3T1HC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3t1hC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3t1hC02
1NYEA 3IEVA 1XNQC 3JAMD 3OTOC 3AF6A 1IBMC 4JI0C 1J5EC 4LFAC 3AF5A 4X65C 4DR7C 4B3MC 3GKUA 4JI5C 2UXCC 2EGTA 4DR5C 2UU9C 4X64C 4DV0C 2OPLB 1MKYA 3R9WA 4JI6C 1WH9A 2KZFA 4DCTA 1QWIA 4DV5C 3I07A 2PN2A 5LMNC 4DV7C 4MH4A 1IBLC 1USPA 4DR2C 2CY1A 4JI4C 4DV6C 1N33C 4NOZA 4DCSA 4GKKC 4LFCC 1LQLA 1N36C 2HHHC 4DR3C 4B3RC 4DR1C 4DV2C 2CXCA 2D7VA 1HR0C 4X66C 4DCVA 5BR8C 4JI3C 2YCBA 2E8FA 1I94C 3J80D 2UUCC 4OX9C 2ZM6C 3CJEA 4NXNC 4YHHC 1N2FA 2OPLA 5IWAC 3EERA 4DV4C 1N34C 4GKJC 4DR4C 4JI8C 2QL8A 4YY3C 2HJGA 1VLAA 4X62C 1WF3A 5LMUC 1IBKC 4B3TC 1EGAA 4AQYC 5IT9D 4B3SC 4LFBC 4LF7C 2DYJA 3LUSA 1XMOC 4DUZC 3R9XA 4MTNA 2E8CA 1ZB8A 4DV1C 5FLXD 3T1HC 1K0RA 2F4VC 4KHPC 1PA4A 4JYAC 1HH2P 1FJGC 1ZB9A 2UXBC 4LF5C 2JMPA 1HNZC 2E8EA 2XR1A 4DV3C 2BJOA 1HNXC 2E5LC 4LF4C 4BSZA 2ASBA 4LF9C 1JOSA 3IEUA 2UUAC 2VQEC 2ONFA 3T1YC 1HNWC 2ATWA 4LF8C 1KKGA 1UKKA 2E7GA 2PT7G 4XX2A 1XMQC 2VQFC 4K0KC 1ML8A 4DUYC 2UUBC 4JI2C 1USPB 4JI1C 1XNRC 1L2FA 3J7AD 1N32C 2UXDC 3J81D 4DCUA 4NXMC 4JI7C 4JV5C 4LF6C 4DR6C 5A2QD
chains in the Genus database with same CATH superfamily
4PUGA 3N2QA 4D57A 3NYQA 5IFIA 4X65C 4B3MC 3GKUA 3L95X 4DR5C 4RVOA 2OPLB 3UX2A 2KZFA 3VNRA 4DV5C 3I07A 3VNSA 1XDXA 3O2EA 4DR2C 1YGTA 1N33C 4DCSA 2QW0X 2D1QA 1N36C 1PG3A 4DR3C 3LGXA 5LCIA 2V7BA 4B3RC 5BSUA 4G37A 5BR8C 4JI3C 2YCBA 5BSVA 3J80D 4OX9C 2ZM6C 1N2FA 4R1LA 3E7XA 3EERA 5A1IA 3CQ1A 3NPDA 4NDNA 4G36A 4IR7A 1WF3A 2ZZNA 2MMAB 2YWBA 3DLPX 4DG9A 2DYJA 1XHJA 3A4IA 4MTNA 5T8SA 1P7LA 4ODJA 4JYAC 1K0RA 1PA4A 4I9FA 3EQ6A 1GPMA 2KZ0A 3L8CA 2UXBC 2E5LC 2WP0C 5KYTA 2PG1E 2P2BA 5DV9A 3ETCA 1VEHA 4I9GA 4PHTA 3RG2A 2PT7G 4XX2A 1XMQC 3CQ2A 3FCEA 1ML8A 4PUIA 1M6XC 3GR0A 2DHMA 2ZTBA 1MXAA 5BSWA 2QVYX 2UXDC 4L4QA 5AE2A 5K85A 3B7WA 1LCIA 3IEVA 1XRCA 4KTTA 3JAMD 3ETOA 4JI0C 1J5EC 3A9UA 3UEBA 3SO4A 4X64C 4DV0C 4HPVA 3TDEA 5A19A 4GXQA 4JI6C 5BSTA 5LMNC 3A26A 1USPA 4DV6C 4L2ZA 4GXRA 3RV2A 1LQLA 3K6RA 3NYRA 4KTVA 4DR1C 4DV2C 2CXCA 1PU1A 2D7VA 4DCVA 2D27A 3C5EA 2PROA 3GR1A 2ZZMA 4WS9A 4FUTA 5IWAC 2VZEA 4DV4C 1N34C 5A1GA 4ZLPA 4DR4C 5CZXA 4ZJZA 4YY3C 2HJGA 4BCAA 4LE5A 4AQYC 1MXBA 1BA3A 5BUQA 4BC7A 4RLFA 4RLQA 3LUSA 4DUZC 1UWDA 4DV1C 3T1HC 2KDNA 2P2MA 2VSQA 4OYCA 2P2JA 1FJGC 1RG9A 3TR3A 4LF5C 1MXCA 2JMPA 2BJOA 3AY0A 4LF9C 1PG4A 3IMLA 1JOSA 1P4EA 2OO4A 2ONFA 1MDFA 4EATA 2ATWA 3TUFA 1YJ7A 1UKKA 2E7GA 5BSMA 2Y27A 2VQFC 4DUYC 2UUBC 3FM7A 5H9UA 4JI2C 1USPB 4JI1C 1V25A 5JRHA 1L2FA 5T8TA 3J7AD 2D1TA 3DHVA 3PBKA 5A2QD 5ADZA 2BH1X 4B3TC 1NYEA 1XNQC 1WCJA 3OTOC 3AF6A 3PESA 4L7IA 2E0GA 1IBMC 1O90A 1FLOA 3A25A 4RMNA 3AF5A 2EGTA 2UU9C 4R1MA 3A9VA 2P20A 1MKYA 1WH9A 3GPCA 1QWIA 2PN2A 4MH4A 1IBLC 4D56A 3KXWA 4JI4C 1MD9A 4RVNA 2D1SA 2YWCA 2Z51A 2HHHC 2OBVA 3PROC 4GS5A 4TPSB 4D4IA 1T5DX 4X66C 1V60A 3TQIA 3I08A 2E8FA 1I94C 2WD9A 3N54B 3CJEA 5BUSA 1O9TA 1QM4A 2YX1A 5CZVA 1VLAA 2DPLA 1IBKC 5LMUC 4LFBC 3IPLA 4ISBA 4LF7C 1XRBA 1XMOC 4G1IA 3R9XA 4KHPC 1HH2P 4IZ6A 4K0BA 1T5HX 4DG8A 1ZB9A 1XS3A 2E8EA 2XR1A 4LF4C 2ASBA 1RY2A 3IEUA 2UUAC 1P4EC 5KYVA 5AE3A 2D1RA 4PZPA 3VNQA 1XRAA 4BC9A 3S82A 4PUHA 4FTFA 4JI7C 4JV5C 2JNVA 3DAYA 4R0MA 3CW9A 1FUGA 5GTDA 4LFAC 3FCCA 4DR7C 4JI5C 2UXCC 5BURA 4D4GA 2QVZX 3NI2A 3R9WA 2P2QA 4DCTA 2MM9A 4DV7C 2P2FA 4U5YD 2M5HA 5BSRA 2CY1A 4WV3A 4NOZA 4GKKC 4LFCC 2AYAA 2QVXX 3R44A 1V26A 2D28C 5E7QA 1TH5A 1HR0C 2UUCC 2CU6A 4NXNC 4YHHC 2OPLA 1ULTA 3LNOA 4GKJC 4JI8C 2QL8A 1MDBA 4RM2A 4X62C 4FUQA 1IB8A 1EGAA 5IT9D 3UOWA 4B3SC 1O93A 2E8CA 5KEIA 1ZB8A 5FLXD 2F4VC 4OXIA 2P02A 4JM1A 3UZ0A 1O92A 1HNZC 1HNXC 4DV3C 4BSZA 5AE1A 3CW8X 3LAXA 3CQ3A 2VQEC 3G7SA 4PROC 3T1YC 1HNWC 4LF8C 1KKGA 2NCLA 2MCQA 4RM3A 1NY8A 2M5OA 3E7WA 4K0KC 1M6XA 1AMUA 3UX3A 5K8FA 4BBYA 2Y4NA 3H2TA 1XNRC 3LNVA 1N32C 3J81D 2Y4OA 4DCUA 4NXMC 4LF6C 4DR6C
chains in the Genus database with same CATH topology
3N2QA 4D57A 3NYQA 5IFIA 4X65C 4B3MC 3GKUA 3L95X 4DR5C 4RVOA 2OPLB 2KZFA 3VNRA 4DV5C 3I07A 3VNSA 4DR2C 1N33C 4DCSA 2QW0X 2D1QA 1N36C 1PG3A 4DR3C 3LGXA 2V7BA 4B3RC 5BSUA 4G37A 5BR8C 4JI3C 2YCBA 5BSVA 3J80D 4OX9C 2ZM6C 1N2FA 4R1LA 3E7XA 3EERA 5A1IA 3NPDA 4NDNA 4G36A 4IR7A 1WF3A 2YWBA 3DLPX 4DG9A 2DYJA 3A4IA 4MTNA 5T8SA 1P7LA 4ODJA 4JYAC 1K0RA 1PA4A 4I9FA 3EQ6A 1GPMA 3L8CA 2UXBC 2E5LC 2WP0C 5KYTA 2P2BA 5DV9A 3ETCA 4I9GA 4PHTA 3RG2A 2PT7G 4XX2A 1XMQC 3FCEA 1ML8A 3GR0A 1MXAA 5BSWA 2QVYX 2UXDC 4L4QA 5AE2A 5K85A 3B7WA 1LCIA 3IEVA 1XRCA 4KTTA 3JAMD 3ETOA 4JI0C 1J5EC 3A9UA 3SO4A 4X64C 4DV0C 4HPVA 3TDEA 5A19A 4GXQA 4JI6C 5BSTA 5LMNC 1USPA 4DV6C 4L2ZA 4GXRA 3RV2A 1LQLA 3NYRA 4KTVA 4DR1C 4DV2C 2CXCA 2D7VA 4DCVA 2D27A 3C5EA 2PROA 3GR1A 4WS9A 4FUTA 5IWAC 2VZEA 4DV4C 1N34C 5A1GA 4ZLPA 4DR4C 5CZXA 4ZJZA 4YY3C 2HJGA 4BCAA 4LE5A 4AQYC 1MXBA 1BA3A 5BUQA 4BC7A 4RLFA 4RLQA 3LUSA 4DUZC 4DV1C 3T1HC 2P2MA 2VSQA 4OYCA 2P2JA 1FJGC 1RG9A 4LF5C 1MXCA 2JMPA 2BJOA 4LF9C 1PG4A 3IMLA 1JOSA 2OO4A 2ONFA 1MDFA 4EATA 2ATWA 3TUFA 1YJ7A 1UKKA 2E7GA 5BSMA 2Y27A 2VQFC 4DUYC 2UUBC 5H9UA 4JI2C 1USPB 4JI1C 1V25A 5JRHA 1L2FA 5T8TA 3J7AD 2D1TA 3DHVA 3PBKA 5A2QD 5ADZA 2BH1X 4B3TC 1NYEA 1XNQC 3OTOC 3AF6A 3PESA 4L7IA 2E0GA 1IBMC 1O90A 4RMNA 3AF5A 2EGTA 2UU9C 4R1MA 3A9VA 2P20A 1MKYA 1WH9A 3GPCA 1QWIA 2PN2A 4MH4A 1IBLC 4D56A 3KXWA 4JI4C 1MD9A 4RVNA 2D1SA 2YWCA 2HHHC 2OBVA 3PROC 4GS5A 4TPSB 4D4IA 1T5DX 4X66C 3TQIA 3I08A 2E8FA 1I94C 2WD9A 3N54B 3CJEA 5BUSA 1O9TA 1QM4A 5CZVA 1VLAA 2DPLA 1IBKC 5LMUC 4LFBC 3IPLA 4ISBA 4LF7C 1XRBA 1XMOC 4G1IA 3R9XA 4KHPC 1HH2P 4IZ6A 4K0BA 1T5HX 4DG8A 1ZB9A 2E8EA 2XR1A 4LF4C 2ASBA 1RY2A 3IEUA 2UUAC 5KYVA 5AE3A 2D1RA 4PZPA 3VNQA 1XRAA 4BC9A 3S82A 4FTFA 4JI7C 4JV5C 3DAYA 4R0MA 3CW9A 1FUGA 5GTDA 4LFAC 3FCCA 4DR7C 4JI5C 2UXCC 5BURA 4D4GA 2QVZX 3NI2A 3R9WA 2P2QA 4DCTA 4DV7C 2P2FA 4U5YD 5BSRA 2CY1A 4WV3A 4NOZA 4GKKC 4LFCC 2AYAA 2QVXX 3R44A 1V26A 2D28C 5E7QA 1HR0C 2UUCC 4NXNC 4YHHC 2OPLA 1ULTA 4GKJC 4JI8C 2QL8A 1MDBA 4RM2A 4X62C 4FUQA 1EGAA 5IT9D 3UOWA 4B3SC 1O93A 2E8CA 5KEIA 1ZB8A 5FLXD 2F4VC 4OXIA 2P02A 4JM1A 3UZ0A 1O92A 1HNZC 1HNXC 4DV3C 4BSZA 5AE1A 3CW8X 3LAXA 2VQEC 3G7SA 4PROC 3T1YC 1HNWC 4LF8C 1KKGA 4RM3A 3E7WA 4K0KC 1AMUA 5K8FA 4BBYA 2Y4NA 3H2TA 1XNRC 3LNVA 1N32C 3J81D 2Y4OA 4DCUA 4NXMC 4LF6C 4DR6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYE A;  3IEV A;  1XNQ C;  3JAM D;  3OTO C;  3AF6 A;  1IBM C;  4JI0 C;  1J5E C;  4LFA C;  3AF5 A;  4X65 C;  4DR7 C;  4B3M C;  3GKU A;  4JI5 C;  2UXC C;  2EGT A;  4DR5 C;  2UU9 C;  4X64 C;  4DV0 C;  2OPL B;  1MKY A;  3R9W A;  4JI6 C;  1WH9 A;  2KZF A;  4DCT A;  1QWI A;  4DV5 C;  3I07 A;  2PN2 A;  5LMN C;  4DV7 C;  4MH4 A;  1IBL C;  1USP A;  4DR2 C;  2CY1 A;  4JI4 C;  4DV6 C;  1N33 C;  4NOZ A;  4DCS A;  4GKK C;  4LFC C;  1LQL A;  1N36 C;  2HHH C;  4DR3 C;  4B3R C;  4DR1 C;  4DV2 C;  2CXC A;  2D7V A;  1HR0 C;  4X66 C;  4DCV A;  5BR8 C;  4JI3 C;  2YCB A;  2E8F A;  1I94 C;  3J80 D;  2UUC C;  4OX9 C;  2ZM6 C;  3CJE A;  4NXN C;  4YHH C;  1N2F A;  2OPL A;  5IWA C;  3EER A;  4DV4 C;  1N34 C;  4GKJ C;  4DR4 C;  4JI8 C;  2QL8 A;  4YY3 C;  2HJG A;  1VLA A;  4X62 C;  1WF3 A;  5LMU C;  1IBK C;  4B3T C;  1EGA A;  4AQY C;  5IT9 D;  4B3S C;  4LFB C;  4LF7 C;  2DYJ A;  3LUS A;  1XMO C;  4DUZ C;  3R9X A;  4MTN A;  2E8C A;  1ZB8 A;  4DV1 C;  5FLX D;  3T1H C;  1K0R A;  2F4V C;  4KHP C;  1PA4 A;  4JYA C;  1HH2 P;  1FJG C;  1ZB9 A;  2UXB C;  4LF5 C;  2JMP A;  1HNZ C;  2E8E A;  2XR1 A;  4DV3 C;  2BJO A;  1HNX C;  2E5L C;  4LF4 C;  4BSZ A;  2ASB A;  4LF9 C;  1JOS A;  3IEU A;  2UUA C;  2VQE C;  2ONF A;  3T1Y C;  1HNW C;  2ATW A;  4LF8 C;  1KKG A;  1UKK A;  2E7G A;  2PT7 G;  4XX2 A;  1XMQ C;  2VQF C;  4K0K C;  1ML8 A;  4DUY C;  2UUB C;  4JI2 C;  1USP B;  4JI1 C;  1XNR C;  1L2F A;  3J7A D;  1N32 C;  2UXD C;  3J81 D;  4DCU A;  4NXM C;  4JI7 C;  4JV5 C;  4LF6 C;  4DR6 C;  5A2Q D; 
#chains in the Genus database with same CATH topology
 4PUG A;  3N2Q A;  4D57 A;  3NYQ A;  5IFI A;  4X65 C;  4B3M C;  3GKU A;  3L95 X;  4DR5 C;  4RVO A;  2OPL B;  3UX2 A;  2KZF A;  3VNR A;  4DV5 C;  3I07 A;  3VNS A;  1XDX A;  3O2E A;  4DR2 C;  1YGT A;  1N33 C;  4DCS A;  2QW0 X;  2D1Q A;  1N36 C;  1PG3 A;  4DR3 C;  3LGX A;  5LCI A;  2V7B A;  4B3R C;  5BSU A;  4G37 A;  5BR8 C;  4JI3 C;  2YCB A;  5BSV A;  3J80 D;  4OX9 C;  2ZM6 C;  1N2F A;  4R1L A;  3E7X A;  3EER A;  5A1I A;  3CQ1 A;  3NPD A;  4NDN A;  4G36 A;  4IR7 A;  1WF3 A;  2ZZN A;  2MMA B;  2YWB A;  3DLP X;  4DG9 A;  2DYJ A;  1XHJ A;  3A4I A;  4MTN A;  5T8S A;  1P7L A;  4ODJ A;  4JYA C;  1K0R A;  1PA4 A;  4I9F A;  3EQ6 A;  1GPM A;  2KZ0 A;  3L8C A;  2UXB C;  2E5L C;  2WP0 C;  5KYT A;  2PG1 E;  2P2B A;  5DV9 A;  3ETC A;  1VEH A;  4I9G A;  4PHT A;  3RG2 A;  2PT7 G;  4XX2 A;  1XMQ C;  3CQ2 A;  3FCE A;  1ML8 A;  4PUI A;  1M6X C;  3GR0 A;  2DHM A;  2ZTB A;  1MXA A;  5BSW A;  2QVY X;  2UXD C;  4L4Q A;  5AE2 A;  5K85 A;  3B7W A;  1LCI A;  3IEV A;  1XRC A;  4KTT A;  3JAM D;  3ETO A;  4JI0 C;  1J5E C;  3A9U A;  3UEB A;  3SO4 A;  4X64 C;  4DV0 C;  4HPV A;  3TDE A;  5A19 A;  4GXQ A;  4JI6 C;  5BST A;  5LMN C;  3A26 A;  1USP A;  4DV6 C;  4L2Z A;  4GXR A;  3RV2 A;  1LQL A;  3K6R A;  3NYR A;  4KTV A;  4DR1 C;  4DV2 C;  2CXC A;  1PU1 A;  2D7V A;  4DCV A;  2D27 A;  3C5E A;  2PRO A;  3GR1 A;  2ZZM A;  4WS9 A;  4FUT A;  5IWA C;  2VZE A;  4DV4 C;  1N34 C;  5A1G A;  4ZLP A;  4DR4 C;  5CZX A;  4ZJZ A;  4YY3 C;  2HJG A;  4BCA A;  4LE5 A;  4AQY C;  1MXB A;  1BA3 A;  5BUQ A;  4BC7 A;  4RLF A;  4RLQ A;  3LUS A;  4DUZ C;  1UWD A;  4DV1 C;  3T1H C;  2KDN A;  2P2M A;  2VSQ A;  4OYC A;  2P2J A;  1FJG C;  1RG9 A;  3TR3 A;  4LF5 C;  1MXC A;  2JMP A;  2BJO A;  3AY0 A;  4LF9 C;  1PG4 A;  3IML A;  1JOS A;  1P4E A;  2OO4 A;  2ONF A;  1MDF A;  4EAT A;  2ATW A;  3TUF A;  1YJ7 A;  1UKK A;  2E7G A;  5BSM A;  2Y27 A;  2VQF C;  4DUY C;  2UUB C;  3FM7 A;  5H9U A;  4JI2 C;  1USP B;  4JI1 C;  1V25 A;  5JRH A;  1L2F A;  5T8T A;  3J7A D;  2D1T A;  3DHV A;  3PBK A;  5A2Q D;  5ADZ A;  2BH1 X;  4B3T C;  1NYE A;  1XNQ C;  1WCJ A;  3OTO C;  3AF6 A;  3PES A;  4L7I A;  2E0G A;  1IBM C;  1O90 A;  1FLO A;  3A25 A;  4RMN A;  3AF5 A;  2EGT A;  2UU9 C;  4R1M A;  3A9V A;  2P20 A;  1MKY A;  1WH9 A;  3GPC A;  1QWI A;  2PN2 A;  4MH4 A;  1IBL C;  4D56 A;  3KXW A;  4JI4 C;  1MD9 A;  4RVN A;  2D1S A;  2YWC A;  2Z51 A;  2HHH C;  2OBV A;  3PRO C;  4GS5 A;  4TPS B;  4D4I A;  1T5D X;  4X66 C;  1V60 A;  3TQI A;  3I08 A;  2E8F A;  1I94 C;  2WD9 A;  3N54 B;  3CJE A;  5BUS A;  1O9T A;  1QM4 A;  2YX1 A;  5CZV A;  1VLA A;  2DPL A;  1IBK C;  5LMU C;  4LFB C;  3IPL A;  4ISB A;  4LF7 C;  1XRB A;  1XMO C;  4G1I A;  3R9X A;  4KHP C;  1HH2 P;  4IZ6 A;  4K0B A;  1T5H X;  4DG8 A;  1ZB9 A;  1XS3 A;  2E8E A;  2XR1 A;  4LF4 C;  2ASB A;  1RY2 A;  3IEU A;  2UUA C;  1P4E C;  5KYV A;  5AE3 A;  2D1R A;  4PZP A;  3VNQ A;  1XRA A;  4BC9 A;  3S82 A;  4PUH A;  4FTF A;  4JI7 C;  4JV5 C;  2JNV A;  3DAY A;  4R0M A;  3CW9 A;  1FUG A;  5GTD A;  4LFA C;  3FCC A;  4DR7 C;  4JI5 C;  2UXC C;  5BUR A;  4D4G A;  2QVZ X;  3NI2 A;  3R9W A;  2P2Q A;  4DCT A;  2MM9 A;  4DV7 C;  2P2F A;  4U5Y D;  2M5H A;  5BSR A;  2CY1 A;  4WV3 A;  4NOZ A;  4GKK C;  4LFC C;  2AYA A;  2QVX X;  3R44 A;  1V26 A;  2D28 C;  5E7Q A;  1TH5 A;  1HR0 C;  2UUC C;  2CU6 A;  4NXN C;  4YHH C;  2OPL A;  1ULT A;  3LNO A;  4GKJ C;  4JI8 C;  2QL8 A;  1MDB A;  4RM2 A;  4X62 C;  4FUQ A;  1IB8 A;  1EGA A;  5IT9 D;  3UOW A;  4B3S C;  1O93 A;  2E8C A;  5KEI A;  1ZB8 A;  5FLX D;  2F4V C;  4OXI A;  2P02 A;  4JM1 A;  3UZ0 A;  1O92 A;  1HNZ C;  1HNX C;  4DV3 C;  4BSZ A;  5AE1 A;  3CW8 X;  3LAX A;  3CQ3 A;  2VQE C;  3G7S A;  4PRO C;  3T1Y C;  1HNW C;  4LF8 C;  1KKG A;  2NCL A;  2MCQ A;  4RM3 A;  1NY8 A;  2M5O A;  3E7W A;  4K0K C;  1M6X A;  1AMU A;  3UX3 A;  5K8F A;  4BBY A;  2Y4N A;  3H2T A;  1XNR C;  3LNV A;  1N32 C;  3J81 D;  2Y4O A;  4DCU A;  4NXM C;  4LF6 C;  4DR6 C; 
#chains in the Genus database with same CATH homology
 3N2Q A;  4D57 A;  3NYQ A;  5IFI A;  4X65 C;  4B3M C;  3GKU A;  3L95 X;  4DR5 C;  4RVO A;  2OPL B;  2KZF A;  3VNR A;  4DV5 C;  3I07 A;  3VNS A;  4DR2 C;  1N33 C;  4DCS A;  2QW0 X;  2D1Q A;  1N36 C;  1PG3 A;  4DR3 C;  3LGX A;  2V7B A;  4B3R C;  5BSU A;  4G37 A;  5BR8 C;  4JI3 C;  2YCB A;  5BSV A;  3J80 D;  4OX9 C;  2ZM6 C;  1N2F A;  4R1L A;  3E7X A;  3EER A;  5A1I A;  3NPD A;  4NDN A;  4G36 A;  4IR7 A;  1WF3 A;  2YWB A;  3DLP X;  4DG9 A;  2DYJ A;  3A4I A;  4MTN A;  5T8S A;  1P7L A;  4ODJ A;  4JYA C;  1K0R A;  1PA4 A;  4I9F A;  3EQ6 A;  1GPM A;  3L8C A;  2UXB C;  2E5L C;  2WP0 C;  5KYT A;  2P2B A;  5DV9 A;  3ETC A;  4I9G A;  4PHT A;  3RG2 A;  2PT7 G;  4XX2 A;  1XMQ C;  3FCE A;  1ML8 A;  3GR0 A;  1MXA A;  5BSW A;  2QVY X;  2UXD C;  4L4Q A;  5AE2 A;  5K85 A;  3B7W A;  1LCI A;  3IEV A;  1XRC A;  4KTT A;  3JAM D;  3ETO A;  4JI0 C;  1J5E C;  3A9U A;  3SO4 A;  4X64 C;  4DV0 C;  4HPV A;  3TDE A;  5A19 A;  4GXQ A;  4JI6 C;  5BST A;  5LMN C;  1USP A;  4DV6 C;  4L2Z A;  4GXR A;  3RV2 A;  1LQL A;  3NYR A;  4KTV A;  4DR1 C;  4DV2 C;  2CXC A;  2D7V A;  4DCV A;  2D27 A;  3C5E A;  2PRO A;  3GR1 A;  4WS9 A;  4FUT A;  5IWA C;  2VZE A;  4DV4 C;  1N34 C;  5A1G A;  4ZLP A;  4DR4 C;  5CZX A;  4ZJZ A;  4YY3 C;  2HJG A;  4BCA A;  4LE5 A;  4AQY C;  1MXB A;  1BA3 A;  5BUQ A;  4BC7 A;  4RLF A;  4RLQ A;  3LUS A;  4DUZ C;  4DV1 C;  3T1H C;  2P2M A;  2VSQ A;  4OYC A;  2P2J A;  1FJG C;  1RG9 A;  4LF5 C;  1MXC A;  2JMP A;  2BJO A;  4LF9 C;  1PG4 A;  3IML A;  1JOS A;  2OO4 A;  2ONF A;  1MDF A;  4EAT A;  2ATW A;  3TUF A;  1YJ7 A;  1UKK A;  2E7G A;  5BSM A;  2Y27 A;  2VQF C;  4DUY C;  2UUB C;  5H9U A;  4JI2 C;  1USP B;  4JI1 C;  1V25 A;  5JRH A;  1L2F A;  5T8T A;  3J7A D;  2D1T A;  3DHV A;  3PBK A;  5A2Q D;  5ADZ A;  2BH1 X;  4B3T C;  1NYE A;  1XNQ C;  3OTO C;  3AF6 A;  3PES A;  4L7I A;  2E0G A;  1IBM C;  1O90 A;  4RMN A;  3AF5 A;  2EGT A;  2UU9 C;  4R1M A;  3A9V A;  2P20 A;  1MKY A;  1WH9 A;  3GPC A;  1QWI A;  2PN2 A;  4MH4 A;  1IBL C;  4D56 A;  3KXW A;  4JI4 C;  1MD9 A;  4RVN A;  2D1S A;  2YWC A;  2HHH C;  2OBV A;  3PRO C;  4GS5 A;  4TPS B;  4D4I A;  1T5D X;  4X66 C;  3TQI A;  3I08 A;  2E8F A;  1I94 C;  2WD9 A;  3N54 B;  3CJE A;  5BUS A;  1O9T A;  1QM4 A;  5CZV A;  1VLA A;  2DPL A;  1IBK C;  5LMU C;  4LFB C;  3IPL A;  4ISB A;  4LF7 C;  1XRB A;  1XMO C;  4G1I A;  3R9X A;  4KHP C;  1HH2 P;  4IZ6 A;  4K0B A;  1T5H X;  4DG8 A;  1ZB9 A;  2E8E A;  2XR1 A;  4LF4 C;  2ASB A;  1RY2 A;  3IEU A;  2UUA C;  5KYV A;  5AE3 A;  2D1R A;  4PZP A;  3VNQ A;  1XRA A;  4BC9 A;  3S82 A;  4FTF A;  4JI7 C;  4JV5 C;  3DAY A;  4R0M A;  3CW9 A;  1FUG A;  5GTD A;  4LFA C;  3FCC A;  4DR7 C;  4JI5 C;  2UXC C;  5BUR A;  4D4G A;  2QVZ X;  3NI2 A;  3R9W A;  2P2Q A;  4DCT A;  4DV7 C;  2P2F A;  4U5Y D;  5BSR A;  2CY1 A;  4WV3 A;  4NOZ A;  4GKK C;  4LFC C;  2AYA A;  2QVX X;  3R44 A;  1V26 A;  2D28 C;  5E7Q A;  1HR0 C;  2UUC C;  4NXN C;  4YHH C;  2OPL A;  1ULT A;  4GKJ C;  4JI8 C;  2QL8 A;  1MDB A;  4RM2 A;  4X62 C;  4FUQ A;  1EGA A;  5IT9 D;  3UOW A;  4B3S C;  1O93 A;  2E8C A;  5KEI A;  1ZB8 A;  5FLX D;  2F4V C;  4OXI A;  2P02 A;  4JM1 A;  3UZ0 A;  1O92 A;  1HNZ C;  1HNX C;  4DV3 C;  4BSZ A;  5AE1 A;  3CW8 X;  3LAX A;  2VQE C;  3G7S A;  4PRO C;  3T1Y C;  1HNW C;  4LF8 C;  1KKG A;  4RM3 A;  3E7W A;  4K0K C;  1AMU A;  5K8F A;  4BBY A;  2Y4N A;  3H2T A;  1XNR C;  3LNV A;  1N32 C;  3J81 D;  2Y4O A;  4DCU A;  4NXM C;  4LF6 C;  4DR6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...