I08 A;  4RLF A;  3N2Q A;  4LFB C;  3B7W A;  3LGX A;  4NDN A;  1N2F A;  4JV5 C;  3CJE A;  3CW8 X;  5KYV A;  5H9U A;  4KTT A;  1XNQ C;  4MH4 A;  1IBK C;  5FLX D;  5LMN C;  4B3M C;  1N33 C;  2D1R A;  2WD9 A;  2DYJ A;  3FCC A;  2YWB A;  4D56 A;  4JI1 C;  3DHV A;  2D1T A;  4RVN A;  4DR4 C;  4BCA A;  5IT9 D;  1MDF A;  4RMN A;  3UOW A;  1UKK A;  4DV0 C;  1IBL C;  3A4I A;  3R44 A;  5BUQ A;  5BST A;  4B3T C;  5A19 A;  4JYA C;  3GR1 A;  1MD9 A;  4FUT A;  2UUC C;  4D4G A;  4NXM C;  4JI0 C;  2P2F A;  2P20 A;  1MXB A;  2WP0 C;  1USP B;  4DCT A;  4LF5 C;  2QL8 A;  4U5Y D;  3C5E A;  3PES A;  1EGA A;  3H2T A;  3E7X A;  3IPL A;  4KHP C;  2F4V C;  2QVY X;  4DV1 C;  1AMU A;  3J81 D;  1HNX C;  4DCS A;  1P7L A;  5BSU A;  1JOS A;  4EAT A;  2BH1 X;  3J80 D;  3ETO A;  4JI4 C;  4K0K C;  2P02 A;  3SO4 A;  1V26 A;  5BR8 C;  2PN2 A;  5DV9 A;  4RM2 A;  3E7W A;  1L2F A;  4GS5 A;  3G7S A;  4OYC A;  1LQL A;  1HNW C;  4L4Q A;  3AF5 A;  1KKG A;  4BBY A;  3PRO C;  4LF8 C;  2VSQ A;  4WS9 A;  1N36 C;  3IEV A;  4I9G A;  4OXI A;  1MXC A;  3A9U A;  2AYA A;  1I94 C;  4IR7 A;  4PRO C;  1N34 C;  4LF7 C;  4LF9 C;  1BA3 A;  2HHH C;  2OPL A;  3RG2 A;  4R1M A;  5AE3 A;  4GKJ C;  4GXR A;  4XX2 A;  1XRA A;  4FUQ A;  3EER A;  5BUR A;  1XRB A;  2PRO A;  2V7B A;  3T1H C;  1HH2 P;  2ONF A;  2E8F A;  1PA4 A;  5K8F A;  1ULT A;  5A1I A;  4DR3 C;  1MXA A;  4JM1 A;  4DUZ C;  3NPD A;  2E5L C;  1RG9 A;  1MDB A;  1T5D X;  4DR7 C;  1ZB8 A;  2E8C A;  1J5E C;  3TQI A;  4KTV A;  4DCV A;  4DG9 A;  2P2J A;  3TUF A;  4BSZ A;  3NI2 A;  3EQ6 A;  5K85 A;  4DV4 C;  1XRC A;  4AQY C;  4ODJ A;  3TDE A;  2UUB C;  4DCU A;  2E7G A;  3DLP X;  2DPL A;  4LFC C;  4DG8 A;  1O93 A;  4IZ6 A;  4LF4 C;  2P2M A;  3GR0 A;  4DR2 C;  5KEI A;  3GPC A;  3T1Y C;  4NOZ A;  4B3S C;  2UU9 C;  4JI2 C;  4G36 A;  2ZM6 C;  4DUY C;  2UUA C;  5T8S A;  4BC9 A;  4GXQ A;  5A1G A;  2E8E A;  4MTN A;  5IWA C;  5T8T A;  4L2Z A;  2CY1 A;  4HPV A;  4DR6 C;  2YCB A;  4G1I A;  3NYQ A;  1WH9 A;  1WF3 A;  3L8C A;  5E7Q A;  3N54 B;  2P2B A;  5A2Q D;  4K0B A;  4DR1 C;  4R1L A;  4DV3 C;  2UXB C;  3IEU A;  5AE1 A;  1NYE A;  4YHH C;  5GTD A;  3R9X A;  4OX9 C;  1QM4 A;  3VNS A;  2OPL B;  1T5H X;  2D1Q A;  1K0R A;  3S82 A;  4X65 C;  1O92 A;  2Y27 A;  1HNZ C;  4D57 A;  1ML8 A;  5BSW A;  4NXN C;  3JAM D;  2BJO A;  4GKK C;  4DV2 C;  4DV6 C;  1N32 C;  4X66 C;  4PZP A;  2P2Q A;  2VZE A;  2ATW A;  5CZV A;  2PT7 G;  2ASB A;  3IML A;  5BUS A;  1V25 A;  2UXD C;  4LE5 A;  4RVO A;  4R0M A;  1XMO C;  2E0G A;  1IBM C;  1QWI A;  4ISB A;  2D28 C;  4LF6 C;  3A9V A;  1XMQ C;  4JI3 C;  4BC7 A;  1O90 A;  3DAY A;  5BSM A;  2EGT A;  5CZX A;  3CW9 A;  2VQE C;  2HJG A;  2XR1 A;  1FJG C;  2CXC A;  5BSV A;  4JI6 C;  4L7I A;  3R9W A;  5IFI A;  5KYT A;  4RLQ A;  2QVX X;  4JI8 C;  4FTF A;  1HR0 C;  4YY3 C;  5LMU C;  4WV3 A;  3VNR A;  4X64 C;  2Y4N A;  4RM3 A;  3LUS A;  1O9T A;  2KZF A;  1FUG A;  4D4I A;  3FCE A;  2Y4O A;  3LAX A;  3LNV A;  1USP A;  2D1S A;  5AE2 A;  1XNR C;  2D7V A;  2JMP A;  2QVZ X;  4JI7 C;  3KXW A;  2D27 A;  5ADZ A;  3RV2 A;  4X62 C;  3VNQ A;  4ZJZ A;  2VQF C;  3NYR A;  3I07 A;  1RY2 A;  1VLA A;  4LFA C;  2UXC C;  1LCI A;  1PG4 A;  4DV7 C;  2OBV A;  5JRH A;  1MKY A;  2QW0 X;  4B3R C;  3ETC A;  3GKU A;  4G37 A;  1ZB9 A;  3PBK A;  4PHT A;  2YWC A;  3L95 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...