3T1HC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3t1hC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3t1hC02
4JI1C 1HH2P 1XNRC 4X65C 1IBLC 2UUBC 4DCSA 1IBMC 4LFAC 4LFCC 4LF8C 1XMOC 1ZB8A 5IWAC 5A2QD 4GKJC 2UXCC 1N32C 4DV1C 2CY1A 1HR0C 4MH4A 2E8EA 4BSZA 4DCUA 2PN2A 2E8CA 3AF5A 2DYJA 1VLAA 5LMUC 4DR2C 3IEVA 2D7VA 4DV4C 4JI0C 2ONFA 3J7AD 2PT7G 4JI3C 4B3MC 1KKGA 4DCVA 1QWIA 1ML8A 2ASBA 1EGAA 1WF3A 2ATWA 2VQEC 2UXBC 1USPA 5LMNC 2HHHC 2XR1A 4DV7C 1FJGC 1N33C 2E7GA 4B3TC 3EERA 4NOZA 4JV5C 4KHPC 2QL8A 4X66C 4JI5C 1USPB 2VQFC 2UUCC 2UXDC 1XNQC 1WH9A 4LF9C 4DR1C 1L2FA 3IEUA 1NYEA 3T1HC 4LF6C 1MKYA 4DR5C 4OX9C 2JMPA 4DR6C 1PA4A 1N36C 4X64C 3I07A 3AF6A 4B3RC 2OPLB 4YY3C 4DV2C 4JI6C 2CXCA 1K0RA 2UU9C 4DCTA 3LUSA 4XX2A 2BJOA 1HNXC 3R9WA 1UKKA 4DR3C 2UUAC 4DV6C 4DV3C 2E5LC 4LF5C 4MTNA 1IBKC 3R9XA 1HNWC 4NXNC 2ZM6C 3CJEA 1N34C 4LFBC 2F4VC 4B3SC 2YCBA 4X62C 3OTOC 4DUYC 4LF7C 1XMQC 1I94C 4JI2C 3JAMD 4AQYC 4JYAC 3J80D 2KZFA 1HNZC 1N2FA 2OPLA 2EGTA 4LF4C 3GKUA 4DV0C 4JI8C 4DV5C 4JI7C 3J81D 5IT9D 4DR7C 4YHHC 1JOSA 4NXMC 2HJGA 5FLXD 4DUZC 2E8FA 1LQLA 4DR4C 5BR8C 1J5EC 3T1YC 4JI4C 4K0KC 4GKKC 1ZB9A
chains in the Genus database with same CATH superfamily
1HH2P 1V26A 1XNRC 3NPDA 4NDNA 4DCSA 4LFCC 3O2EA 5T8SA 1ZB8A 5IWAC 5A2QD 4GKJC 3ETCA 5BSVA 1FUGA 1T5DX 2OO4A 5CZXA 1PG3A 1VLAA 4DR2C 2ZTBA 4WV3A 1WCJA 4IR7A 1KKGA 1QWIA 3GR0A 1EGAA 3A26A 2HHHC 4JM1A 4DV7C 4OYCA 4JV5C 4JI5C 3A4IA 1WH9A 5A1IA 1MKYA 1IB8A 3RG2A 1PA4A 1FLOA 2OBVA 2D28C 3FCCA 3VNRA 4BC7A 3ETOA 3G7SA 1O90A 4L4QA 4DV6C 2AYAA 5BSUA 4DG9A 5AE3A 2D1SA 3E7WA 2P2BA 3VNQA 4LF5C 4BC9A 1IBKC 1AMUA 2QVZX 5A19A 3UX2A 4LFBC 3A9VA 3CQ1A 4RVNA 4ODJA 2WP0C 5IFIA 4LF7C 3A25A 2KZ0A 3JAMD 2KZFA 4JI8C 1V25A 3IPLA 4R1LA 4FTFA 4RLQA 5AE2A 2DHMA 4NXMC 2ZZMA 3CW8X 3TDEA 5BR8C 4ISBA 4GKKC 1O92A 4GS5A 2P20A 4TPSB 4X65C 4GXQA 1IBMC 4LFAC 3UZ0A 1XDXA 1XMOC 2CY1A 1HR0C 2E8EA 4BSZA 4DCUA 3AF5A 2DYJA 5BURA 5LMUC 1VEHA 4DV4C 2MMAB 2ONFA 4JI3C 5KEIA 1MXCA 1XHJA 4DCVA 5BUQA 4FUTA 2ASBA 3AY0A 2Z51A 5E7QA 2ATWA 2KDNA 4IZ6A 5LMNC 1XRBA 2XR1A 2D1QA 3TUFA 4B3TC 3EERA 1MDBA 4NOZA 2P2FA 2Y4NA 1USPB 2UUCC 2D1RA 1XNQC 4PZPA 3UX3A 4LF9C 4DR1C 4LF6C 1NYEA 3L8CA 4DR5C 4OX9C 4I9FA 1XS3A 1BA3A 1GPMA 3E7XA 4DV2C 2ZZNA 3EQ6A 2BJOA 2PG1E 1O93A 4DV3C 2DPLA 2E5LC 3A9UA 1N34C 3UEBA 2F4VC 4B3SC 4X62C 5K8FA 3UOWA 4R1MA 1P4EC 4I9GA 4HPVA 5CZVA 2EGTA 4G1IA 3L95X 1XRAA 3J81D 5BSWA 4PUGA 1UWDA 4YHHC 4BCAA 4G36A 5BUSA 1J5EC 1MDFA 4K0KC 1ZB9A 3DAYA 4LE5A 1IBLC 1PG4A 3NI2A 3K6RA 3KXWA 2UXCC 3LNOA 4PHTA 3B7WA 3I08A 5KYVA 5K85A 3FM7A 2QVYX 4BBYA 2BH1X 3H2TA 2PN2A 2P02A 3DLPX 2E0GA 3RV2A 1ULTA 2M5OA 1P7LA 3CQ2A 1TH5A 1RY2A 1WF3A 2MM9A 3PROC 1O9TA 2VQEC 3NYQA 4RLFA 5JRHA 4KHPC 2VQFC 2UXDC 1M6XC 2YWCA 1L2FA 3IEUA 2D1TA 5BSMA 4D57A 4KTVA 3S82A 1N36C 4PUHA 4X64C 3AF6A 4JI6C 2CXCA 1K0RA 2UU9C 1MXBA 4ZLPA 5H9UA 1HNXC 3R9WA 3TR3A 3DHVA 1V60A 2JNVA 2Y4OA 4DR3C 1YGTA 3PBKA 2M5HA 4FUQA 3R9XA 1HNWC 4NXNC 2YX1A 3CJEA 2YCBA 4RM3A 3CQ3A 3C5EA 3LAXA 1I94C 4JI2C 1NY8A 4D56A 4D4IA 3J80D 1HNZC 2OPLA 2Y27A 4G37A 1XRCA 4JI7C 4DR7C 5T8TA 3NYRA 1MXAA 2CU6A 4EATA 5GTDA 5FLXD 4DUZC 4L7IA 3J7AD 3VNSA 4JI1C 3CW9A 2UUBC 2MCQA 4OXIA 4LF8C 1N32C 4DV1C 5KYTA 4MH4A 1M6XA 4RVOA 4PUIA 2E8CA 3N2QA 2VSQA 4WS9A 3IEVA 2D7VA 3GR1A 4JI0C 1LCIA 3N54B 2PT7G 2YWBA 3R44A 2PROA 4KTTA 1PU1A 4B3MC 5BSRA 1ML8A 3LGXA 2NCLA 2QW0X 4L2ZA 2V7BA 3IMLA 4GXRA 2UXBC 1USPA 1FJGC 1N33C 2E7GA 2P2QA 2QL8A 4X66C 4RM2A 5LCIA 3T1HC 5AE1A 3FCEA 2JMPA 4DR6C 1QM4A 3I07A 4B3RC 4DG8A 2OPLB 4U5YD 4R0MA 4YY3C 2P2MA 4DCTA 3LUSA 4PROC 4XX2A 4ZJZA 1MD9A 5ADZA 3TQIA 1UKKA 2UUAC 1T5HX 2VZEA 1YJ7A 3SO4A 4MTNA 5A1GA 4D4GA 4K0BA 5DV9A 2ZM6C 5BSTA 1RG9A 3OTOC 4DUYC 2QVXX 3LNVA 1XMQC 1P4EA 4AQYC 4JYAC 1N2FA 2P2JA 4LF4C 3GPCA 3GKUA 4DV0C 4DV5C 4RMNA 5IT9D 1JOSA 2D27A 3PESA 2HJGA 2E8FA 2WD9A 1LQLA 4DR4C 3T1YC 4JI4C
chains in the Genus database with same CATH topology
1HH2P 1V26A 1XNRC 3NPDA 4NDNA 4DCSA 4LFCC 5T8SA 1ZB8A 5IWAC 5A2QD 4GKJC 3ETCA 5BSVA 1FUGA 1T5DX 2OO4A 5CZXA 1PG3A 1VLAA 4DR2C 4WV3A 4IR7A 1KKGA 1QWIA 3GR0A 1EGAA 2HHHC 4JM1A 4DV7C 4OYCA 4JV5C 4JI5C 3A4IA 1WH9A 5A1IA 1MKYA 3RG2A 1PA4A 2OBVA 2D28C 3FCCA 3VNRA 4BC7A 3ETOA 3G7SA 1O90A 4L4QA 4DV6C 2AYAA 5BSUA 4DG9A 5AE3A 2D1SA 3E7WA 2P2BA 3VNQA 4LF5C 4BC9A 1IBKC 1AMUA 2QVZX 5A19A 4LFBC 3A9VA 4RVNA 4ODJA 2WP0C 5IFIA 4LF7C 3JAMD 2KZFA 4JI8C 1V25A 3IPLA 4R1LA 4FTFA 4RLQA 5AE2A 4NXMC 3CW8X 3TDEA 5BR8C 4ISBA 4GKKC 1O92A 4GS5A 2P20A 4TPSB 4X65C 4GXQA 1IBMC 4LFAC 3UZ0A 1XMOC 2CY1A 1HR0C 2E8EA 4BSZA 4DCUA 3AF5A 2DYJA 5BURA 5LMUC 4DV4C 2ONFA 4JI3C 5KEIA 1MXCA 4DCVA 5BUQA 4FUTA 2ASBA 5E7QA 2ATWA 4IZ6A 5LMNC 1XRBA 2XR1A 2D1QA 3TUFA 4B3TC 3EERA 1MDBA 4NOZA 2P2FA 2Y4NA 1USPB 2UUCC 2D1RA 1XNQC 4PZPA 4LF9C 4DR1C 4LF6C 1NYEA 3L8CA 4DR5C 4OX9C 4I9FA 1BA3A 1GPMA 3E7XA 4DV2C 3EQ6A 2BJOA 1O93A 4DV3C 2DPLA 2E5LC 3A9UA 1N34C 2F4VC 4B3SC 4X62C 5K8FA 3UOWA 4R1MA 4I9GA 4HPVA 5CZVA 2EGTA 4G1IA 3L95X 1XRAA 3J81D 5BSWA 4YHHC 4BCAA 4G36A 5BUSA 1J5EC 1MDFA 4K0KC 1ZB9A 3DAYA 4LE5A 1IBLC 1PG4A 3NI2A 3KXWA 2UXCC 4PHTA 3B7WA 3I08A 5KYVA 5K85A 2QVYX 4BBYA 2BH1X 3H2TA 2PN2A 2P02A 3DLPX 2E0GA 3RV2A 1ULTA 1P7LA 1RY2A 1WF3A 3PROC 1O9TA 2VQEC 3NYQA 4RLFA 5JRHA 4KHPC 2VQFC 2UXDC 2YWCA 1L2FA 3IEUA 2D1TA 5BSMA 4D57A 4KTVA 3S82A 1N36C 4X64C 3AF6A 4JI6C 2CXCA 1K0RA 2UU9C 1MXBA 4ZLPA 5H9UA 1HNXC 3R9WA 3DHVA 2Y4OA 4DR3C 3PBKA 4FUQA 3R9XA 1HNWC 4NXNC 3CJEA 2YCBA 4RM3A 3LAXA 3C5EA 1I94C 4JI2C 4D56A 4D4IA 3J80D 1HNZC 2OPLA 2Y27A 4G37A 1XRCA 4JI7C 4DR7C 5T8TA 3NYRA 1MXAA 4EATA 5GTDA 5FLXD 4DUZC 4L7IA 3J7AD 3VNSA 4JI1C 3CW9A 2UUBC 4OXIA 4LF8C 1N32C 4DV1C 5KYTA 4MH4A 4RVOA 2E8CA 3N2QA 2VSQA 4WS9A 3IEVA 2D7VA 3GR1A 4JI0C 1LCIA 3N54B 2PT7G 2YWBA 3R44A 2PROA 4KTTA 4B3MC 5BSRA 1ML8A 3LGXA 2QW0X 4L2ZA 2V7BA 3IMLA 4GXRA 2UXBC 1USPA 1FJGC 1N33C 2E7GA 2P2QA 2QL8A 4X66C 4RM2A 3T1HC 5AE1A 3FCEA 2JMPA 4DR6C 1QM4A 3I07A 4B3RC 4DG8A 2OPLB 4U5YD 4R0MA 4YY3C 2P2MA 4DCTA 3LUSA 4PROC 4XX2A 4ZJZA 1MD9A 5ADZA 3TQIA 1UKKA 2UUAC 1T5HX 2VZEA 1YJ7A 3SO4A 4MTNA 5A1GA 4D4GA 4K0BA 5DV9A 2ZM6C 5BSTA 1RG9A 3OTOC 4DUYC 2QVXX 3LNVA 1XMQC 4AQYC 4JYAC 1N2FA 2P2JA 4LF4C 3GPCA 3GKUA 4DV0C 4DV5C 4RMNA 5IT9D 1JOSA 2D27A 3PESA 2HJGA 2E8FA 2WD9A 1LQLA 4DR4C 3T1YC 4JI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 C;  1HH2 P;  1XNR C;  4X65 C;  1IBL C;  2UUB C;  4DCS A;  1IBM C;  4LFA C;  4LFC C;  4LF8 C;  1XMO C;  1ZB8 A;  5IWA C;  5A2Q D;  4GKJ C;  2UXC C;  1N32 C;  4DV1 C;  2CY1 A;  1HR0 C;  4MH4 A;  2E8E A;  4BSZ A;  4DCU A;  2PN2 A;  2E8C A;  3AF5 A;  2DYJ A;  1VLA A;  5LMU C;  4DR2 C;  3IEV A;  2D7V A;  4DV4 C;  4JI0 C;  2ONF A;  3J7A D;  2PT7 G;  4JI3 C;  4B3M C;  1KKG A;  4DCV A;  1QWI A;  1ML8 A;  2ASB A;  1EGA A;  1WF3 A;  2ATW A;  2VQE C;  2UXB C;  1USP A;  5LMN C;  2HHH C;  2XR1 A;  4DV7 C;  1FJG C;  1N33 C;  2E7G A;  4B3T C;  3EER A;  4NOZ A;  4JV5 C;  4KHP C;  2QL8 A;  4X66 C;  4JI5 C;  1USP B;  2VQF C;  2UUC C;  2UXD C;  1XNQ C;  1WH9 A;  4LF9 C;  4DR1 C;  1L2F A;  3IEU A;  1NYE A;  3T1H C;  4LF6 C;  1MKY A;  4DR5 C;  4OX9 C;  2JMP A;  4DR6 C;  1PA4 A;  1N36 C;  4X64 C;  3I07 A;  3AF6 A;  4B3R C;  2OPL B;  4YY3 C;  4DV2 C;  4JI6 C;  2CXC A;  1K0R A;  2UU9 C;  4DCT A;  3LUS A;  4XX2 A;  2BJO A;  1HNX C;  3R9W A;  1UKK A;  4DR3 C;  2UUA C;  4DV6 C;  4DV3 C;  2E5L C;  4LF5 C;  4MTN A;  1IBK C;  3R9X A;  1HNW C;  4NXN C;  2ZM6 C;  3CJE A;  1N34 C;  4LFB C;  2F4V C;  4B3S C;  2YCB A;  4X62 C;  3OTO C;  4DUY C;  4LF7 C;  1XMQ C;  1I94 C;  4JI2 C;  3JAM D;  4AQY C;  4JYA C;  3J80 D;  2KZF A;  1HNZ C;  1N2F A;  2OPL A;  2EGT A;  4LF4 C;  3GKU A;  4DV0 C;  4JI8 C;  4DV5 C;  4JI7 C;  3J81 D;  5IT9 D;  4DR7 C;  4YHH C;  1JOS A;  4NXM C;  2HJG A;  5FLX D;  4DUZ C;  2E8F A;  1LQL A;  4DR4 C;  5BR8 C;  1J5E C;  3T1Y C;  4JI4 C;  4K0K C;  4GKK C;  1ZB9 A; 
#chains in the Genus database with same CATH topology
 1HH2 P;  1V26 A;  1XNR C;  3NPD A;  4NDN A;  4DCS A;  4LFC C;  3O2E A;  5T8S A;  1ZB8 A;  5IWA C;  5A2Q D;  4GKJ C;  3ETC A;  5BSV A;  1FUG A;  1T5D X;  2OO4 A;  5CZX A;  1PG3 A;  1VLA A;  4DR2 C;  2ZTB A;  4WV3 A;  1WCJ A;  4IR7 A;  1KKG A;  1QWI A;  3GR0 A;  1EGA A;  3A26 A;  2HHH C;  4JM1 A;  4DV7 C;  4OYC A;  4JV5 C;  4JI5 C;  3A4I A;  1WH9 A;  5A1I A;  1MKY A;  1IB8 A;  3RG2 A;  1PA4 A;  1FLO A;  2OBV A;  2D28 C;  3FCC A;  3VNR A;  4BC7 A;  3ETO A;  3G7S A;  1O90 A;  4L4Q A;  4DV6 C;  2AYA A;  5BSU A;  4DG9 A;  5AE3 A;  2D1S A;  3E7W A;  2P2B A;  3VNQ A;  4LF5 C;  4BC9 A;  1IBK C;  1AMU A;  2QVZ X;  5A19 A;  3UX2 A;  4LFB C;  3A9V A;  3CQ1 A;  4RVN A;  4ODJ A;  2WP0 C;  5IFI A;  4LF7 C;  3A25 A;  2KZ0 A;  3JAM D;  2KZF A;  4JI8 C;  1V25 A;  3IPL A;  4R1L A;  4FTF A;  4RLQ A;  5AE2 A;  2DHM A;  4NXM C;  2ZZM A;  3CW8 X;  3TDE A;  5BR8 C;  4ISB A;  4GKK C;  1O92 A;  4GS5 A;  2P20 A;  4TPS B;  4X65 C;  4GXQ A;  1IBM C;  4LFA C;  3UZ0 A;  1XDX A;  1XMO C;  2CY1 A;  1HR0 C;  2E8E A;  4BSZ A;  4DCU A;  3AF5 A;  2DYJ A;  5BUR A;  5LMU C;  1VEH A;  4DV4 C;  2MMA B;  2ONF A;  4JI3 C;  5KEI A;  1MXC A;  1XHJ A;  4DCV A;  5BUQ A;  4FUT A;  2ASB A;  3AY0 A;  2Z51 A;  5E7Q A;  2ATW A;  2KDN A;  4IZ6 A;  5LMN C;  1XRB A;  2XR1 A;  2D1Q A;  3TUF A;  4B3T C;  3EER A;  1MDB A;  4NOZ A;  2P2F A;  2Y4N A;  1USP B;  2UUC C;  2D1R A;  1XNQ C;  4PZP A;  3UX3 A;  4LF9 C;  4DR1 C;  4LF6 C;  1NYE A;  3L8C A;  4DR5 C;  4OX9 C;  4I9F A;  1XS3 A;  1BA3 A;  1GPM A;  3E7X A;  4DV2 C;  2ZZN A;  3EQ6 A;  2BJO A;  2PG1 E;  1O93 A;  4DV3 C;  2DPL A;  2E5L C;  3A9U A;  1N34 C;  3UEB A;  2F4V C;  4B3S C;  4X62 C;  5K8F A;  3UOW A;  4R1M A;  1P4E C;  4I9G A;  4HPV A;  5CZV A;  2EGT A;  4G1I A;  3L95 X;  1XRA A;  3J81 D;  5BSW A;  4PUG A;  1UWD A;  4YHH C;  4BCA A;  4G36 A;  5BUS A;  1J5E C;  1MDF A;  4K0K C;  1ZB9 A;  3DAY A;  4LE5 A;  1IBL C;  1PG4 A;  3NI2 A;  3K6R A;  3KXW A;  2UXC C;  3LNO A;  4PHT A;  3B7W A;  3I08 A;  5KYV A;  5K85 A;  3FM7 A;  2QVY X;  4BBY A;  2BH1 X;  3H2T A;  2PN2 A;  2P02 A;  3DLP X;  2E0G A;  3RV2 A;  1ULT A;  2M5O A;  1P7L A;  3CQ2 A;  1TH5 A;  1RY2 A;  1WF3 A;  2MM9 A;  3PRO C;  1O9T A;  2VQE C;  3NYQ A;  4RLF A;  5JRH A;  4KHP C;  2VQF C;  2UXD C;  1M6X C;  2YWC A;  1L2F A;  3IEU A;  2D1T A;  5BSM A;  4D57 A;  4KTV A;  3S82 A;  1N36 C;  4PUH A;  4X64 C;  3AF6 A;  4JI6 C;  2CXC A;  1K0R A;  2UU9 C;  1MXB A;  4ZLP A;  5H9U A;  1HNX C;  3R9W A;  3TR3 A;  3DHV A;  1V60 A;  2JNV A;  2Y4O A;  4DR3 C;  1YGT A;  3PBK A;  2M5H A;  4FUQ A;  3R9X A;  1HNW C;  4NXN C;  2YX1 A;  3CJE A;  2YCB A;  4RM3 A;  3CQ3 A;  3C5E A;  3LAX A;  1I94 C;  4JI2 C;  1NY8 A;  4D56 A;  4D4I A;  3J80 D;  1HNZ C;  2OPL A;  2Y27 A;  4G37 A;  1XRC A;  4JI7 C;  4DR7 C;  5T8T A;  3NYR A;  1MXA A;  2CU6 A;  4EAT A;  5GTD A;  5FLX D;  4DUZ C;  4L7I A;  3J7A D;  3VNS A;  4JI1 C;  3CW9 A;  2UUB C;  2MCQ A;  4OXI A;  4LF8 C;  1N32 C;  4DV1 C;  5KYT A;  4MH4 A;  1M6X A;  4RVO A;  4PUI A;  2E8C A;  3N2Q A;  2VSQ A;  4WS9 A;  3IEV A;  2D7V A;  3GR1 A;  4JI0 C;  1LCI A;  3N54 B;  2PT7 G;  2YWB A;  3R44 A;  2PRO A;  4KTT A;  1PU1 A;  4B3M C;  5BSR A;  1ML8 A;  3LGX A;  2NCL A;  2QW0 X;  4L2Z A;  2V7B A;  3IML A;  4GXR A;  2UXB C;  1USP A;  1FJG C;  1N33 C;  2E7G A;  2P2Q A;  2QL8 A;  4X66 C;  4RM2 A;  5LCI A;  3T1H C;  5AE1 A;  3FCE A;  2JMP A;  4DR6 C;  1QM4 A;  3I07 A;  4B3R C;  4DG8 A;  2OPL B;  4U5Y D;  4R0M A;  4YY3 C;  2P2M A;  4DCT A;  3LUS A;  4PRO C;  4XX2 A;  4ZJZ A;  1MD9 A;  5ADZ A;  3TQI A;  1UKK A;  2UUA C;  1T5H X;  2VZE A;  1YJ7 A;  3SO4 A;  4MTN A;  5A1G A;  4D4G A;  4K0B A;  5DV9 A;  2ZM6 C;  5BST A;  1RG9 A;  3OTO C;  4DUY C;  2QVX X;  3LNV A;  1XMQ C;  1P4E A;  4AQY C;  4JYA C;  1N2F A;  2P2J A;  4LF4 C;  3GPC A;  3GKU A;  4DV0 C;  4DV5 C;  4RMN A;  5IT9 D;  1JOS A;  2D27 A;  3PES A;  2HJG A;  2E8F A;  2WD9 A;  1LQL A;  4DR4 C;  3T1Y C;  4JI4 C; 
#chains in the Genus database with same CATH homology
 1HH2 P;  1V26 A;  1XNR C;  3NPD A;  4NDN A;  4DCS A;  4LFC C;  5T8S A;  1ZB8 A;  5IWA C;  5A2Q D;  4GKJ C;  3ETC A;  5BSV A;  1FUG A;  1T5D X;  2OO4 A;  5CZX A;  1PG3 A;  1VLA A;  4DR2 C;  4WV3 A;  4IR7 A;  1KKG A;  1QWI A;  3GR0 A;  1EGA A;  2HHH C;  4JM1 A;  4DV7 C;  4OYC A;  4JV5 C;  4JI5 C;  3A4I A;  1WH9 A;  5A1I A;  1MKY A;  3RG2 A;  1PA4 A;  2OBV A;  2D28 C;  3FCC A;  3VNR A;  4BC7 A;  3ETO A;  3G7S A;  1O90 A;  4L4Q A;  4DV6 C;  2AYA A;  5BSU A;  4DG9 A;  5AE3 A;  2D1S A;  3E7W A;  2P2B A;  3VNQ A;  4LF5 C;  4BC9 A;  1IBK C;  1AMU A;  2QVZ X;  5A19 A;  4LFB C;  3A9V A;  4RVN A;  4ODJ A;  2WP0 C;  5IFI A;  4LF7 C;  3JAM D;  2KZF A;  4JI8 C;  1V25 A;  3IPL A;  4R1L A;  4FTF A;  4RLQ A;  5AE2 A;  4NXM C;  3CW8 X;  3TDE A;  5BR8 C;  4ISB A;  4GKK C;  1O92 A;  4GS5 A;  2P20 A;  4TPS B;  4X65 C;  4GXQ A;  1IBM C;  4LFA C;  3UZ0 A;  1XMO C;  2CY1 A;  1HR0 C;  2E8E A;  4BSZ A;  4DCU A;  3AF5 A;  2DYJ A;  5BUR A;  5LMU C;  4DV4 C;  2ONF A;  4JI3 C;  5KEI A;  1MXC A;  4DCV A;  5BUQ A;  4FUT A;  2ASB A;  5E7Q A;  2ATW A;  4IZ6 A;  5LMN C;  1XRB A;  2XR1 A;  2D1Q A;  3TUF A;  4B3T C;  3EER A;  1MDB A;  4NOZ A;  2P2F A;  2Y4N A;  1USP B;  2UUC C;  2D1R A;  1XNQ C;  4PZP A;  4LF9 C;  4DR1 C;  4LF6 C;  1NYE A;  3L8C A;  4DR5 C;  4OX9 C;  4I9F A;  1BA3 A;  1GPM A;  3E7X A;  4DV2 C;  3EQ6 A;  2BJO A;  1O93 A;  4DV3 C;  2DPL A;  2E5L C;  3A9U A;  1N34 C;  2F4V C;  4B3S C;  4X62 C;  5K8F A;  3UOW A;  4R1M A;  4I9G A;  4HPV A;  5CZV A;  2EGT A;  4G1I A;  3L95 X;  1XRA A;  3J81 D;  5BSW A;  4YHH C;  4BCA A;  4G36 A;  5BUS A;  1J5E C;  1MDF A;  4K0K C;  1ZB9 A;  3DAY A;  4LE5 A;  1IBL C;  1PG4 A;  3NI2 A;  3KXW A;  2UXC C;  4PHT A;  3B7W A;  3I08 A;  5KYV A;  5K85 A;  2QVY X;  4BBY A;  2BH1 X;  3H2T A;  2PN2 A;  2P02 A;  3DLP X;  2E0G A;  3RV2 A;  1ULT A;  1P7L A;  1RY2 A;  1WF3 A;  3PRO C;  1O9T A;  2VQE C;  3NYQ A;  4RLF A;  5JRH A;  4KHP C;  2VQF C;  2UXD C;  2YWC A;  1L2F A;  3IEU A;  2D1T A;  5BSM A;  4D57 A;  4KTV A;  3S82 A;  1N36 C;  4X64 C;  3AF6 A;  4JI6 C;  2CXC A;  1K0R A;  2UU9 C;  1MXB A;  4ZLP A;  5H9U A;  1HNX C;  3R9W A;  3DHV A;  2Y4O A;  4DR3 C;  3PBK A;  4FUQ A;  3R9X A;  1HNW C;  4NXN C;  3CJE A;  2YCB A;  4RM3 A;  3LAX A;  3C5E A;  1I94 C;  4JI2 C;  4D56 A;  4D4I A;  3J80 D;  1HNZ C;  2OPL A;  2Y27 A;  4G37 A;  1XRC A;  4JI7 C;  4DR7 C;  5T8T A;  3NYR A;  1MXA A;  4EAT A;  5GTD A;  5FLX D;  4DUZ C;  4L7I A;  3J7A D;  3VNS A;  4JI1 C;  3CW9 A;  2UUB C;  4OXI A;  4LF8 C;  1N32 C;  4DV1 C;  5KYT A;  4MH4 A;  4RVO A;  2E8C A;  3N2Q A;  2VSQ A;  4WS9 A;  3IEV A;  2D7V A;  3GR1 A;  4JI0 C;  1LCI A;  3N54 B;  2PT7 G;  2YWB A;  3R44 A;  2PRO A;  4KTT A;  4B3M C;  5BSR A;  1ML8 A;  3LGX A;  2QW0 X;  4L2Z A;  2V7B A;  3IML A;  4GXR A;  2UXB C;  1USP A;  1FJG C;  1N33 C;  2E7G A;  2P2Q A;  2QL8 A;  4X66 C;  4RM2 A;  3T1H C;  5AE1 A;  3FCE A;  2JMP A;  4DR6 C;  1QM4 A;  3I07 A;  4B3R C;  4DG8 A;  2OPL B;  4U5Y D;  4R0M A;  4YY3 C;  2P2M A;  4DCT A;  3LUS A;  4PRO C;  4XX2 A;  4ZJZ A;  1MD9 A;  5ADZ A;  3TQI A;  1UKK A;  2UUA C;  1T5H X;  2VZE A;  1YJ7 A;  3SO4 A;  4MTN A;  5A1G A;  4D4G A;  4K0B A;  5DV9 A;  2ZM6 C;  5BST A;  1RG9 A;  3OTO C;  4DUY C;  2QVX X;  3LNV A;  1XMQ C;  4AQY C;  4JYA C;  1N2F A;  2P2J A;  4LF4 C;  3GPC A;  3GKU A;  4DV0 C;  4DV5 C;  4RMN A;  5IT9 D;  1JOS A;  2D27 A;  3PES A;  2HJG A;  2E8F A;  2WD9 A;  1LQL A;  4DR4 C;  3T1Y C;  4JI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...