3T1HC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3t1hC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3t1hC02
3JAMD 2D7VA 4DR5C 4MTNA 4NXMC 4B3SC 4JI6C 4DV7C 1I94C 2BJOA 3R9XA 2XR1A 2HJGA 4LFBC 3GKUA 1HR0C 2YCBA 1JOSA 2ZM6C 2E5LC 3OTOC 1N36C 2F4VC 2UXBC 2JMPA 1USPB 4B3TC 1UKKA 5A2QD 1ML8A 3I07A 3R9WA 1ZB8A 4DV5C 1HH2P 4B3MC 1MKYA 2HHHC 4DR7C 5FLXD 2PN2A 4LF8C 4LF9C 1K0RA 2OPLA 4AQYC 4LF7C 4DCSA 2KZFA 2EGTA 1J5EC 1N2FA 4X65C 2ATWA 1XMQC 4DCTA 1KKGA 1L2FA 1ZB9A 4X66C 4DV0C 1IBKC 1LQLA 1VLAA 1PA4A 4DR1C 4X62C 4NXNC 2UUBC 4DCVA 5BR8C 2UUCC 2ASBA 4DV4C 4JI4C 4BSZA 2QL8A 4GKJC 2UXCC 3IEVA 2DYJA 5IT9D 2E8EA 4DV2C 1IBLC 1HNXC 4JI7C 1HNZC 1NYEA 4DV1C 4XX2A 1FJGC 4LFAC 1XNRC 5LMUC 3LUSA 4JI3C 5LMNC 2PT7G 4JI8C 4YHHC 4DUZC 1N34C 1HNWC 3CJEA 3IEUA 4DR6C 4JI2C 2E7GA 2OPLB 4NOZA 1WF3A 5IWAC 4DR3C 4DUYC 1XNQC 4DR2C 4LF6C 4JI1C 2CY1A 1XMOC 4OX9C 4JV5C 2VQFC 2E8FA 4DCUA 3J7AD 4X64C 4LF5C 1EGAA 4B3RC 1IBMC 3EERA 3J80D 4JI0C 2UU9C 4JYAC 1N33C 2ONFA 3J81D 4K0KC 1N32C 4LFCC 1WH9A 3AF6A 2CXCA 2VQEC 3T1HC 4YY3C 4DV3C 4MH4A 2UXDC 4GKKC 1QWIA 4JI5C 4KHPC 3AF5A 2UUAC 4DR4C 1USPA 4LF4C 2E8CA 3T1YC 4DV6C
chains in the Genus database with same CATH superfamily
3IMLA 3R44A 4NXMC 3R9XA 1I94C 3UZ0A 3NI2A 3VNRA 2HJGA 4WV3A 2DHMA 4RVOA 1HR0C 2YCBA 4DG9A 5H9UA 4B3TC 2M5HA 3VNSA 1ZB8A 4HPVA 3CW8X 1MKYA 5AE1A 4PUGA 4FTFA 3GR0A 4LF8C 5BUSA 1K0RA 4BC9A 4AQYC 4G1IA 3PESA 4RLQA 1V60A 3A9VA 1XRBA 2P2QA 4L7IA 1L2FA 1VLAA 3FCCA 3N2QA 1RG9A 4BC7A 1P7LA 4GXQA 2UUCC 2ASBA 4BSZA 4R1MA 4PUHA 4GKJC 4D56A 5ADZA 3H2TA 2E8EA 1M6XC 3A26A 4XX2A 1O93A 1WCJA 1T5HX 4JI3C 3A9UA 2E7GA 2V7BA 2E0GA 4NOZA 1O9TA 4BBYA 1XNQC 4LF6C 2D1QA 1XRCA 5BSRA 4OX9C 2YX1A 2E8FA 1EGAA 4OXIA 1UWDA 3J80D 2P2BA 2UU9C 2Y4NA 3CQ1A 3J81D 3NYRA 4LFCC 2CXCA 3UX3A 4YY3C 3TR3A 1MXCA 4MH4A 4KHPC 5A1GA 2ZTBA 4ISBA 2BJOA 2D27A 3DHVA 1NY8A 1VEHA 4L2ZA 1V25A 3GKUA 3FM7A 2D1SA 3OTOC 1P4EC 4K0BA 5KEIA 5KYTA 2F4VC 2JMPA 5A19A 1MXAA 4EATA 3I07A 2QVZX 5BSUA 5A1IA 2PG1E 4B3MC 4RMNA 5FLXD 5JRHA 2OPLA 1MD9A 4LF7C 3GR1A 5CZXA 2KZFA 2EGTA 1J5EC 2P2JA 1XMQC 4RVNA 5BSWA 4DV0C 1IBKC 3GPCA 3FCEA 5BSVA 2YWCA 3DLPX 2UUBC 4DCVA 4NDNA 1FLOA 4DV4C 1O90A 4D57A 2UXCC 2DYJA 3L95X 3N54B 1LCIA 4DV2C 2P2FA 1NYEA 4WS9A 2P20A 2PT7G 2QVYX 4YHHC 4ODJA 3CQ3A 4DR6C 4JI2C 5LCIA 2OPLB 5IWAC 5E7QA 2CY1A 1XMOC 2VSQA 2D28C 4IR7A 2VQFC 1MXBA 4X64C 2YWBA 4B3RC 1IBMC 1YGTA 3EERA 4DG8A 4JM1A 3E7WA 4JYAC 4R1LA 2ONFA 1PG4A 3LNVA 1WH9A 3AF6A 2VQEC 3RV2A 4BCAA 3T1HC 3B7WA 1MDBA 1V26A 2KZ0A 5BURA 4GKKC 1QWIA 2JNVA 3TQIA 3JAMD 4DR5C 4MTNA 3LGXA 4B3SC 4JI6C 4PHTA 4D4IA 3ETCA 2KDNA 4LFBC 3ETOA 2ZM6C 1XDXA 2UXBC 3NYQA 1USPB 2ZZNA 2D1TA 2DPLA 1XHJA 4L4QA 1ML8A 4ZLPA 5T8TA 4DV5C 4DR7C 5IFIA 4PUIA 4DCSA 3EQ6A 1N2FA 4X65C 4DCTA 1ZB9A 3G7SA 1PA4A 4DR1C 5GTDA 4NXNC 2OBVA 3S82A 4G37A 3LAXA 1BA3A 1RY2A 4ZJZA 5IT9D 2WP0C 1TH5A 3E7XA 4DV1C 1AMUA 2Y4OA 4LFAC 2Y27A 1XNRC 1FUGA 4PROC 3LUSA 3AY0A 4R0MA 5DV9A 4JI8C 4DUZC 1M6XA 4FUTA 3CJEA 3IEUA 3IPLA 3PBKA 3O2EA 1WF3A 4DR3C 4DUYC 5AE3A 2MM9A 4RM2A 2D1RA 2MMAB 3J7AD 5K8FA 5KYVA 4LE5A 2AYAA 2CU6A 1N33C 4K0KC 5BSMA 1IB8A 4KTVA 2WD9A 4DV3C 1PG3A 4PZPA 4JI5C 3AF5A 3CQ2A 3KXWA 4DR4C 1USPA 4U5YD 4LF4C 3T1YC 5K85A 4DV6C 3I08A 2D7VA 3L8CA 4DV7C 4I9FA 4KTTA 2XR1A 1GPMA 2VZEA 1JOSA 5AE2A 1MDFA 3A4IA 2E5LC 1N36C 3A25A 1UKKA 1XRAA 5A2QD 4RM3A 3R9WA 4IZ6A 2ZZMA 4FUQA 1HH2P 2HHHC 5BUQA 2PN2A 4LF9C 1P4EA 5T8SA 4GXRA 2QW0X 4GS5A 5CZVA 2ATWA 4OYCA 1YJ7A 1KKGA 3UX2A 4X66C 1LQLA 3K6RA 1T5DX 3TDEA 4X62C 5BR8C 4I9GA 3DAYA 3CW9A 4JI4C 1ULTA 2M5OA 2Z51A 2QL8A 3IEVA 2OO4A 1IBLC 1HNXC 3LNOA 4JI7C 1HNZC 1FJGC 3UOWA 4D4GA 5LMUC 5LMNC 3TUFA 5BSTA 4G36A 1N34C 1HNWC 3VNQA 2PROA 4TPSB 2P02A 4DR2C 4JI1C 2QVXX 4JV5C 1QM4A 2MCQA 4DCUA 4LF5C 3NPDA 4JI0C 4RLFA 2P2MA 1N32C 1PU1A 2NCLA 3UEBA 3RG2A 3SO4A 3C5EA 2UXDC 2BH1X 2UUAC 3PROC 1O92A 1XS3A 2E8CA
chains in the Genus database with same CATH topology
3IMLA 3R44A 4NXMC 3R9XA 1I94C 3UZ0A 3NI2A 3VNRA 2HJGA 4WV3A 4RVOA 1HR0C 2YCBA 4DG9A 5H9UA 4B3TC 3VNSA 1ZB8A 4HPVA 3CW8X 1MKYA 5AE1A 4FTFA 3GR0A 4LF8C 5BUSA 1K0RA 4BC9A 4AQYC 4G1IA 3PESA 4RLQA 3A9VA 1XRBA 2P2QA 4L7IA 1L2FA 1VLAA 3FCCA 3N2QA 1RG9A 4BC7A 1P7LA 4GXQA 2UUCC 2ASBA 4BSZA 4R1MA 4GKJC 4D56A 5ADZA 3H2TA 2E8EA 4XX2A 1O93A 1T5HX 4JI3C 3A9UA 2E7GA 2V7BA 2E0GA 4NOZA 1O9TA 4BBYA 1XNQC 4LF6C 2D1QA 1XRCA 5BSRA 4OX9C 2E8FA 1EGAA 4OXIA 3J80D 2P2BA 2UU9C 2Y4NA 3J81D 3NYRA 4LFCC 2CXCA 4YY3C 1MXCA 4MH4A 4KHPC 5A1GA 4ISBA 2BJOA 2D27A 3DHVA 4L2ZA 1V25A 3GKUA 2D1SA 3OTOC 4K0BA 5KEIA 5KYTA 2F4VC 2JMPA 5A19A 1MXAA 4EATA 3I07A 2QVZX 5BSUA 5A1IA 4B3MC 4RMNA 5FLXD 5JRHA 2OPLA 1MD9A 4LF7C 3GR1A 5CZXA 2KZFA 2EGTA 1J5EC 2P2JA 1XMQC 4RVNA 5BSWA 4DV0C 1IBKC 3GPCA 3FCEA 5BSVA 2YWCA 3DLPX 2UUBC 4DCVA 4NDNA 4DV4C 1O90A 4D57A 2UXCC 2DYJA 3L95X 3N54B 1LCIA 4DV2C 2P2FA 1NYEA 4WS9A 2P20A 2PT7G 2QVYX 4YHHC 4ODJA 4DR6C 4JI2C 2OPLB 5IWAC 5E7QA 2CY1A 1XMOC 2VSQA 2D28C 4IR7A 2VQFC 1MXBA 4X64C 2YWBA 4B3RC 1IBMC 3EERA 4DG8A 4JM1A 3E7WA 4JYAC 4R1LA 2ONFA 1PG4A 3LNVA 1WH9A 3AF6A 2VQEC 3RV2A 4BCAA 3T1HC 3B7WA 1MDBA 1V26A 5BURA 4GKKC 1QWIA 3TQIA 3JAMD 4DR5C 4MTNA 3LGXA 4B3SC 4JI6C 4PHTA 4D4IA 3ETCA 4LFBC 3ETOA 2ZM6C 2UXBC 3NYQA 1USPB 2D1TA 2DPLA 4L4QA 1ML8A 4ZLPA 5T8TA 4DV5C 4DR7C 5IFIA 4DCSA 3EQ6A 1N2FA 4X65C 4DCTA 1ZB9A 3G7SA 1PA4A 4DR1C 5GTDA 4NXNC 2OBVA 3S82A 4G37A 3LAXA 1BA3A 1RY2A 4ZJZA 5IT9D 2WP0C 3E7XA 4DV1C 1AMUA 2Y4OA 4LFAC 2Y27A 1XNRC 1FUGA 4PROC 3LUSA 4R0MA 5DV9A 4JI8C 4DUZC 4FUTA 3CJEA 3IEUA 3IPLA 3PBKA 1WF3A 4DR3C 4DUYC 5AE3A 4RM2A 2D1RA 3J7AD 5K8FA 5KYVA 4LE5A 2AYAA 1N33C 4K0KC 5BSMA 4KTVA 2WD9A 4DV3C 1PG3A 4PZPA 4JI5C 3AF5A 3KXWA 4DR4C 1USPA 4U5YD 4LF4C 3T1YC 4DV6C 5K85A 3I08A 2D7VA 3L8CA 4DV7C 4I9FA 4KTTA 2XR1A 1GPMA 2VZEA 1JOSA 5AE2A 1MDFA 3A4IA 2E5LC 1N36C 1UKKA 1XRAA 5A2QD 4RM3A 3R9WA 4IZ6A 4FUQA 1HH2P 2HHHC 5BUQA 2PN2A 4LF9C 5T8SA 4GXRA 2QW0X 4GS5A 5CZVA 2ATWA 4OYCA 1YJ7A 1KKGA 4X66C 1LQLA 1T5DX 3TDEA 4X62C 5BR8C 4I9GA 3DAYA 3CW9A 4JI4C 1ULTA 2QL8A 3IEVA 2OO4A 1IBLC 1HNXC 4JI7C 1HNZC 1FJGC 3UOWA 4D4GA 5LMUC 5LMNC 3TUFA 5BSTA 4G36A 1N34C 1HNWC 3VNQA 2PROA 4TPSB 2P02A 4DR2C 4JI1C 2QVXX 4JV5C 1QM4A 4DCUA 4LF5C 3NPDA 4JI0C 4RLFA 2P2MA 1N32C 3RG2A 3SO4A 3C5EA 2UXDC 2BH1X 2UUAC 3PROC 1O92A 2E8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM D;  2D7V A;  4DR5 C;  4MTN A;  4NXM C;  4B3S C;  4JI6 C;  4DV7 C;  1I94 C;  2BJO A;  3R9X A;  2XR1 A;  2HJG A;  4LFB C;  3GKU A;  1HR0 C;  2YCB A;  1JOS A;  2ZM6 C;  2E5L C;  3OTO C;  1N36 C;  2F4V C;  2UXB C;  2JMP A;  1USP B;  4B3T C;  1UKK A;  5A2Q D;  1ML8 A;  3I07 A;  3R9W A;  1ZB8 A;  4DV5 C;  1HH2 P;  4B3M C;  1MKY A;  2HHH C;  4DR7 C;  5FLX D;  2PN2 A;  4LF8 C;  4LF9 C;  1K0R A;  2OPL A;  4AQY C;  4LF7 C;  4DCS A;  2KZF A;  2EGT A;  1J5E C;  1N2F A;  4X65 C;  2ATW A;  1XMQ C;  4DCT A;  1KKG A;  1L2F A;  1ZB9 A;  4X66 C;  4DV0 C;  1IBK C;  1LQL A;  1VLA A;  1PA4 A;  4DR1 C;  4X62 C;  4NXN C;  2UUB C;  4DCV A;  5BR8 C;  2UUC C;  2ASB A;  4DV4 C;  4JI4 C;  4BSZ A;  2QL8 A;  4GKJ C;  2UXC C;  3IEV A;  2DYJ A;  5IT9 D;  2E8E A;  4DV2 C;  1IBL C;  1HNX C;  4JI7 C;  1HNZ C;  1NYE A;  4DV1 C;  4XX2 A;  1FJG C;  4LFA C;  1XNR C;  5LMU C;  3LUS A;  4JI3 C;  5LMN C;  2PT7 G;  4JI8 C;  4YHH C;  4DUZ C;  1N34 C;  1HNW C;  3CJE A;  3IEU A;  4DR6 C;  4JI2 C;  2E7G A;  2OPL B;  4NOZ A;  1WF3 A;  5IWA C;  4DR3 C;  4DUY C;  1XNQ C;  4DR2 C;  4LF6 C;  4JI1 C;  2CY1 A;  1XMO C;  4OX9 C;  4JV5 C;  2VQF C;  2E8F A;  4DCU A;  3J7A D;  4X64 C;  4LF5 C;  1EGA A;  4B3R C;  1IBM C;  3EER A;  3J80 D;  4JI0 C;  2UU9 C;  4JYA C;  1N33 C;  2ONF A;  3J81 D;  4K0K C;  1N32 C;  4LFC C;  1WH9 A;  3AF6 A;  2CXC A;  2VQE C;  3T1H C;  4YY3 C;  4DV3 C;  4MH4 A;  2UXD C;  4GKK C;  1QWI A;  4JI5 C;  4KHP C;  3AF5 A;  2UUA C;  4DR4 C;  1USP A;  4LF4 C;  2E8C A;  3T1Y C;  4DV6 C; 
#chains in the Genus database with same CATH topology
 3IML A;  3R44 A;  4NXM C;  3R9X A;  1I94 C;  3UZ0 A;  3NI2 A;  3VNR A;  2HJG A;  4WV3 A;  2DHM A;  4RVO A;  1HR0 C;  2YCB A;  4DG9 A;  5H9U A;  4B3T C;  2M5H A;  3VNS A;  1ZB8 A;  4HPV A;  3CW8 X;  1MKY A;  5AE1 A;  4PUG A;  4FTF A;  3GR0 A;  4LF8 C;  5BUS A;  1K0R A;  4BC9 A;  4AQY C;  4G1I A;  3PES A;  4RLQ A;  1V60 A;  3A9V A;  1XRB A;  2P2Q A;  4L7I A;  1L2F A;  1VLA A;  3FCC A;  3N2Q A;  1RG9 A;  4BC7 A;  1P7L A;  4GXQ A;  2UUC C;  2ASB A;  4BSZ A;  4R1M A;  4PUH A;  4GKJ C;  4D56 A;  5ADZ A;  3H2T A;  2E8E A;  1M6X C;  3A26 A;  4XX2 A;  1O93 A;  1WCJ A;  1T5H X;  4JI3 C;  3A9U A;  2E7G A;  2V7B A;  2E0G A;  4NOZ A;  1O9T A;  4BBY A;  1XNQ C;  4LF6 C;  2D1Q A;  1XRC A;  5BSR A;  4OX9 C;  2YX1 A;  2E8F A;  1EGA A;  4OXI A;  1UWD A;  3J80 D;  2P2B A;  2UU9 C;  2Y4N A;  3CQ1 A;  3J81 D;  3NYR A;  4LFC C;  2CXC A;  3UX3 A;  4YY3 C;  3TR3 A;  1MXC A;  4MH4 A;  4KHP C;  5A1G A;  2ZTB A;  4ISB A;  2BJO A;  2D27 A;  3DHV A;  1NY8 A;  1VEH A;  4L2Z A;  1V25 A;  3GKU A;  3FM7 A;  2D1S A;  3OTO C;  1P4E C;  4K0B A;  5KEI A;  5KYT A;  2F4V C;  2JMP A;  5A19 A;  1MXA A;  4EAT A;  3I07 A;  2QVZ X;  5BSU A;  5A1I A;  2PG1 E;  4B3M C;  4RMN A;  5FLX D;  5JRH A;  2OPL A;  1MD9 A;  4LF7 C;  3GR1 A;  5CZX A;  2KZF A;  2EGT A;  1J5E C;  2P2J A;  1XMQ C;  4RVN A;  5BSW A;  4DV0 C;  1IBK C;  3GPC A;  3FCE A;  5BSV A;  2YWC A;  3DLP X;  2UUB C;  4DCV A;  4NDN A;  1FLO A;  4DV4 C;  1O90 A;  4D57 A;  2UXC C;  2DYJ A;  3L95 X;  3N54 B;  1LCI A;  4DV2 C;  2P2F A;  1NYE A;  4WS9 A;  2P20 A;  2PT7 G;  2QVY X;  4YHH C;  4ODJ A;  3CQ3 A;  4DR6 C;  4JI2 C;  5LCI A;  2OPL B;  5IWA C;  5E7Q A;  2CY1 A;  1XMO C;  2VSQ A;  2D28 C;  4IR7 A;  2VQF C;  1MXB A;  4X64 C;  2YWB A;  4B3R C;  1IBM C;  1YGT A;  3EER A;  4DG8 A;  4JM1 A;  3E7W A;  4JYA C;  4R1L A;  2ONF A;  1PG4 A;  3LNV A;  1WH9 A;  3AF6 A;  2VQE C;  3RV2 A;  4BCA A;  3T1H C;  3B7W A;  1MDB A;  1V26 A;  2KZ0 A;  5BUR A;  4GKK C;  1QWI A;  2JNV A;  3TQI A;  3JAM D;  4DR5 C;  4MTN A;  3LGX A;  4B3S C;  4JI6 C;  4PHT A;  4D4I A;  3ETC A;  2KDN A;  4LFB C;  3ETO A;  2ZM6 C;  1XDX A;  2UXB C;  3NYQ A;  1USP B;  2ZZN A;  2D1T A;  2DPL A;  1XHJ A;  4L4Q A;  1ML8 A;  4ZLP A;  5T8T A;  4DV5 C;  4DR7 C;  5IFI A;  4PUI A;  4DCS A;  3EQ6 A;  1N2F A;  4X65 C;  4DCT A;  1ZB9 A;  3G7S A;  1PA4 A;  4DR1 C;  5GTD A;  4NXN C;  2OBV A;  3S82 A;  4G37 A;  3LAX A;  1BA3 A;  1RY2 A;  4ZJZ A;  5IT9 D;  2WP0 C;  1TH5 A;  3E7X A;  4DV1 C;  1AMU A;  2Y4O A;  4LFA C;  2Y27 A;  1XNR C;  1FUG A;  4PRO C;  3LUS A;  3AY0 A;  4R0M A;  5DV9 A;  4JI8 C;  4DUZ C;  1M6X A;  4FUT A;  3CJE A;  3IEU A;  3IPL A;  3PBK A;  3O2E A;  1WF3 A;  4DR3 C;  4DUY C;  5AE3 A;  2MM9 A;  4RM2 A;  2D1R A;  2MMA B;  3J7A D;  5K8F A;  5KYV A;  4LE5 A;  2AYA A;  2CU6 A;  1N33 C;  4K0K C;  5BSM A;  1IB8 A;  4KTV A;  2WD9 A;  4DV3 C;  1PG3 A;  4PZP A;  4JI5 C;  3AF5 A;  3CQ2 A;  3KXW A;  4DR4 C;  1USP A;  4U5Y D;  4LF4 C;  3T1Y C;  5K85 A;  4DV6 C;  3I08 A;  2D7V A;  3L8C A;  4DV7 C;  4I9F A;  4KTT A;  2XR1 A;  1GPM A;  2VZE A;  1JOS A;  5AE2 A;  1MDF A;  3A4I A;  2E5L C;  1N36 C;  3A25 A;  1UKK A;  1XRA A;  5A2Q D;  4RM3 A;  3R9W A;  4IZ6 A;  2ZZM A;  4FUQ A;  1HH2 P;  2HHH C;  5BUQ A;  2PN2 A;  4LF9 C;  1P4E A;  5T8S A;  4GXR A;  2QW0 X;  4GS5 A;  5CZV A;  2ATW A;  4OYC A;  1YJ7 A;  1KKG A;  3UX2 A;  4X66 C;  1LQL A;  3K6R A;  1T5D X;  3TDE A;  4X62 C;  5BR8 C;  4I9G A;  3DAY A;  3CW9 A;  4JI4 C;  1ULT A;  2M5O A;  2Z51 A;  2QL8 A;  3IEV A;  2OO4 A;  1IBL C;  1HNX C;  3LNO A;  4JI7 C;  1HNZ C;  1FJG C;  3UOW A;  4D4G A;  5LMU C;  5LMN C;  3TUF A;  5BST A;  4G36 A;  1N34 C;  1HNW C;  3VNQ A;  2PRO A;  4TPS B;  2P02 A;  4DR2 C;  4JI1 C;  2QVX X;  4JV5 C;  1QM4 A;  2MCQ A;  4DCU A;  4LF5 C;  3NPD A;  4JI0 C;  4RLF A;  2P2M A;  1N32 C;  1PU1 A;  2NCL A;  3UEB A;  3RG2 A;  3SO4 A;  3C5E A;  2UXD C;  2BH1 X;  2UUA C;  3PRO C;  1O92 A;  1XS3 A;  2E8C A; 
#chains in the Genus database with same CATH homology
 3IML A;  3R44 A;  4NXM C;  3R9X A;  1I94 C;  3UZ0 A;  3NI2 A;  3VNR A;  2HJG A;  4WV3 A;  4RVO A;  1HR0 C;  2YCB A;  4DG9 A;  5H9U A;  4B3T C;  3VNS A;  1ZB8 A;  4HPV A;  3CW8 X;  1MKY A;  5AE1 A;  4FTF A;  3GR0 A;  4LF8 C;  5BUS A;  1K0R A;  4BC9 A;  4AQY C;  4G1I A;  3PES A;  4RLQ A;  3A9V A;  1XRB A;  2P2Q A;  4L7I A;  1L2F A;  1VLA A;  3FCC A;  3N2Q A;  1RG9 A;  4BC7 A;  1P7L A;  4GXQ A;  2UUC C;  2ASB A;  4BSZ A;  4R1M A;  4GKJ C;  4D56 A;  5ADZ A;  3H2T A;  2E8E A;  4XX2 A;  1O93 A;  1T5H X;  4JI3 C;  3A9U A;  2E7G A;  2V7B A;  2E0G A;  4NOZ A;  1O9T A;  4BBY A;  1XNQ C;  4LF6 C;  2D1Q A;  1XRC A;  5BSR A;  4OX9 C;  2E8F A;  1EGA A;  4OXI A;  3J80 D;  2P2B A;  2UU9 C;  2Y4N A;  3J81 D;  3NYR A;  4LFC C;  2CXC A;  4YY3 C;  1MXC A;  4MH4 A;  4KHP C;  5A1G A;  4ISB A;  2BJO A;  2D27 A;  3DHV A;  4L2Z A;  1V25 A;  3GKU A;  2D1S A;  3OTO C;  4K0B A;  5KEI A;  5KYT A;  2F4V C;  2JMP A;  5A19 A;  1MXA A;  4EAT A;  3I07 A;  2QVZ X;  5BSU A;  5A1I A;  4B3M C;  4RMN A;  5FLX D;  5JRH A;  2OPL A;  1MD9 A;  4LF7 C;  3GR1 A;  5CZX A;  2KZF A;  2EGT A;  1J5E C;  2P2J A;  1XMQ C;  4RVN A;  5BSW A;  4DV0 C;  1IBK C;  3GPC A;  3FCE A;  5BSV A;  2YWC A;  3DLP X;  2UUB C;  4DCV A;  4NDN A;  4DV4 C;  1O90 A;  4D57 A;  2UXC C;  2DYJ A;  3L95 X;  3N54 B;  1LCI A;  4DV2 C;  2P2F A;  1NYE A;  4WS9 A;  2P20 A;  2PT7 G;  2QVY X;  4YHH C;  4ODJ A;  4DR6 C;  4JI2 C;  2OPL B;  5IWA C;  5E7Q A;  2CY1 A;  1XMO C;  2VSQ A;  2D28 C;  4IR7 A;  2VQF C;  1MXB A;  4X64 C;  2YWB A;  4B3R C;  1IBM C;  3EER A;  4DG8 A;  4JM1 A;  3E7W A;  4JYA C;  4R1L A;  2ONF A;  1PG4 A;  3LNV A;  1WH9 A;  3AF6 A;  2VQE C;  3RV2 A;  4BCA A;  3T1H C;  3B7W A;  1MDB A;  1V26 A;  5BUR A;  4GKK C;  1QWI A;  3TQI A;  3JAM D;  4DR5 C;  4MTN A;  3LGX A;  4B3S C;  4JI6 C;  4PHT A;  4D4I A;  3ETC A;  4LFB C;  3ETO A;  2ZM6 C;  2UXB C;  3NYQ A;  1USP B;  2D1T A;  2DPL A;  4L4Q A;  1ML8 A;  4ZLP A;  5T8T A;  4DV5 C;  4DR7 C;  5IFI A;  4DCS A;  3EQ6 A;  1N2F A;  4X65 C;  4DCT A;  1ZB9 A;  3G7S A;  1PA4 A;  4DR1 C;  5GTD A;  4NXN C;  2OBV A;  3S82 A;  4G37 A;  3LAX A;  1BA3 A;  1RY2 A;  4ZJZ A;  5IT9 D;  2WP0 C;  3E7X A;  4DV1 C;  1AMU A;  2Y4O A;  4LFA C;  2Y27 A;  1XNR C;  1FUG A;  4PRO C;  3LUS A;  4R0M A;  5DV9 A;  4JI8 C;  4DUZ C;  4FUT A;  3CJE A;  3IEU A;  3IPL A;  3PBK A;  1WF3 A;  4DR3 C;  4DUY C;  5AE3 A;  4RM2 A;  2D1R A;  3J7A D;  5K8F A;  5KYV A;  4LE5 A;  2AYA A;  1N33 C;  4K0K C;  5BSM A;  4KTV A;  2WD9 A;  4DV3 C;  1PG3 A;  4PZP A;  4JI5 C;  3AF5 A;  3KXW A;  4DR4 C;  1USP A;  4U5Y D;  4LF4 C;  3T1Y C;  4DV6 C;  5K85 A;  3I08 A;  2D7V A;  3L8C A;  4DV7 C;  4I9F A;  4KTT A;  2XR1 A;  1GPM A;  2VZE A;  1JOS A;  5AE2 A;  1MDF A;  3A4I A;  2E5L C;  1N36 C;  1UKK A;  1XRA A;  5A2Q D;  4RM3 A;  3R9W A;  4IZ6 A;  4FUQ A;  1HH2 P;  2HHH C;  5BUQ A;  2PN2 A;  4LF9 C;  5T8S A;  4GXR A;  2QW0 X;  4GS5 A;  5CZV A;  2ATW A;  4OYC A;  1YJ7 A;  1KKG A;  4X66 C;  1LQL A;  1T5D X;  3TDE A;  4X62 C;  5BR8 C;  4I9G A;  3DAY A;  3CW9 A;  4JI4 C;  1ULT A;  2QL8 A;  3IEV A;  2OO4 A;  1IBL C;  1HNX C;  4JI7 C;  1HNZ C;  1FJG C;  3UOW A;  4D4G A;  5LMU C;  5LMN C;  3TUF A;  5BST A;  4G36 A;  1N34 C;  1HNW C;  3VNQ A;  2PRO A;  4TPS B;  2P02 A;  4DR2 C;  4JI1 C;  2QVX X;  4JV5 C;  1QM4 A;  4DCU A;  4LF5 C;  3NPD A;  4JI0 C;  4RLF A;  2P2M A;  1N32 C;  3RG2 A;  3SO4 A;  3C5E A;  2UXD C;  2BH1 X;  2UUA C;  3PRO C;  1O92 A;  2E8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...