3T1HC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3t1hC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 3t1hC02
4OX9C 4DR7C 1PA4A 1XNRC 2DYJA 4LF7C 3CJEA 4K0KC 4NOZA 2UUAC 4DCTA 2PN2A 2YCBA 2UUBC 4X66C 4JI1C 4MTNA 5IT9D 1ZB9A 4JI4C 1N34C 1IBMC 1ML8A 4GKKC 4B3RC 2JMPA 4GKJC 3JAMD 4LF4C 1HNXC 4LFAC 4DCUA 4LFBC 4LF6C 1UKKA 4DV7C 2ZM6C 2E8EA 4DR5C 1N33C 5FLXD 2BJOA 4YY3C 3IEVA 1USPB 1HR0C 1HH2P 3J7AD 2E5LC 2XR1A 5LMUC 4JI7C 4JI0C 4JYAC 4YHHC 3T1YC 3AF6A 4DV4C 4DR6C 4DV3C 1IBKC 3IEUA 2OPLA 3I07A 3LUSA 4LF9C 5BR8C 2UUCC 2E8CA 3R9WA 4JI5C 5IWAC 2VQEC 1ZB8A 5LMNC 2PT7G 1K0RA 1QWIA 1EGAA 2ONFA 1JOSA 4BSZA 4B3MC 1XMQC 1N32C 4X64C 1I94C 4JI2C 2OPLB 4AQYC 2UXDC 4DUYC 1L2FA 1N2FA 4DV1C 1N36C 4JI6C 4DV0C 3EERA 4DR4C 3J81D 2CXCA 2QL8A 1MKYA 1VLAA 4B3SC 4NXNC 3AF5A 4DR3C 4X62C 5A2QD 2VQFC 4JI8C 4DCVA 2UXCC 1XMOC 4LF8C 4XX2A 4NXMC 3GKUA 4JV5C 1FJGC 4DUZC 1KKGA 2E7GA 4DV5C 3OTOC 3R9XA 1HNWC 3J80D 2UU9C 2ATWA 4DV2C 4DV6C 1J5EC 4LF5C 1WH9A 2KZFA 1NYEA 4LFCC 4X65C 2CY1A 2ASBA 1HNZC 4DCSA 3T1HC 1USPA 4DR1C 1WF3A 4KHPC 1IBLC 1LQLA 4MH4A 4DR2C 4JI3C 2HHHC 2UXBC 2F4VC 2EGTA 1XNQC 2E8FA 4B3TC 2D7VA 2HJGA
chains in the Genus database with same CATH superfamily
4OX9C 4RVNA 3TQIA 2DPLA 1M6XA 4D57A 4D4GA 3LNOA 3IMLA 4DCTA 2YCBA 3SO4A 4X66C 4JI1C 1RG9A 2KDNA 4MTNA 1ZB9A 4IR7A 5IT9D 4GKKC 5BSTA 1M6XC 4B3RC 2JMPA 4GXQA 4GKJC 3JAMD 5IFIA 2P20A 1O90A 1N33C 3IEVA 4TPSB 5K8FA 3J7AD 1O92A 4JI0C 4JYAC 5BURA 1XRCA 4OXIA 1IBKC 2OPLA 3IPLA 2ZZNA 4LF9C 5BR8C 2P2MA 2UUCC 2WD9A 2E8CA 2VQEC 5JRHA 4PUHA 1QWIA 1K0RA 1JOSA 1N32C 4D56A 5CZVA 1NY8A 1I94C 4R0MA 4G37A 4DUYC 1MXAA 1ULTA 1L2FA 4JI6C 3DHVA 4HPVA 2V7BA 2CXCA 4FUTA 3J81D 2QL8A 1MKYA 1T5HX 3AF5A 4DR3C 2OBVA 4X62C 4L2ZA 3TUFA 4ODJA 1XMOC 4LF8C 3PBKA 3GKUA 3CQ1A 3RG2A 3OTOC 1HNWC 3GR1A 3UOWA 2NCLA 4LF5C 1P4EA 2KZFA 4FTFA 1NYEA 1TH5A 1HNZC 3FCCA 3E7XA 1YJ7A 4RMNA 1P4EC 4EATA 2UXBC 4PUGA 1UWDA 2F4VC 1XNQC 4B3TC 1T5DX 5T8SA 2MMAB 3L95X 3FM7A 1AMUA 4PZPA 3TR3A 5BSMA 4LF7C 2D1SA 4KTTA 5AE3A 3E7WA 4I9FA 1FLOA 3N2QA 3CW9A 5KYVA 4BC9A 4DCUA 4LF6C 1UKKA 4DV7C 2ZM6C 4DR5C 1BA3A 5BSWA 3NPDA 2Y27A 5A19A 2P2BA 2XR1A 5CZXA 4RLFA 4YHHC 3T1YC 4DV4C 3L8CA 3I07A 5A1IA 3R9WA 3I08A 5LMNC 1ZB8A 3RV2A 1XDXA 1EGAA 2ONFA 4ZLPA 3K6RA 4RM3A 3NYQA 5KEIA 1XMQC 3CW8X 1GPMA 4BCAA 2MCQA 4DG9A 1PG4A 4G36A 1VLAA 2QVYX 4NXNC 5T8TA 1V26A 4L7IA 5A2QD 4JI8C 3UEBA 2WP0C 4XX2A 4NXMC 3VNSA 5BSUA 5BUQA 4ISBA 5K85A 1FJGC 4U5YD 3KXWA 2D28C 3R9XA 3A4IA 3CQ2A 4DG8A 2ATWA 4GXRA 3NI2A 1J5EC 3UX3A 4BBYA 1RY2A 2VZEA 4DCSA 3T1HC 4KHPC 3ETCA 2HHHC 2D1QA 1PU1A 4NDNA 2M5HA 2PG1E 1MXCA 5H9UA 2AYAA 3TDEA 3VNQA 4PROC 2D27A 4PHTA 5LCIA 3CJEA 4K0KC 2P2FA 4NOZA 4WS9A 2UUAC 2PN2A 3PROC 4JI4C 1ML8A 1YGTA 1HNXC 2MM9A 1XRAA 2E0GA 2P2QA 2E8EA 5BSVA 4PUIA 4LE5A 1MDFA 1MD9A 4RVOA 1HR0C 2E5LC 5LMUC 4JI7C 2Y4NA 3AF6A 1XRBA 4ZJZA 4FUQA 3NYRA 2PT7G 4I9GA 2P02A 4GS5A 4BSZA 2VSQA 5A1GA 1MXBA 4X64C 3B7WA 4JI2C 2UXDC 2P2JA 2BH1X 4DV1C 3CQ3A 1N36C 4DV0C 3EERA 4DR4C 4D4IA 3DLPX 2VQFC 4DCVA 1IB8A 3O2EA 1KKGA 4L4QA 4DV5C 2PROA 3J80D 4KTVA 4DV2C 4DV6C 5E7QA 1WH9A 4RM2A 5AE1A 3UZ0A 5BUSA 1VEHA 4X65C 4G1IA 2D1TA 4IZ6A 5ADZA 1USPA 4DR1C 3DAYA 2M5OA 3G7SA 1LQLA 1O9TA 2E8FA 1P7LA 3LGXA 2HJGA 3AY0A 3H2TA 4DR7C 1PA4A 1XNRC 2DYJA 1V25A 5AE2A 2Y4OA 1XS3A 1PG3A 2UUBC 1IBMC 4BC7A 1N34C 1MDBA 5GTDA 4LF4C 4LFAC 4LFBC 3A9VA 3VNRA 3R44A 3ETOA 5FLXD 4OYCA 1XHJA 2BJOA 3LNVA 2JNVA 2QVZX 4YY3C 1USPB 1HH2P 4K0BA 1FUGA 2OO4A 3PESA 4DR6C 4DV3C 3EQ6A 3IEUA 2Z51A 1QM4A 3GR0A 3LUSA 2QVXX 5DV9A 4JI5C 5IWAC 2D1RA 2ZZMA 3GPCA 3UX2A 2CU6A 4B3MC 5KYTA 1WCJA 2OPLB 2YX1A 4AQYC 3N54B 1N2FA 2YWCA 4B3SC 2KZ0A 3FCEA 2UXCC 1V60A 3A26A 2YWBA 4JV5C 4DUZC 2E7GA 3S82A 2UU9C 3A25A 2DHMA 2ZTBA 4LFCC 2CY1A 2QW0X 1LCIA 2ASBA 5BSRA 1O93A 4WV3A 4R1LA 3A9UA 3LAXA 1WF3A 3C5EA 1IBLC 4MH4A 4JM1A 4RLQA 4DR2C 4JI3C 2EGTA 4R1MA 2D7VA
chains in the Genus database with same CATH topology
4OX9C 4RVNA 3TQIA 2DPLA 4D57A 4D4GA 3IMLA 4DCTA 2YCBA 3SO4A 4X66C 4JI1C 1RG9A 4MTNA 5IT9D 1ZB9A 4IR7A 4GKKC 5BSTA 4B3RC 2JMPA 4GXQA 4GKJC 3JAMD 5IFIA 2P20A 1O90A 1N33C 3IEVA 4TPSB 5K8FA 3J7AD 1O92A 4JI0C 4JYAC 5BURA 1XRCA 4OXIA 1IBKC 2OPLA 3IPLA 4LF9C 5BR8C 2P2MA 2UUCC 2WD9A 2E8CA 2VQEC 5JRHA 1QWIA 1K0RA 1JOSA 1N32C 4D56A 5CZVA 1I94C 4R0MA 4G37A 4DUYC 1MXAA 1ULTA 1L2FA 4JI6C 3DHVA 4HPVA 2V7BA 2CXCA 4FUTA 3J81D 2QL8A 1MKYA 1T5HX 3AF5A 4DR3C 2OBVA 4X62C 4L2ZA 3TUFA 4ODJA 1XMOC 4LF8C 3PBKA 3GKUA 3RG2A 3OTOC 1HNWC 3GR1A 3UOWA 4LF5C 2KZFA 4FTFA 1NYEA 1HNZC 3FCCA 3E7XA 1YJ7A 4RMNA 4EATA 2UXBC 2F4VC 1XNQC 4B3TC 1T5DX 5T8SA 3L95X 1AMUA 4PZPA 5BSMA 4LF7C 2D1SA 4KTTA 5AE3A 3E7WA 4I9FA 3N2QA 3CW9A 5KYVA 4BC9A 4DCUA 4LF6C 1UKKA 4DV7C 2ZM6C 4DR5C 1BA3A 5BSWA 3NPDA 2Y27A 5A19A 2P2BA 2XR1A 5CZXA 4RLFA 4YHHC 3T1YC 4DV4C 3L8CA 3I07A 5A1IA 3R9WA 3I08A 5LMNC 1ZB8A 3RV2A 1EGAA 2ONFA 4ZLPA 4RM3A 3NYQA 5KEIA 1XMQC 3CW8X 1GPMA 4BCAA 4DG9A 1PG4A 4G36A 1VLAA 2QVYX 4NXNC 5T8TA 1V26A 4L7IA 5A2QD 4JI8C 2WP0C 4XX2A 4NXMC 3VNSA 5BSUA 5BUQA 4ISBA 5K85A 1FJGC 4U5YD 3KXWA 2D28C 3R9XA 3A4IA 4DG8A 2ATWA 4GXRA 3NI2A 1J5EC 4BBYA 1RY2A 2VZEA 4DCSA 3T1HC 4KHPC 3ETCA 2HHHC 2D1QA 4NDNA 1MXCA 5H9UA 2AYAA 3TDEA 3VNQA 4PROC 2D27A 4PHTA 3CJEA 4K0KC 2P2FA 4NOZA 4WS9A 2UUAC 2PN2A 3PROC 4JI4C 1ML8A 1HNXC 1XRAA 2E0GA 2P2QA 2E8EA 5BSVA 4LE5A 1MDFA 1MD9A 4RVOA 1HR0C 2E5LC 5LMUC 4JI7C 2Y4NA 3AF6A 1XRBA 4ZJZA 4FUQA 3NYRA 2PT7G 4I9GA 2P02A 4GS5A 4BSZA 2VSQA 5A1GA 1MXBA 4X64C 3B7WA 4JI2C 2UXDC 2P2JA 2BH1X 4DV1C 1N36C 4DV0C 3EERA 4DR4C 4D4IA 3DLPX 2VQFC 4DCVA 1KKGA 4L4QA 4DV5C 2PROA 3J80D 4KTVA 4DV2C 4DV6C 5E7QA 1WH9A 4RM2A 5AE1A 3UZ0A 5BUSA 4X65C 4G1IA 2D1TA 4IZ6A 5ADZA 1USPA 4DR1C 3DAYA 3G7SA 1LQLA 1O9TA 2E8FA 1P7LA 3LGXA 2HJGA 3H2TA 4DR7C 1PA4A 1XNRC 2DYJA 1V25A 5AE2A 2Y4OA 1PG3A 2UUBC 1IBMC 4BC7A 1N34C 1MDBA 5GTDA 4LF4C 4LFAC 4LFBC 3A9VA 3VNRA 3R44A 3ETOA 5FLXD 4OYCA 2BJOA 3LNVA 2QVZX 4YY3C 1USPB 1HH2P 4K0BA 1FUGA 2OO4A 3PESA 4DR6C 4DV3C 3EQ6A 3IEUA 1QM4A 3GR0A 3LUSA 2QVXX 5DV9A 4JI5C 5IWAC 2D1RA 3GPCA 4B3MC 5KYTA 2OPLB 4AQYC 3N54B 1N2FA 2YWCA 4B3SC 3FCEA 2UXCC 2YWBA 4JV5C 4DUZC 2E7GA 3S82A 2UU9C 4LFCC 2CY1A 2QW0X 1LCIA 2ASBA 5BSRA 1O93A 4WV3A 4R1LA 3A9UA 3LAXA 1WF3A 3C5EA 1IBLC 4MH4A 4JM1A 4RLQA 4DR2C 4JI3C 2EGTA 4R1MA 2D7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 C;  4DR7 C;  1PA4 A;  1XNR C;  2DYJ A;  4LF7 C;  3CJE A;  4K0K C;  4NOZ A;  2UUA C;  4DCT A;  2PN2 A;  2YCB A;  2UUB C;  4X66 C;  4JI1 C;  4MTN A;  5IT9 D;  1ZB9 A;  4JI4 C;  1N34 C;  1IBM C;  1ML8 A;  4GKK C;  4B3R C;  2JMP A;  4GKJ C;  3JAM D;  4LF4 C;  1HNX C;  4LFA C;  4DCU A;  4LFB C;  4LF6 C;  1UKK A;  4DV7 C;  2ZM6 C;  2E8E A;  4DR5 C;  1N33 C;  5FLX D;  2BJO A;  4YY3 C;  3IEV A;  1USP B;  1HR0 C;  1HH2 P;  3J7A D;  2E5L C;  2XR1 A;  5LMU C;  4JI7 C;  4JI0 C;  4JYA C;  4YHH C;  3T1Y C;  3AF6 A;  4DV4 C;  4DR6 C;  4DV3 C;  1IBK C;  3IEU A;  2OPL A;  3I07 A;  3LUS A;  4LF9 C;  5BR8 C;  2UUC C;  2E8C A;  3R9W A;  4JI5 C;  5IWA C;  2VQE C;  1ZB8 A;  5LMN C;  2PT7 G;  1K0R A;  1QWI A;  1EGA A;  2ONF A;  1JOS A;  4BSZ A;  4B3M C;  1XMQ C;  1N32 C;  4X64 C;  1I94 C;  4JI2 C;  2OPL B;  4AQY C;  2UXD C;  4DUY C;  1L2F A;  1N2F A;  4DV1 C;  1N36 C;  4JI6 C;  4DV0 C;  3EER A;  4DR4 C;  3J81 D;  2CXC A;  2QL8 A;  1MKY A;  1VLA A;  4B3S C;  4NXN C;  3AF5 A;  4DR3 C;  4X62 C;  5A2Q D;  2VQF C;  4JI8 C;  4DCV A;  2UXC C;  1XMO C;  4LF8 C;  4XX2 A;  4NXM C;  3GKU A;  4JV5 C;  1FJG C;  4DUZ C;  1KKG A;  2E7G A;  4DV5 C;  3OTO C;  3R9X A;  1HNW C;  3J80 D;  2UU9 C;  2ATW A;  4DV2 C;  4DV6 C;  1J5E C;  4LF5 C;  1WH9 A;  2KZF A;  1NYE A;  4LFC C;  4X65 C;  2CY1 A;  2ASB A;  1HNZ C;  4DCS A;  3T1H C;  1USP A;  4DR1 C;  1WF3 A;  4KHP C;  1IBL C;  1LQL A;  4MH4 A;  4DR2 C;  4JI3 C;  2HHH C;  2UXB C;  2F4V C;  2EGT A;  1XNQ C;  2E8F A;  4B3T C;  2D7V A;  2HJG A; 
#chains in the Genus database with same CATH topology
 4OX9 C;  4RVN A;  3TQI A;  2DPL A;  1M6X A;  4D57 A;  4D4G A;  3LNO A;  3IML A;  4DCT A;  2YCB A;  3SO4 A;  4X66 C;  4JI1 C;  1RG9 A;  2KDN A;  4MTN A;  1ZB9 A;  4IR7 A;  5IT9 D;  4GKK C;  5BST A;  1M6X C;  4B3R C;  2JMP A;  4GXQ A;  4GKJ C;  3JAM D;  5IFI A;  2P20 A;  1O90 A;  1N33 C;  3IEV A;  4TPS B;  5K8F A;  3J7A D;  1O92 A;  4JI0 C;  4JYA C;  5BUR A;  1XRC A;  4OXI A;  1IBK C;  2OPL A;  3IPL A;  2ZZN A;  4LF9 C;  5BR8 C;  2P2M A;  2UUC C;  2WD9 A;  2E8C A;  2VQE C;  5JRH A;  4PUH A;  1QWI A;  1K0R A;  1JOS A;  1N32 C;  4D56 A;  5CZV A;  1NY8 A;  1I94 C;  4R0M A;  4G37 A;  4DUY C;  1MXA A;  1ULT A;  1L2F A;  4JI6 C;  3DHV A;  4HPV A;  2V7B A;  2CXC A;  4FUT A;  3J81 D;  2QL8 A;  1MKY A;  1T5H X;  3AF5 A;  4DR3 C;  2OBV A;  4X62 C;  4L2Z A;  3TUF A;  4ODJ A;  1XMO C;  4LF8 C;  3PBK A;  3GKU A;  3CQ1 A;  3RG2 A;  3OTO C;  1HNW C;  3GR1 A;  3UOW A;  2NCL A;  4LF5 C;  1P4E A;  2KZF A;  4FTF A;  1NYE A;  1TH5 A;  1HNZ C;  3FCC A;  3E7X A;  1YJ7 A;  4RMN A;  1P4E C;  4EAT A;  2UXB C;  4PUG A;  1UWD A;  2F4V C;  1XNQ C;  4B3T C;  1T5D X;  5T8S A;  2MMA B;  3L95 X;  3FM7 A;  1AMU A;  4PZP A;  3TR3 A;  5BSM A;  4LF7 C;  2D1S A;  4KTT A;  5AE3 A;  3E7W A;  4I9F A;  1FLO A;  3N2Q A;  3CW9 A;  5KYV A;  4BC9 A;  4DCU A;  4LF6 C;  1UKK A;  4DV7 C;  2ZM6 C;  4DR5 C;  1BA3 A;  5BSW A;  3NPD A;  2Y27 A;  5A19 A;  2P2B A;  2XR1 A;  5CZX A;  4RLF A;  4YHH C;  3T1Y C;  4DV4 C;  3L8C A;  3I07 A;  5A1I A;  3R9W A;  3I08 A;  5LMN C;  1ZB8 A;  3RV2 A;  1XDX A;  1EGA A;  2ONF A;  4ZLP A;  3K6R A;  4RM3 A;  3NYQ A;  5KEI A;  1XMQ C;  3CW8 X;  1GPM A;  4BCA A;  2MCQ A;  4DG9 A;  1PG4 A;  4G36 A;  1VLA A;  2QVY X;  4NXN C;  5T8T A;  1V26 A;  4L7I A;  5A2Q D;  4JI8 C;  3UEB A;  2WP0 C;  4XX2 A;  4NXM C;  3VNS A;  5BSU A;  5BUQ A;  4ISB A;  5K85 A;  1FJG C;  4U5Y D;  3KXW A;  2D28 C;  3R9X A;  3A4I A;  3CQ2 A;  4DG8 A;  2ATW A;  4GXR A;  3NI2 A;  1J5E C;  3UX3 A;  4BBY A;  1RY2 A;  2VZE A;  4DCS A;  3T1H C;  4KHP C;  3ETC A;  2HHH C;  2D1Q A;  1PU1 A;  4NDN A;  2M5H A;  2PG1 E;  1MXC A;  5H9U A;  2AYA A;  3TDE A;  3VNQ A;  4PRO C;  2D27 A;  4PHT A;  5LCI A;  3CJE A;  4K0K C;  2P2F A;  4NOZ A;  4WS9 A;  2UUA C;  2PN2 A;  3PRO C;  4JI4 C;  1ML8 A;  1YGT A;  1HNX C;  2MM9 A;  1XRA A;  2E0G A;  2P2Q A;  2E8E A;  5BSV A;  4PUI A;  4LE5 A;  1MDF A;  1MD9 A;  4RVO A;  1HR0 C;  2E5L C;  5LMU C;  4JI7 C;  2Y4N A;  3AF6 A;  1XRB A;  4ZJZ A;  4FUQ A;  3NYR A;  2PT7 G;  4I9G A;  2P02 A;  4GS5 A;  4BSZ A;  2VSQ A;  5A1G A;  1MXB A;  4X64 C;  3B7W A;  4JI2 C;  2UXD C;  2P2J A;  2BH1 X;  4DV1 C;  3CQ3 A;  1N36 C;  4DV0 C;  3EER A;  4DR4 C;  4D4I A;  3DLP X;  2VQF C;  4DCV A;  1IB8 A;  3O2E A;  1KKG A;  4L4Q A;  4DV5 C;  2PRO A;  3J80 D;  4KTV A;  4DV2 C;  4DV6 C;  5E7Q A;  1WH9 A;  4RM2 A;  5AE1 A;  3UZ0 A;  5BUS A;  1VEH A;  4X65 C;  4G1I A;  2D1T A;  4IZ6 A;  5ADZ A;  1USP A;  4DR1 C;  3DAY A;  2M5O A;  3G7S A;  1LQL A;  1O9T A;  2E8F A;  1P7L A;  3LGX A;  2HJG A;  3AY0 A;  3H2T A;  4DR7 C;  1PA4 A;  1XNR C;  2DYJ A;  1V25 A;  5AE2 A;  2Y4O A;  1XS3 A;  1PG3 A;  2UUB C;  1IBM C;  4BC7 A;  1N34 C;  1MDB A;  5GTD A;  4LF4 C;  4LFA C;  4LFB C;  3A9V A;  3VNR A;  3R44 A;  3ETO A;  5FLX D;  4OYC A;  1XHJ A;  2BJO A;  3LNV A;  2JNV A;  2QVZ X;  4YY3 C;  1USP B;  1HH2 P;  4K0B A;  1FUG A;  2OO4 A;  3PES A;  4DR6 C;  4DV3 C;  3EQ6 A;  3IEU A;  2Z51 A;  1QM4 A;  3GR0 A;  3LUS A;  2QVX X;  5DV9 A;  4JI5 C;  5IWA C;  2D1R A;  2ZZM A;  3GPC A;  3UX2 A;  2CU6 A;  4B3M C;  5KYT A;  1WCJ A;  2OPL B;  2YX1 A;  4AQY C;  3N54 B;  1N2F A;  2YWC A;  4B3S C;  2KZ0 A;  3FCE A;  2UXC C;  1V60 A;  3A26 A;  2YWB A;  4JV5 C;  4DUZ C;  2E7G A;  3S82 A;  2UU9 C;  3A25 A;  2DHM A;  2ZTB A;  4LFC C;  2CY1 A;  2QW0 X;  1LCI A;  2ASB A;  5BSR A;  1O93 A;  4WV3 A;  4R1L A;  3A9U A;  3LAX A;  1WF3 A;  3C5E A;  1IBL C;  4MH4 A;  4JM1 A;  4RLQ A;  4DR2 C;  4JI3 C;  2EGT A;  4R1M A;  2D7V A; 
#chains in the Genus database with same CATH homology
 4OX9 C;  4RVN A;  3TQI A;  2DPL A;  4D57 A;  4D4G A;  3IML A;  4DCT A;  2YCB A;  3SO4 A;  4X66 C;  4JI1 C;  1RG9 A;  4MTN A;  5IT9 D;  1ZB9 A;  4IR7 A;  4GKK C;  5BST A;  4B3R C;  2JMP A;  4GXQ A;  4GKJ C;  3JAM D;  5IFI A;  2P20 A;  1O90 A;  1N33 C;  3IEV A;  4TPS B;  5K8F A;  3J7A D;  1O92 A;  4JI0 C;  4JYA C;  5BUR A;  1XRC A;  4OXI A;  1IBK C;  2OPL A;  3IPL A;  4LF9 C;  5BR8 C;  2P2M A;  2UUC C;  2WD9 A;  2E8C A;  2VQE C;  5JRH A;  1QWI A;  1K0R A;  1JOS A;  1N32 C;  4D56 A;  5CZV A;  1I94 C;  4R0M A;  4G37 A;  4DUY C;  1MXA A;  1ULT A;  1L2F A;  4JI6 C;  3DHV A;  4HPV A;  2V7B A;  2CXC A;  4FUT A;  3J81 D;  2QL8 A;  1MKY A;  1T5H X;  3AF5 A;  4DR3 C;  2OBV A;  4X62 C;  4L2Z A;  3TUF A;  4ODJ A;  1XMO C;  4LF8 C;  3PBK A;  3GKU A;  3RG2 A;  3OTO C;  1HNW C;  3GR1 A;  3UOW A;  4LF5 C;  2KZF A;  4FTF A;  1NYE A;  1HNZ C;  3FCC A;  3E7X A;  1YJ7 A;  4RMN A;  4EAT A;  2UXB C;  2F4V C;  1XNQ C;  4B3T C;  1T5D X;  5T8S A;  3L95 X;  1AMU A;  4PZP A;  5BSM A;  4LF7 C;  2D1S A;  4KTT A;  5AE3 A;  3E7W A;  4I9F A;  3N2Q A;  3CW9 A;  5KYV A;  4BC9 A;  4DCU A;  4LF6 C;  1UKK A;  4DV7 C;  2ZM6 C;  4DR5 C;  1BA3 A;  5BSW A;  3NPD A;  2Y27 A;  5A19 A;  2P2B A;  2XR1 A;  5CZX A;  4RLF A;  4YHH C;  3T1Y C;  4DV4 C;  3L8C A;  3I07 A;  5A1I A;  3R9W A;  3I08 A;  5LMN C;  1ZB8 A;  3RV2 A;  1EGA A;  2ONF A;  4ZLP A;  4RM3 A;  3NYQ A;  5KEI A;  1XMQ C;  3CW8 X;  1GPM A;  4BCA A;  4DG9 A;  1PG4 A;  4G36 A;  1VLA A;  2QVY X;  4NXN C;  5T8T A;  1V26 A;  4L7I A;  5A2Q D;  4JI8 C;  2WP0 C;  4XX2 A;  4NXM C;  3VNS A;  5BSU A;  5BUQ A;  4ISB A;  5K85 A;  1FJG C;  4U5Y D;  3KXW A;  2D28 C;  3R9X A;  3A4I A;  4DG8 A;  2ATW A;  4GXR A;  3NI2 A;  1J5E C;  4BBY A;  1RY2 A;  2VZE A;  4DCS A;  3T1H C;  4KHP C;  3ETC A;  2HHH C;  2D1Q A;  4NDN A;  1MXC A;  5H9U A;  2AYA A;  3TDE A;  3VNQ A;  4PRO C;  2D27 A;  4PHT A;  3CJE A;  4K0K C;  2P2F A;  4NOZ A;  4WS9 A;  2UUA C;  2PN2 A;  3PRO C;  4JI4 C;  1ML8 A;  1HNX C;  1XRA A;  2E0G A;  2P2Q A;  2E8E A;  5BSV A;  4LE5 A;  1MDF A;  1MD9 A;  4RVO A;  1HR0 C;  2E5L C;  5LMU C;  4JI7 C;  2Y4N A;  3AF6 A;  1XRB A;  4ZJZ A;  4FUQ A;  3NYR A;  2PT7 G;  4I9G A;  2P02 A;  4GS5 A;  4BSZ A;  2VSQ A;  5A1G A;  1MXB A;  4X64 C;  3B7W A;  4JI2 C;  2UXD C;  2P2J A;  2BH1 X;  4DV1 C;  1N36 C;  4DV0 C;  3EER A;  4DR4 C;  4D4I A;  3DLP X;  2VQF C;  4DCV A;  1KKG A;  4L4Q A;  4DV5 C;  2PRO A;  3J80 D;  4KTV A;  4DV2 C;  4DV6 C;  5E7Q A;  1WH9 A;  4RM2 A;  5AE1 A;  3UZ0 A;  5BUS A;  4X65 C;  4G1I A;  2D1T A;  4IZ6 A;  5ADZ A;  1USP A;  4DR1 C;  3DAY A;  3G7S A;  1LQL A;  1O9T A;  2E8F A;  1P7L A;  3LGX A;  2HJG A;  3H2T A;  4DR7 C;  1PA4 A;  1XNR C;  2DYJ A;  1V25 A;  5AE2 A;  2Y4O A;  1PG3 A;  2UUB C;  1IBM C;  4BC7 A;  1N34 C;  1MDB A;  5GTD A;  4LF4 C;  4LFA C;  4LFB C;  3A9V A;  3VNR A;  3R44 A;  3ETO A;  5FLX D;  4OYC A;  2BJO A;  3LNV A;  2QVZ X;  4YY3 C;  1USP B;  1HH2 P;  4K0B A;  1FUG A;  2OO4 A;  3PES A;  4DR6 C;  4DV3 C;  3EQ6 A;  3IEU A;  1QM4 A;  3GR0 A;  3LUS A;  2QVX X;  5DV9 A;  4JI5 C;  5IWA C;  2D1R A;  3GPC A;  4B3M C;  5KYT A;  2OPL B;  4AQY C;  3N54 B;  1N2F A;  2YWC A;  4B3S C;  3FCE A;  2UXC C;  2YWB A;  4JV5 C;  4DUZ C;  2E7G A;  3S82 A;  2UU9 C;  4LFC C;  2CY1 A;  2QW0 X;  1LCI A;  2ASB A;  5BSR A;  1O93 A;  4WV3 A;  4R1L A;  3A9U A;  3LAX A;  1WF3 A;  3C5E A;  1IBL C;  4MH4 A;  4JM1 A;  4RLQ A;  4DR2 C;  4JI3 C;  2EGT A;  4R1M A;  2D7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...