4B3RC

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3rC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3rC02
2UXBC 5A2QD 1J5EC 2E7GA 4DR2C 1KKGA 2QL8A 4JI3C 2E5LC 2BJOA 2HHHC 4DCVA 2UXCC 4GKJC 4LF6C 1HR0C 4DR5C 4JV5C 4YHHC 5FLXD 1QWIA 3GKUA 3IEVA 4X62C 5BR8C 2CY1A 2PN2A 3T1YC 1LQLA 4MH4A 4NOZA 4BSZA 1JOSA 2UXDC 3OTOC 1XNQC 2UU9C 4DV5C 2EGTA 5IWAC 1IBKC 4JI1C 2PT7G 4LFBC 1HH2P 4B3TC 3EERA 4JI5C 3J81D 4DR4C 4LF7C 1N32C 2HJGA 4LF8C 4DR3C 1K0RA 4JI4C 2ZM6C 4DR1C 4DUZC 4MTNA 2UUBC 1ZB8A 4JI6C 2KZFA 5LMUC 2ONFA 4NXNC 4X65C 3CJEA 4K0KC 2DYJA 4JI0C 4DUYC 1HNWC 3AF5A 2CXCA 1HNXC 4JI7C 4LFAC 4DV1C 1NYEA 4DR7C 4X66C 2VQFC 3J7AD 4LF5C 1XMQC 2E8FA 2VQEC 2XR1A 3J80D 5LMNC 2E8EA 4YY3C 4B3MC 2ASBA 1N34C 1FJGC 1EGAA 1UKKA 2OPLB 2OPLA 1VLAA 1I94C 4GKKC 1WF3A 2ATWA 1WH9A 4DV0C 4XX2A 1ZB9A 1IBLC 1N33C 3R9XA 3R9WA 3LUSA 1N36C 4LF4C 1IBMC 1XNRC 4DR6C 1PA4A 2UUCC 4DV3C 5IT9D 4JI2C 2D7VA 3AF6A 1MKYA 2E8CA 4LFCC 4DCUA 2UUAC 4B3RC 4KHPC 4DV6C 4X64C 1ML8A 4DV2C 3T1HC 1XMOC 4LF9C 4DCTA 1HNZC 1L2FA 3JAMD 4B3SC 1N2FA 2YCBA 4NXMC 4AQYC 2F4VC 4DV4C 3I07A 3IEUA 4JYAC 1USPA 1USPB 4JI8C 4DV7C 4OX9C 2JMPA 4DCSA
chains in the Genus database with same CATH superfamily
5A2QD 1O90A 3GPCA 3LAXA 2CU6A 5BSMA 3A9VA 5CZXA 4DCVA 2D1RA 2MMAB 4L7IA 4DR5C 4JV5C 5FLXD 4GS5A 1LCIA 5AE2A 1O92A 4BBYA 5BSRA 2DHMA 4FTFA 4MH4A 4OYCA 3LNVA 4D57A 2PG1E 2EGTA 3AY0A 2PT7G 3CW9A 2YWBA 4B3TC 4TPSB 2ZZMA 2VSQA 3G7SA 1AMUA 4DR3C 5BSWA 2ZM6C 1FLOA 4KTTA 4K0KC 2AYAA 2M5HA 2P2BA 4DR7C 4BC9A 4RMNA 3J7AD 2VQEC 3GR0A 5KYVA 5LMNC 2E8EA 2ASBA 5LCIA 3UX3A 4U5YD 2KZ0A 1TH5A 5A1IA 1V60A 3TR3A 1UWDA 4ISBA 1IBLC 1N33C 2D1QA 4ZLPA 3R9WA 3PROC 4BC7A 3LUSA 5T8TA 2Y4OA 1WCJA 2P2FA 1XNRC 2E0GA 4RM2A 5JRHA 4DV3C 4JI2C 1O93A 1VEHA 1XRCA 3T1HC 3JAMD 3PESA 2YX1A 3LNOA 4I9FA 5KYTA 1NY8A 3IEUA 4JYAC 2D1TA 3A25A 4RLFA 4K0BA 4PUIA 4DCSA 4DR2C 1KKGA 4JI3C 2E5LC 3FCCA 2QVZX 3N2QA 4GKJC 4LF6C 1HR0C 4DG9A 4YHHC 3IEVA 4G37A 2PN2A 3T1YC 4RVOA 4D56A 4NOZA 3OTOC 4DV5C 1PG3A 3DLPX 4RM3A 3UEBA 1P4EA 4LFBC 3EERA 1MXAA 2BH1X 4PZPA 5IFIA 5A19A 4LF7C 3CQ1A 4FUTA 1K0RA 4DR1C 2UUBC 3RV2A 2OBVA 3KXWA 2KZFA 5LMUC 4ODJA 4X65C 3CJEA 4JI0C 2P02A 3NYQA 4R0MA 4YY3C 4B3MC 2WP0C 1YJ7A 1FJGC 1O9TA 2OPLB 3UZ0A 1VLAA 3L8CA 4GKKC 3GR1A 4DV0C 4XX2A 1XRAA 5AE1A 2NCLA 2QVYX 3TUFA 4FUQA 1GPMA 3NPDA 2OO4A 4IZ6A 1PA4A 1XRBA 5IT9D 4L4QA 2E8CA 3PBKA 4DCUA 2QVXX 3O2EA 4DV2C 2P2JA 1ML8A 3VNQA 1XMOC 4LF9C 2M5OA 1QM4A 4HPVA 4DCTA 3UOWA 4G1IA 4WS9A 4B3SC 1N2FA 4NXMC 4AQYC 4PUHA 4PHTA 4DV4C 2F4VC 1T5DX 3B7WA 3I08A 5A1GA 3CQ3A 1V25A 2JMPA 2E7GA 3L95X 2BJOA 2UXCC 1YGTA 1QWIA 5KEIA 2ZZNA 4X62C 5BR8C 4PUGA 3E7XA 1P7LA 1LQLA 3ETOA 1JOSA 2MCQA 2UXDC 3CQ2A 5IWAC 1IBKC 4JI1C 5T8SA 4D4IA 4JI5C 3J81D 4DR4C 3FM7A 4BCAA 1N32C 4R1MA 4ZJZA 1XS3A 4DUZC 4MTNA 4PROC 1ZB8A 3VNRA 4JI6C 2ONFA 3VNSA 4G36A 4NXNC 1PU1A 2DYJA 3A26A 4JI7C 1NYEA 3K6RA 4X66C 4NDNA 1XMQC 2E8FA 2XR1A 2PROA 4RLQA 3EQ6A 4RVNA 5K8FA 2JNVA 1EGAA 1RG9A 2WD9A 2ATWA 1BA3A 1WH9A 4JM1A 4OXIA 2P2MA 1MDBA 1ZB9A 1XHJA 3R9XA 3S82A 2MM9A 4LE5A 5ADZA 1IBMC 4GXQA 3SO4A 5BUQA 2UUCC 4D4GA 2D7VA 3R44A 4LFCC 1XDXA 4DG8A 1M6XC 5K85A 5BSVA 1HNZC 3IPLA 5BUSA 4KTVA 2ZTBA 5GTDA 4DV7C 2KDNA 2VQFC 2UXBC 1J5EC 1PG4A 1V26A 2QL8A 2HHHC 2QW0X 3GKUA 2D27A 3UX2A 2CY1A 4L2ZA 5BURA 4I9GA 4BSZA 1XNQC 2UU9C 5H9UA 3CW8X 1HH2P 1MDFA 5BSUA 3DHVA 2D1SA 2HJGA 4LF8C 3LGXA 5DV9A 4JI4C 5CZVA 2P20A 4DUYC 1HNWC 3AF5A 2CXCA 4R1LA 1P4EC 1HNXC 4LFAC 3E7WA 4DV1C 1M6XA 2D28C 4LF5C 3TQIA 1MD9A 1T5HX 2Y27A 3J80D 3IMLA 3C5EA 4WV3A 1FUGA 1N34C 1MXCA 1UKKA 3DAYA 2OPLA 2Y4NA 1I94C 3H2TA 1WF3A 3NYRA 4IR7A 2DPLA 3NI2A 1N36C 5AE3A 2P2QA 4LF4C 1RY2A 2YWCA 1IB8A 4DR6C 2V7BA 3FCEA 1MKYA 3AF6A 2UUAC 3N54B 4B3RC 4KHPC 4DV6C 4X64C 4EATA 2VZEA 1L2FA 2YCBA 4GXRA 3RG2A 1ULTA 3ETCA 3TDEA 3I07A 5BSTA 1MXBA 2Z51A 1USPA 1USPB 3A9UA 4JI8C 5E7QA 4OX9C 3A4IA
chains in the Genus database with same CATH topology
5A2QD 1O90A 3GPCA 3LAXA 5BSMA 3A9VA 5CZXA 4DCVA 2D1RA 4L7IA 4DR5C 4JV5C 5FLXD 4GS5A 1LCIA 5AE2A 1O92A 4BBYA 5BSRA 4FTFA 4MH4A 4OYCA 3LNVA 4D57A 2EGTA 2PT7G 3CW9A 2YWBA 4B3TC 4TPSB 2VSQA 3G7SA 1AMUA 4DR3C 5BSWA 2ZM6C 4KTTA 4K0KC 2AYAA 2P2BA 4DR7C 4BC9A 4RMNA 3J7AD 2VQEC 3GR0A 5KYVA 5LMNC 2E8EA 2ASBA 4U5YD 5A1IA 4ISBA 1IBLC 1N33C 2D1QA 4ZLPA 3R9WA 3PROC 4BC7A 3LUSA 5T8TA 2Y4OA 2P2FA 1XNRC 2E0GA 4RM2A 5JRHA 4DV3C 4JI2C 1O93A 1XRCA 3T1HC 3JAMD 3PESA 4I9FA 5KYTA 3IEUA 4JYAC 2D1TA 4RLFA 4K0BA 4DCSA 4DR2C 1KKGA 4JI3C 2E5LC 3FCCA 2QVZX 3N2QA 4GKJC 4LF6C 1HR0C 4DG9A 4YHHC 3IEVA 4G37A 2PN2A 3T1YC 4RVOA 4D56A 4NOZA 3OTOC 4DV5C 1PG3A 3DLPX 4RM3A 4LFBC 3EERA 1MXAA 2BH1X 4PZPA 5IFIA 5A19A 4LF7C 4FUTA 1K0RA 4DR1C 2UUBC 3RV2A 2OBVA 3KXWA 2KZFA 5LMUC 4ODJA 4X65C 3CJEA 4JI0C 2P02A 3NYQA 4R0MA 4YY3C 4B3MC 2WP0C 1YJ7A 1FJGC 1O9TA 2OPLB 3UZ0A 1VLAA 3L8CA 4GKKC 3GR1A 4DV0C 4XX2A 1XRAA 5AE1A 2QVYX 3TUFA 4FUQA 1GPMA 3NPDA 2OO4A 4IZ6A 1PA4A 1XRBA 5IT9D 4L4QA 2E8CA 3PBKA 4DCUA 2QVXX 4LF9C 1XMOC 2P2JA 1ML8A 3VNQA 4DV2C 1QM4A 4HPVA 4DCTA 3UOWA 4G1IA 4WS9A 4B3SC 1N2FA 4NXMC 4AQYC 4PHTA 4DV4C 2F4VC 1T5DX 3B7WA 3I08A 5A1GA 1V25A 2JMPA 2E7GA 3L95X 2BJOA 2UXCC 1QWIA 5KEIA 4X62C 5BR8C 3E7XA 1P7LA 1LQLA 3ETOA 1JOSA 2UXDC 5IWAC 1IBKC 4JI1C 5T8SA 4D4IA 4JI5C 3J81D 4DR4C 4BCAA 1N32C 4R1MA 4ZJZA 4DUZC 4MTNA 4PROC 1ZB8A 3VNRA 4JI6C 2ONFA 3VNSA 4G36A 4NXNC 2DYJA 4JI7C 1NYEA 4X66C 4NDNA 1XMQC 2E8FA 2XR1A 2PROA 4RLQA 3EQ6A 4RVNA 5K8FA 1EGAA 1RG9A 2WD9A 2ATWA 1BA3A 1WH9A 4JM1A 2P2MA 4OXIA 1MDBA 1ZB9A 3R9XA 3S82A 4LE5A 5ADZA 1IBMC 4GXQA 3SO4A 5BUQA 2UUCC 4D4GA 2D7VA 3R44A 4LFCC 4DG8A 5K85A 5BSVA 1HNZC 3IPLA 5BUSA 4KTVA 5GTDA 4DV7C 2VQFC 2UXBC 1J5EC 1PG4A 1V26A 2QL8A 2HHHC 2QW0X 3GKUA 2D27A 2CY1A 4L2ZA 5BURA 4I9GA 4BSZA 1XNQC 2UU9C 5H9UA 3CW8X 1HH2P 1MDFA 5BSUA 3DHVA 2D1SA 2HJGA 4LF8C 3LGXA 5DV9A 4JI4C 5CZVA 2P20A 4DUYC 1HNWC 3AF5A 2CXCA 4R1LA 1HNXC 4LFAC 3E7WA 4DV1C 2D28C 4LF5C 3TQIA 1MD9A 1T5HX 2Y27A 3J80D 3IMLA 3C5EA 4WV3A 1FUGA 1N34C 1MXCA 1UKKA 3DAYA 2OPLA 2Y4NA 1I94C 3H2TA 1WF3A 3NYRA 4IR7A 2DPLA 3NI2A 1N36C 5AE3A 2P2QA 4LF4C 1RY2A 2YWCA 4DR6C 2V7BA 3FCEA 1MKYA 3AF6A 2UUAC 3N54B 4B3RC 4KHPC 4DV6C 4X64C 4EATA 2VZEA 1L2FA 2YCBA 4GXRA 3RG2A 1ULTA 3ETCA 3TDEA 3I07A 5BSTA 1MXBA 1USPA 1USPB 3A9UA 4JI8C 5E7QA 4OX9C 3A4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB C;  5A2Q D;  1J5E C;  2E7G A;  4DR2 C;  1KKG A;  2QL8 A;  4JI3 C;  2E5L C;  2BJO A;  2HHH C;  4DCV A;  2UXC C;  4GKJ C;  4LF6 C;  1HR0 C;  4DR5 C;  4JV5 C;  4YHH C;  5FLX D;  1QWI A;  3GKU A;  3IEV A;  4X62 C;  5BR8 C;  2CY1 A;  2PN2 A;  3T1Y C;  1LQL A;  4MH4 A;  4NOZ A;  4BSZ A;  1JOS A;  2UXD C;  3OTO C;  1XNQ C;  2UU9 C;  4DV5 C;  2EGT A;  5IWA C;  1IBK C;  4JI1 C;  2PT7 G;  4LFB C;  1HH2 P;  4B3T C;  3EER A;  4JI5 C;  3J81 D;  4DR4 C;  4LF7 C;  1N32 C;  2HJG A;  4LF8 C;  4DR3 C;  1K0R A;  4JI4 C;  2ZM6 C;  4DR1 C;  4DUZ C;  4MTN A;  2UUB C;  1ZB8 A;  4JI6 C;  2KZF A;  5LMU C;  2ONF A;  4NXN C;  4X65 C;  3CJE A;  4K0K C;  2DYJ A;  4JI0 C;  4DUY C;  1HNW C;  3AF5 A;  2CXC A;  1HNX C;  4JI7 C;  4LFA C;  4DV1 C;  1NYE A;  4DR7 C;  4X66 C;  2VQF C;  3J7A D;  4LF5 C;  1XMQ C;  2E8F A;  2VQE C;  2XR1 A;  3J80 D;  5LMN C;  2E8E A;  4YY3 C;  4B3M C;  2ASB A;  1N34 C;  1FJG C;  1EGA A;  1UKK A;  2OPL B;  2OPL A;  1VLA A;  1I94 C;  4GKK C;  1WF3 A;  2ATW A;  1WH9 A;  4DV0 C;  4XX2 A;  1ZB9 A;  1IBL C;  1N33 C;  3R9X A;  3R9W A;  3LUS A;  1N36 C;  4LF4 C;  1IBM C;  1XNR C;  4DR6 C;  1PA4 A;  2UUC C;  4DV3 C;  5IT9 D;  4JI2 C;  2D7V A;  3AF6 A;  1MKY A;  2E8C A;  4LFC C;  4DCU A;  2UUA C;  4B3R C;  4KHP C;  4DV6 C;  4X64 C;  1ML8 A;  4DV2 C;  3T1H C;  1XMO C;  4LF9 C;  4DCT A;  1HNZ C;  1L2F A;  3JAM D;  4B3S C;  1N2F A;  2YCB A;  4NXM C;  4AQY C;  2F4V C;  4DV4 C;  3I07 A;  3IEU A;  4JYA C;  1USP A;  1USP B;  4JI8 C;  4DV7 C;  4OX9 C;  2JMP A;  4DCS A; 
#chains in the Genus database with same CATH topology
 5A2Q D;  1O90 A;  3GPC A;  3LAX A;  2CU6 A;  5BSM A;  3A9V A;  5CZX A;  4DCV A;  2D1R A;  2MMA B;  4L7I A;  4DR5 C;  4JV5 C;  5FLX D;  4GS5 A;  1LCI A;  5AE2 A;  1O92 A;  4BBY A;  5BSR A;  2DHM A;  4FTF A;  4MH4 A;  4OYC A;  3LNV A;  4D57 A;  2PG1 E;  2EGT A;  3AY0 A;  2PT7 G;  3CW9 A;  2YWB A;  4B3T C;  4TPS B;  2ZZM A;  2VSQ A;  3G7S A;  1AMU A;  4DR3 C;  5BSW A;  2ZM6 C;  1FLO A;  4KTT A;  4K0K C;  2AYA A;  2M5H A;  2P2B A;  4DR7 C;  4BC9 A;  4RMN A;  3J7A D;  2VQE C;  3GR0 A;  5KYV A;  5LMN C;  2E8E A;  2ASB A;  5LCI A;  3UX3 A;  4U5Y D;  2KZ0 A;  1TH5 A;  5A1I A;  1V60 A;  3TR3 A;  1UWD A;  4ISB A;  1IBL C;  1N33 C;  2D1Q A;  4ZLP A;  3R9W A;  3PRO C;  4BC7 A;  3LUS A;  5T8T A;  2Y4O A;  1WCJ A;  2P2F A;  1XNR C;  2E0G A;  4RM2 A;  5JRH A;  4DV3 C;  4JI2 C;  1O93 A;  1VEH A;  1XRC A;  3T1H C;  3JAM D;  3PES A;  2YX1 A;  3LNO A;  4I9F A;  5KYT A;  1NY8 A;  3IEU A;  4JYA C;  2D1T A;  3A25 A;  4RLF A;  4K0B A;  4PUI A;  4DCS A;  4DR2 C;  1KKG A;  4JI3 C;  2E5L C;  3FCC A;  2QVZ X;  3N2Q A;  4GKJ C;  4LF6 C;  1HR0 C;  4DG9 A;  4YHH C;  3IEV A;  4G37 A;  2PN2 A;  3T1Y C;  4RVO A;  4D56 A;  4NOZ A;  3OTO C;  4DV5 C;  1PG3 A;  3DLP X;  4RM3 A;  3UEB A;  1P4E A;  4LFB C;  3EER A;  1MXA A;  2BH1 X;  4PZP A;  5IFI A;  5A19 A;  4LF7 C;  3CQ1 A;  4FUT A;  1K0R A;  4DR1 C;  2UUB C;  3RV2 A;  2OBV A;  3KXW A;  2KZF A;  5LMU C;  4ODJ A;  4X65 C;  3CJE A;  4JI0 C;  2P02 A;  3NYQ A;  4R0M A;  4YY3 C;  4B3M C;  2WP0 C;  1YJ7 A;  1FJG C;  1O9T A;  2OPL B;  3UZ0 A;  1VLA A;  3L8C A;  4GKK C;  3GR1 A;  4DV0 C;  4XX2 A;  1XRA A;  5AE1 A;  2NCL A;  2QVY X;  3TUF A;  4FUQ A;  1GPM A;  3NPD A;  2OO4 A;  4IZ6 A;  1PA4 A;  1XRB A;  5IT9 D;  4L4Q A;  2E8C A;  3PBK A;  4DCU A;  2QVX X;  3O2E A;  4DV2 C;  2P2J A;  1ML8 A;  3VNQ A;  1XMO C;  4LF9 C;  2M5O A;  1QM4 A;  4HPV A;  4DCT A;  3UOW A;  4G1I A;  4WS9 A;  4B3S C;  1N2F A;  4NXM C;  4AQY C;  4PUH A;  4PHT A;  4DV4 C;  2F4V C;  1T5D X;  3B7W A;  3I08 A;  5A1G A;  3CQ3 A;  1V25 A;  2JMP A;  2E7G A;  3L95 X;  2BJO A;  2UXC C;  1YGT A;  1QWI A;  5KEI A;  2ZZN A;  4X62 C;  5BR8 C;  4PUG A;  3E7X A;  1P7L A;  1LQL A;  3ETO A;  1JOS A;  2MCQ A;  2UXD C;  3CQ2 A;  5IWA C;  1IBK C;  4JI1 C;  5T8S A;  4D4I A;  4JI5 C;  3J81 D;  4DR4 C;  3FM7 A;  4BCA A;  1N32 C;  4R1M A;  4ZJZ A;  1XS3 A;  4DUZ C;  4MTN A;  4PRO C;  1ZB8 A;  3VNR A;  4JI6 C;  2ONF A;  3VNS A;  4G36 A;  4NXN C;  1PU1 A;  2DYJ A;  3A26 A;  4JI7 C;  1NYE A;  3K6R A;  4X66 C;  4NDN A;  1XMQ C;  2E8F A;  2XR1 A;  2PRO A;  4RLQ A;  3EQ6 A;  4RVN A;  5K8F A;  2JNV A;  1EGA A;  1RG9 A;  2WD9 A;  2ATW A;  1BA3 A;  1WH9 A;  4JM1 A;  4OXI A;  2P2M A;  1MDB A;  1ZB9 A;  1XHJ A;  3R9X A;  3S82 A;  2MM9 A;  4LE5 A;  5ADZ A;  1IBM C;  4GXQ A;  3SO4 A;  5BUQ A;  2UUC C;  4D4G A;  2D7V A;  3R44 A;  4LFC C;  1XDX A;  4DG8 A;  1M6X C;  5K85 A;  5BSV A;  1HNZ C;  3IPL A;  5BUS A;  4KTV A;  2ZTB A;  5GTD A;  4DV7 C;  2KDN A;  2VQF C;  2UXB C;  1J5E C;  1PG4 A;  1V26 A;  2QL8 A;  2HHH C;  2QW0 X;  3GKU A;  2D27 A;  3UX2 A;  2CY1 A;  4L2Z A;  5BUR A;  4I9G A;  4BSZ A;  1XNQ C;  2UU9 C;  5H9U A;  3CW8 X;  1HH2 P;  1MDF A;  5BSU A;  3DHV A;  2D1S A;  2HJG A;  4LF8 C;  3LGX A;  5DV9 A;  4JI4 C;  5CZV A;  2P20 A;  4DUY C;  1HNW C;  3AF5 A;  2CXC A;  4R1L A;  1P4E C;  1HNX C;  4LFA C;  3E7W A;  4DV1 C;  1M6X A;  2D28 C;  4LF5 C;  3TQI A;  1MD9 A;  1T5H X;  2Y27 A;  3J80 D;  3IML A;  3C5E A;  4WV3 A;  1FUG A;  1N34 C;  1MXC A;  1UKK A;  3DAY A;  2OPL A;  2Y4N A;  1I94 C;  3H2T A;  1WF3 A;  3NYR A;  4IR7 A;  2DPL A;  3NI2 A;  1N36 C;  5AE3 A;  2P2Q A;  4LF4 C;  1RY2 A;  2YWC A;  1IB8 A;  4DR6 C;  2V7B A;  3FCE A;  1MKY A;  3AF6 A;  2UUA C;  3N54 B;  4B3R C;  4KHP C;  4DV6 C;  4X64 C;  4EAT A;  2VZE A;  1L2F A;  2YCB A;  4GXR A;  3RG2 A;  1ULT A;  3ETC A;  3TDE A;  3I07 A;  5BST A;  1MXB A;  2Z51 A;  1USP A;  1USP B;  3A9U A;  4JI8 C;  5E7Q A;  4OX9 C;  3A4I A; 
#chains in the Genus database with same CATH homology
 5A2Q D;  1O90 A;  3GPC A;  3LAX A;  5BSM A;  3A9V A;  5CZX A;  4DCV A;  2D1R A;  4L7I A;  4DR5 C;  4JV5 C;  5FLX D;  4GS5 A;  1LCI A;  5AE2 A;  1O92 A;  4BBY A;  5BSR A;  4FTF A;  4MH4 A;  4OYC A;  3LNV A;  4D57 A;  2EGT A;  2PT7 G;  3CW9 A;  2YWB A;  4B3T C;  4TPS B;  2VSQ A;  3G7S A;  1AMU A;  4DR3 C;  5BSW A;  2ZM6 C;  4KTT A;  4K0K C;  2AYA A;  2P2B A;  4DR7 C;  4BC9 A;  4RMN A;  3J7A D;  2VQE C;  3GR0 A;  5KYV A;  5LMN C;  2E8E A;  2ASB A;  4U5Y D;  5A1I A;  4ISB A;  1IBL C;  1N33 C;  2D1Q A;  4ZLP A;  3R9W A;  3PRO C;  4BC7 A;  3LUS A;  5T8T A;  2Y4O A;  2P2F A;  1XNR C;  2E0G A;  4RM2 A;  5JRH A;  4DV3 C;  4JI2 C;  1O93 A;  1XRC A;  3T1H C;  3JAM D;  3PES A;  4I9F A;  5KYT A;  3IEU A;  4JYA C;  2D1T A;  4RLF A;  4K0B A;  4DCS A;  4DR2 C;  1KKG A;  4JI3 C;  2E5L C;  3FCC A;  2QVZ X;  3N2Q A;  4GKJ C;  4LF6 C;  1HR0 C;  4DG9 A;  4YHH C;  3IEV A;  4G37 A;  2PN2 A;  3T1Y C;  4RVO A;  4D56 A;  4NOZ A;  3OTO C;  4DV5 C;  1PG3 A;  3DLP X;  4RM3 A;  4LFB C;  3EER A;  1MXA A;  2BH1 X;  4PZP A;  5IFI A;  5A19 A;  4LF7 C;  4FUT A;  1K0R A;  4DR1 C;  2UUB C;  3RV2 A;  2OBV A;  3KXW A;  2KZF A;  5LMU C;  4ODJ A;  4X65 C;  3CJE A;  4JI0 C;  2P02 A;  3NYQ A;  4R0M A;  4YY3 C;  4B3M C;  2WP0 C;  1YJ7 A;  1FJG C;  1O9T A;  2OPL B;  3UZ0 A;  1VLA A;  3L8C A;  4GKK C;  3GR1 A;  4DV0 C;  4XX2 A;  1XRA A;  5AE1 A;  2QVY X;  3TUF A;  4FUQ A;  1GPM A;  3NPD A;  2OO4 A;  4IZ6 A;  1PA4 A;  1XRB A;  5IT9 D;  4L4Q A;  2E8C A;  3PBK A;  4DCU A;  2QVX X;  4LF9 C;  1XMO C;  2P2J A;  1ML8 A;  3VNQ A;  4DV2 C;  1QM4 A;  4HPV A;  4DCT A;  3UOW A;  4G1I A;  4WS9 A;  4B3S C;  1N2F A;  4NXM C;  4AQY C;  4PHT A;  4DV4 C;  2F4V C;  1T5D X;  3B7W A;  3I08 A;  5A1G A;  1V25 A;  2JMP A;  2E7G A;  3L95 X;  2BJO A;  2UXC C;  1QWI A;  5KEI A;  4X62 C;  5BR8 C;  3E7X A;  1P7L A;  1LQL A;  3ETO A;  1JOS A;  2UXD C;  5IWA C;  1IBK C;  4JI1 C;  5T8S A;  4D4I A;  4JI5 C;  3J81 D;  4DR4 C;  4BCA A;  1N32 C;  4R1M A;  4ZJZ A;  4DUZ C;  4MTN A;  4PRO C;  1ZB8 A;  3VNR A;  4JI6 C;  2ONF A;  3VNS A;  4G36 A;  4NXN C;  2DYJ A;  4JI7 C;  1NYE A;  4X66 C;  4NDN A;  1XMQ C;  2E8F A;  2XR1 A;  2PRO A;  4RLQ A;  3EQ6 A;  4RVN A;  5K8F A;  1EGA A;  1RG9 A;  2WD9 A;  2ATW A;  1BA3 A;  1WH9 A;  4JM1 A;  2P2M A;  4OXI A;  1MDB A;  1ZB9 A;  3R9X A;  3S82 A;  4LE5 A;  5ADZ A;  1IBM C;  4GXQ A;  3SO4 A;  5BUQ A;  2UUC C;  4D4G A;  2D7V A;  3R44 A;  4LFC C;  4DG8 A;  5K85 A;  5BSV A;  1HNZ C;  3IPL A;  5BUS A;  4KTV A;  5GTD A;  4DV7 C;  2VQF C;  2UXB C;  1J5E C;  1PG4 A;  1V26 A;  2QL8 A;  2HHH C;  2QW0 X;  3GKU A;  2D27 A;  2CY1 A;  4L2Z A;  5BUR A;  4I9G A;  4BSZ A;  1XNQ C;  2UU9 C;  5H9U A;  3CW8 X;  1HH2 P;  1MDF A;  5BSU A;  3DHV A;  2D1S A;  2HJG A;  4LF8 C;  3LGX A;  5DV9 A;  4JI4 C;  5CZV A;  2P20 A;  4DUY C;  1HNW C;  3AF5 A;  2CXC A;  4R1L A;  1HNX C;  4LFA C;  3E7W A;  4DV1 C;  2D28 C;  4LF5 C;  3TQI A;  1MD9 A;  1T5H X;  2Y27 A;  3J80 D;  3IML A;  3C5E A;  4WV3 A;  1FUG A;  1N34 C;  1MXC A;  1UKK A;  3DAY A;  2OPL A;  2Y4N A;  1I94 C;  3H2T A;  1WF3 A;  3NYR A;  4IR7 A;  2DPL A;  3NI2 A;  1N36 C;  5AE3 A;  2P2Q A;  4LF4 C;  1RY2 A;  2YWC A;  4DR6 C;  2V7B A;  3FCE A;  1MKY A;  3AF6 A;  2UUA C;  3N54 B;  4B3R C;  4KHP C;  4DV6 C;  4X64 C;  4EAT A;  2VZE A;  1L2F A;  2YCB A;  4GXR A;  3RG2 A;  1ULT A;  3ETC A;  3TDE A;  3I07 A;  5BST A;  1MXB A;  1USP A;  1USP B;  3A9U A;  4JI8 C;  5E7Q A;  4OX9 C;  3A4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...