4B3RC

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3rC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3rC02
2BJOA 4YY3C 2UXBC 1JOSA 1PA4A 4DUYC 1ML8A 3GKUA 4JI2C 2F4VC 2OPLA 4DV4C 1N33C 3R9WA 3R9XA 4JI4C 1N36C 5FLXD 1IBKC 2UXCC 1WH9A 4DR3C 1XMOC 1QWIA 2E7GA 4DUZC 4B3MC 2CXCA 4LF9C 1ZB9A 5A2QD 3OTOC 4DCSA 4JI7C 2HHHC 2UUAC 4LF4C 2YCBA 1N32C 2PN2A 4X64C 3J80D 4LFCC 4LFBC 4DR4C 1KKGA 4DCUA 1XNQC 1HNZC 2E8CA 4LF8C 2E8EA 2PT7G 4X65C 1IBLC 4OX9C 4B3RC 5IT9D 3AF6A 2E8FA 4JI3C 1HH2P 4YHHC 3JAMD 4DR1C 2UUBC 2UXDC 4JYAC 1HNWC 1J5EC 1N2FA 4DV5C 2EGTA 4DR7C 1FJGC 3J7AD 4JI8C 5BR8C 4DV7C 2HJGA 1N34C 4B3TC 4JI5C 2XR1A 4DR6C 4DCTA 4JI6C 1ZB8A 3LUSA 4DV3C 1USPB 1L2FA 2ATWA 4DV6C 4DR2C 4LF5C 1NYEA 1LQLA 3AF5A 4X66C 4X62C 1XMQC 2JMPA 1XNRC 1HNXC 2QL8A 2KZFA 3IEUA 3IEVA 4XX2A 1HR0C 1USPA 4JI1C 3J81D 1IBMC 1VLAA 2CY1A 5LMUC 1K0RA 4AQYC 1EGAA 4GKJC 2UUCC 3EERA 2VQFC 4DV0C 3T1HC 1UKKA 4MTNA 2D7VA 4LFAC 2ZM6C 4GKKC 1MKYA 4NXMC 1WF3A 3T1YC 4DV2C 4DR5C 2ASBA 4JV5C 4DCVA 4K0KC 4NOZA 2ONFA 2UU9C 4LF7C 3CJEA 5IWAC 4DV1C 1I94C 2OPLB 3I07A 2DYJA 2E5LC 4B3SC 4LF6C 4NXNC 4MH4A 5LMNC 2VQEC 4JI0C 4KHPC 4BSZA
chains in the Genus database with same CATH superfamily
2BJOA 5DV9A 2UXBC 3GKUA 3E7XA 2MCQA 2OPLA 5IFIA 2P2JA 4RVNA 3R9WA 3R9XA 2AYAA 2JNVA 3TQIA 2KZ0A 2OBVA 4DUZC 4EATA 1QM4A 1ZB9A 4JI7C 4DCSA 3IMLA 2UUAC 3A4IA 1RY2A 1FLOA 4X64C 3DLPX 3J80D 4LFCC 1KKGA 4DCUA 1HNZC 2E8CA 1N32C 2PT7G 1IBLC 2BH1X 3AF6A 2E8FA 4JI3C 1HH2P 4YHHC 2PROA 3AY0A 2UUBC 1HNWC 3LGXA 5BSTA 1J5EC 2PG1E 1FJGC 4FTFA 3L95X 3LAXA 1MDBA 4DV7C 2M5OA 2HJGA 5KEIA 4JI6C 2Z51A 4JM1A 3A9VA 1UWDA 3DAYA 1O9TA 3B7WA 5BUQA 5GTDA 4LF5C 1NYEA 4D4GA 5BSMA 3LNVA 3UZ0A 4KTTA 4GXQA 5KYTA 1HNXC 3VNRA 3IEVA 2P2FA 4NDNA 3J81D 4AQYC 3NYRA 1K0RA 4BC9A 2UUCC 4U5YD 1PG3A 3T1HC 3CQ1A 2WD9A 4L7IA 4LFAC 4DV2C 4IZ6A 3SO4A 2ASBA 4JV5C 4PZPA 4RM2A 4K0KC 2D1QA 1P4EC 3E7WA 4DV1C 2OPLB 3I07A 3TDEA 1LCIA 4GS5A 5LMNC 5A1GA 1M6XC 3GR0A 1JOSA 1XRAA 3K6RA 4LE5A 4PUGA 2DHMA 4RMNA 1IBKC 1WH9A 4FUQA 1XMOC 2QVYX 1P4EA 1P7LA 2E7GA 2CXCA 4WS9A 5A2QD 3UX3A 2HHHC 5K85A 4I9FA 4LF4C 2P20A 3VNQA 1M6XA 5BSUA 2KDNA 5A1IA 1XNQC 4R0MA 3PESA 4OX9C 2E8EA 3VNSA 5ADZA 2ZZMA 3A25A 1MDFA 4JYAC 4DR7C 5AE1A 1XRBA 3J7AD 2MMAB 3IPLA 1N34C 4B3TC 4JI5C 1RG9A 4DCTA 1ZB8A 2Y4OA 2ATWA 4ODJA 3TR3A 4DR2C 4X66C 3NYQA 4WV3A 2JMPA 2KZFA 2VZEA 4XX2A 1USPA 1O90A 3G7SA 4G1IA 2VSQA 5LMUC 3EERA 4G36A 1UKKA 2OO4A 4IR7A 2ZM6C 4GKKC 1MKYA 4NXMC 3R44A 4R1MA 4DR5C 2P2BA 5AE3A 5H9UA 4DCVA 2YWBA 2DYJA 4LF6C 4NXNC 4RM3A 4I9GA 4JI0C 4BSZA 5CZXA 4YY3C 2MM9A 1ML8A 3L8CA 4JI2C 1N33C 4DV4C 3PBKA 3CQ3A 4JI4C 5E7QA 1N36C 1V25A 2UXCC 2WP0C 4L4QA 4D56A 2CU6A 1QWIA 1XHJA 1GPMA 2YCBA 5CZVA 2Y27A 2QVZX 1ULTA 3FM7A 2D27A 2E0GA 2PN2A 4LFBC 4DR4C 5BURA 1PU1A 4R1LA 2M5HA 1N2FA 4DV5C 2D1RA 3GR1A 5BR8C 4JI8C 4RVOA 2P02A 4DV3C 4L2ZA 3N54B 4DG9A 1USPB 1O93A 4DV6C 1O92A 2D1SA 1V60A 3AF5A 1T5HX 1TH5A 4RLFA 3I08A 4RLQA 5BSRA 3C5EA 1WCJA 2QL8A 3IEUA 2ZTBA 1HR0C 1IBMC 2CY1A 4ISBA 1EGAA 4GKJC 2NCLA 1VEHA 2VQFC 4DV0C 2Y4NA 4MTNA 4BBYA 3O2EA 3ETCA 3T1YC 3GPCA 1MD9A 4NOZA 2ONFA 4ZJZA 3S82A 2UU9C 4LF7C 3CJEA 5IWAC 1I94C 4PUIA 1PG4A 3FCCA 1MXAA 4B3SC 4MH4A 3RV2A 2P2MA 3PROC 5BUSA 4KHPC 3CW8X 1FUGA 3FCEA 4G37A 1PA4A 4DUYC 3UOWA 2ZZNA 2F4VC 4D57A 4KTVA 4HPVA 1MXBA 3KXWA 3LNOA 5FLXD 4DR3C 2DPLA 4B3MC 4ZLPA 2P2QA 4LF9C 3OTOC 3ETOA 4TPSB 5BSWA 4DG8A 4LF8C 5A19A 4X65C 4B3RC 5IT9D 4PUHA 3JAMD 3H2TA 5T8TA 4DR1C 5BSVA 1XS3A 2YX1A 5JRHA 2UXDC 2EGTA 2QVXX 3NPDA 3EQ6A 3TUFA 4BCAA 1XRCA 2XR1A 4DR6C 1MXCA 3LUSA 3A9UA 2V7BA 3UX2A 5KYVA 1L2FA 4PHTA 1LQLA 1NY8A 3N2QA 1YJ7A 4X62C 5AE2A 1XMQC 1BA3A 1XNRC 3CQ2A 4OYCA 4JI1C 1VLAA 2D28C 1AMUA 4FUTA 5T8SA 4D4IA 4BC7A 4K0BA 2D7VA 3RG2A 1YGTA 4PROC 1WF3A 3CW9A 2YWCA 5K8FA 2QW0X 5LCIA 4GXRA 3NI2A 2D1TA 2E5LC 1XDXA 1T5DX 3DHVA 3UEBA 1IB8A 3A26A 1V26A 4OXIA 2VQEC
chains in the Genus database with same CATH topology
2BJOA 5DV9A 2UXBC 3GKUA 3E7XA 2OPLA 5IFIA 2P2JA 4RVNA 3R9WA 3R9XA 2AYAA 3TQIA 2OBVA 4DUZC 4EATA 1QM4A 1ZB9A 4JI7C 4DCSA 3IMLA 2UUAC 3A4IA 1RY2A 4X64C 3DLPX 3J80D 4LFCC 1KKGA 4DCUA 1HNZC 2E8CA 1N32C 2PT7G 1IBLC 2BH1X 3AF6A 2E8FA 4JI3C 1HH2P 4YHHC 2PROA 2UUBC 1HNWC 3LGXA 5BSTA 1J5EC 1FJGC 4FTFA 3L95X 3LAXA 1MDBA 4DV7C 2HJGA 5KEIA 4JI6C 4JM1A 3A9VA 3DAYA 1O9TA 3B7WA 5BUQA 5GTDA 4LF5C 1NYEA 4D4GA 5BSMA 3LNVA 3UZ0A 4KTTA 4GXQA 5KYTA 1HNXC 3VNRA 3IEVA 2P2FA 4NDNA 3J81D 4AQYC 3NYRA 1K0RA 4BC9A 2UUCC 4U5YD 1PG3A 3T1HC 2WD9A 4L7IA 4LFAC 4DV2C 4IZ6A 3SO4A 2ASBA 4JV5C 4PZPA 4RM2A 4K0KC 2D1QA 3E7WA 4DV1C 2OPLB 3I07A 3TDEA 1LCIA 4GS5A 5LMNC 5A1GA 3GR0A 1JOSA 1XRAA 4LE5A 4RMNA 1IBKC 1WH9A 4FUQA 1XMOC 2QVYX 1P7LA 2E7GA 2CXCA 4WS9A 5A2QD 2HHHC 5K85A 4I9FA 4LF4C 2P20A 3VNQA 5BSUA 5A1IA 1XNQC 4R0MA 3PESA 4OX9C 2E8EA 3VNSA 5ADZA 1MDFA 4JYAC 4DR7C 5AE1A 1XRBA 3J7AD 3IPLA 1N34C 4B3TC 4JI5C 1RG9A 4DCTA 1ZB8A 2Y4OA 2ATWA 4ODJA 4DR2C 4X66C 3NYQA 4WV3A 2JMPA 2KZFA 2VZEA 4XX2A 1USPA 1O90A 3G7SA 4G1IA 2VSQA 5LMUC 3EERA 4G36A 1UKKA 2OO4A 4IR7A 2ZM6C 4GKKC 1MKYA 4NXMC 3R44A 4R1MA 4DR5C 2P2BA 5AE3A 5H9UA 4DCVA 2YWBA 2DYJA 4LF6C 4NXNC 4RM3A 4I9GA 4JI0C 4BSZA 5CZXA 4YY3C 1ML8A 3L8CA 4JI2C 1N33C 4DV4C 3PBKA 4JI4C 5E7QA 1N36C 1V25A 2UXCC 2WP0C 4L4QA 4D56A 1QWIA 1GPMA 2YCBA 5CZVA 2Y27A 2QVZX 1ULTA 2D27A 2E0GA 2PN2A 4LFBC 4DR4C 5BURA 4R1LA 1N2FA 4DV5C 2D1RA 3GR1A 5BR8C 4JI8C 4RVOA 2P02A 4DV3C 4L2ZA 3N54B 4DG9A 1USPB 1O93A 4DV6C 1O92A 2D1SA 3AF5A 1T5HX 4RLFA 3I08A 4RLQA 5BSRA 3C5EA 2QL8A 3IEUA 1HR0C 1IBMC 2CY1A 4ISBA 1EGAA 4GKJC 2VQFC 4DV0C 2Y4NA 4MTNA 4BBYA 3ETCA 3T1YC 3GPCA 1MD9A 4NOZA 2ONFA 4ZJZA 3S82A 2UU9C 4LF7C 3CJEA 5IWAC 1I94C 1PG4A 3FCCA 1MXAA 4B3SC 4MH4A 3RV2A 2P2MA 3PROC 5BUSA 4KHPC 3CW8X 1FUGA 3FCEA 4G37A 1PA4A 4DUYC 3UOWA 2F4VC 4D57A 4KTVA 4HPVA 1MXBA 3KXWA 5FLXD 4DR3C 2DPLA 4B3MC 4ZLPA 2P2QA 4LF9C 3OTOC 3ETOA 4TPSB 5BSWA 4DG8A 4LF8C 5A19A 4X65C 4B3RC 5IT9D 3JAMD 3H2TA 5T8TA 4DR1C 5BSVA 2UXDC 5JRHA 2EGTA 2QVXX 3NPDA 3EQ6A 3TUFA 4BCAA 1XRCA 2XR1A 4DR6C 1MXCA 3LUSA 3A9UA 2V7BA 5KYVA 1L2FA 4PHTA 1LQLA 3N2QA 1YJ7A 4X62C 5AE2A 1XMQC 1BA3A 1XNRC 4OYCA 4JI1C 1VLAA 2D28C 1AMUA 4FUTA 5T8SA 4D4IA 4BC7A 4K0BA 2D7VA 3RG2A 4PROC 1WF3A 3CW9A 2YWCA 5K8FA 2QW0X 4GXRA 3NI2A 2D1TA 2E5LC 1T5DX 3DHVA 1V26A 4OXIA 2VQEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJO A;  4YY3 C;  2UXB C;  1JOS A;  1PA4 A;  4DUY C;  1ML8 A;  3GKU A;  4JI2 C;  2F4V C;  2OPL A;  4DV4 C;  1N33 C;  3R9W A;  3R9X A;  4JI4 C;  1N36 C;  5FLX D;  1IBK C;  2UXC C;  1WH9 A;  4DR3 C;  1XMO C;  1QWI A;  2E7G A;  4DUZ C;  4B3M C;  2CXC A;  4LF9 C;  1ZB9 A;  5A2Q D;  3OTO C;  4DCS A;  4JI7 C;  2HHH C;  2UUA C;  4LF4 C;  2YCB A;  1N32 C;  2PN2 A;  4X64 C;  3J80 D;  4LFC C;  4LFB C;  4DR4 C;  1KKG A;  4DCU A;  1XNQ C;  1HNZ C;  2E8C A;  4LF8 C;  2E8E A;  2PT7 G;  4X65 C;  1IBL C;  4OX9 C;  4B3R C;  5IT9 D;  3AF6 A;  2E8F A;  4JI3 C;  1HH2 P;  4YHH C;  3JAM D;  4DR1 C;  2UUB C;  2UXD C;  4JYA C;  1HNW C;  1J5E C;  1N2F A;  4DV5 C;  2EGT A;  4DR7 C;  1FJG C;  3J7A D;  4JI8 C;  5BR8 C;  4DV7 C;  2HJG A;  1N34 C;  4B3T C;  4JI5 C;  2XR1 A;  4DR6 C;  4DCT A;  4JI6 C;  1ZB8 A;  3LUS A;  4DV3 C;  1USP B;  1L2F A;  2ATW A;  4DV6 C;  4DR2 C;  4LF5 C;  1NYE A;  1LQL A;  3AF5 A;  4X66 C;  4X62 C;  1XMQ C;  2JMP A;  1XNR C;  1HNX C;  2QL8 A;  2KZF A;  3IEU A;  3IEV A;  4XX2 A;  1HR0 C;  1USP A;  4JI1 C;  3J81 D;  1IBM C;  1VLA A;  2CY1 A;  5LMU C;  1K0R A;  4AQY C;  1EGA A;  4GKJ C;  2UUC C;  3EER A;  2VQF C;  4DV0 C;  3T1H C;  1UKK A;  4MTN A;  2D7V A;  4LFA C;  2ZM6 C;  4GKK C;  1MKY A;  4NXM C;  1WF3 A;  3T1Y C;  4DV2 C;  4DR5 C;  2ASB A;  4JV5 C;  4DCV A;  4K0K C;  4NOZ A;  2ONF A;  2UU9 C;  4LF7 C;  3CJE A;  5IWA C;  4DV1 C;  1I94 C;  2OPL B;  3I07 A;  2DYJ A;  2E5L C;  4B3S C;  4LF6 C;  4NXN C;  4MH4 A;  5LMN C;  2VQE C;  4JI0 C;  4KHP C;  4BSZ A; 
#chains in the Genus database with same CATH topology
 2BJO A;  5DV9 A;  2UXB C;  3GKU A;  3E7X A;  2MCQ A;  2OPL A;  5IFI A;  2P2J A;  4RVN A;  3R9W A;  3R9X A;  2AYA A;  2JNV A;  3TQI A;  2KZ0 A;  2OBV A;  4DUZ C;  4EAT A;  1QM4 A;  1ZB9 A;  4JI7 C;  4DCS A;  3IML A;  2UUA C;  3A4I A;  1RY2 A;  1FLO A;  4X64 C;  3DLP X;  3J80 D;  4LFC C;  1KKG A;  4DCU A;  1HNZ C;  2E8C A;  1N32 C;  2PT7 G;  1IBL C;  2BH1 X;  3AF6 A;  2E8F A;  4JI3 C;  1HH2 P;  4YHH C;  2PRO A;  3AY0 A;  2UUB C;  1HNW C;  3LGX A;  5BST A;  1J5E C;  2PG1 E;  1FJG C;  4FTF A;  3L95 X;  3LAX A;  1MDB A;  4DV7 C;  2M5O A;  2HJG A;  5KEI A;  4JI6 C;  2Z51 A;  4JM1 A;  3A9V A;  1UWD A;  3DAY A;  1O9T A;  3B7W A;  5BUQ A;  5GTD A;  4LF5 C;  1NYE A;  4D4G A;  5BSM A;  3LNV A;  3UZ0 A;  4KTT A;  4GXQ A;  5KYT A;  1HNX C;  3VNR A;  3IEV A;  2P2F A;  4NDN A;  3J81 D;  4AQY C;  3NYR A;  1K0R A;  4BC9 A;  2UUC C;  4U5Y D;  1PG3 A;  3T1H C;  3CQ1 A;  2WD9 A;  4L7I A;  4LFA C;  4DV2 C;  4IZ6 A;  3SO4 A;  2ASB A;  4JV5 C;  4PZP A;  4RM2 A;  4K0K C;  2D1Q A;  1P4E C;  3E7W A;  4DV1 C;  2OPL B;  3I07 A;  3TDE A;  1LCI A;  4GS5 A;  5LMN C;  5A1G A;  1M6X C;  3GR0 A;  1JOS A;  1XRA A;  3K6R A;  4LE5 A;  4PUG A;  2DHM A;  4RMN A;  1IBK C;  1WH9 A;  4FUQ A;  1XMO C;  2QVY X;  1P4E A;  1P7L A;  2E7G A;  2CXC A;  4WS9 A;  5A2Q D;  3UX3 A;  2HHH C;  5K85 A;  4I9F A;  4LF4 C;  2P20 A;  3VNQ A;  1M6X A;  5BSU A;  2KDN A;  5A1I A;  1XNQ C;  4R0M A;  3PES A;  4OX9 C;  2E8E A;  3VNS A;  5ADZ A;  2ZZM A;  3A25 A;  1MDF A;  4JYA C;  4DR7 C;  5AE1 A;  1XRB A;  3J7A D;  2MMA B;  3IPL A;  1N34 C;  4B3T C;  4JI5 C;  1RG9 A;  4DCT A;  1ZB8 A;  2Y4O A;  2ATW A;  4ODJ A;  3TR3 A;  4DR2 C;  4X66 C;  3NYQ A;  4WV3 A;  2JMP A;  2KZF A;  2VZE A;  4XX2 A;  1USP A;  1O90 A;  3G7S A;  4G1I A;  2VSQ A;  5LMU C;  3EER A;  4G36 A;  1UKK A;  2OO4 A;  4IR7 A;  2ZM6 C;  4GKK C;  1MKY A;  4NXM C;  3R44 A;  4R1M A;  4DR5 C;  2P2B A;  5AE3 A;  5H9U A;  4DCV A;  2YWB A;  2DYJ A;  4LF6 C;  4NXN C;  4RM3 A;  4I9G A;  4JI0 C;  4BSZ A;  5CZX A;  4YY3 C;  2MM9 A;  1ML8 A;  3L8C A;  4JI2 C;  1N33 C;  4DV4 C;  3PBK A;  3CQ3 A;  4JI4 C;  5E7Q A;  1N36 C;  1V25 A;  2UXC C;  2WP0 C;  4L4Q A;  4D56 A;  2CU6 A;  1QWI A;  1XHJ A;  1GPM A;  2YCB A;  5CZV A;  2Y27 A;  2QVZ X;  1ULT A;  3FM7 A;  2D27 A;  2E0G A;  2PN2 A;  4LFB C;  4DR4 C;  5BUR A;  1PU1 A;  4R1L A;  2M5H A;  1N2F A;  4DV5 C;  2D1R A;  3GR1 A;  5BR8 C;  4JI8 C;  4RVO A;  2P02 A;  4DV3 C;  4L2Z A;  3N54 B;  4DG9 A;  1USP B;  1O93 A;  4DV6 C;  1O92 A;  2D1S A;  1V60 A;  3AF5 A;  1T5H X;  1TH5 A;  4RLF A;  3I08 A;  4RLQ A;  5BSR A;  3C5E A;  1WCJ A;  2QL8 A;  3IEU A;  2ZTB A;  1HR0 C;  1IBM C;  2CY1 A;  4ISB A;  1EGA A;  4GKJ C;  2NCL A;  1VEH A;  2VQF C;  4DV0 C;  2Y4N A;  4MTN A;  4BBY A;  3O2E A;  3ETC A;  3T1Y C;  3GPC A;  1MD9 A;  4NOZ A;  2ONF A;  4ZJZ A;  3S82 A;  2UU9 C;  4LF7 C;  3CJE A;  5IWA C;  1I94 C;  4PUI A;  1PG4 A;  3FCC A;  1MXA A;  4B3S C;  4MH4 A;  3RV2 A;  2P2M A;  3PRO C;  5BUS A;  4KHP C;  3CW8 X;  1FUG A;  3FCE A;  4G37 A;  1PA4 A;  4DUY C;  3UOW A;  2ZZN A;  2F4V C;  4D57 A;  4KTV A;  4HPV A;  1MXB A;  3KXW A;  3LNO A;  5FLX D;  4DR3 C;  2DPL A;  4B3M C;  4ZLP A;  2P2Q A;  4LF9 C;  3OTO C;  3ETO A;  4TPS B;  5BSW A;  4DG8 A;  4LF8 C;  5A19 A;  4X65 C;  4B3R C;  5IT9 D;  4PUH A;  3JAM D;  3H2T A;  5T8T A;  4DR1 C;  5BSV A;  1XS3 A;  2YX1 A;  5JRH A;  2UXD C;  2EGT A;  2QVX X;  3NPD A;  3EQ6 A;  3TUF A;  4BCA A;  1XRC A;  2XR1 A;  4DR6 C;  1MXC A;  3LUS A;  3A9U A;  2V7B A;  3UX2 A;  5KYV A;  1L2F A;  4PHT A;  1LQL A;  1NY8 A;  3N2Q A;  1YJ7 A;  4X62 C;  5AE2 A;  1XMQ C;  1BA3 A;  1XNR C;  3CQ2 A;  4OYC A;  4JI1 C;  1VLA A;  2D28 C;  1AMU A;  4FUT A;  5T8S A;  4D4I A;  4BC7 A;  4K0B A;  2D7V A;  3RG2 A;  1YGT A;  4PRO C;  1WF3 A;  3CW9 A;  2YWC A;  5K8F A;  2QW0 X;  5LCI A;  4GXR A;  3NI2 A;  2D1T A;  2E5L C;  1XDX A;  1T5D X;  3DHV A;  3UEB A;  1IB8 A;  3A26 A;  1V26 A;  4OXI A;  2VQE C; 
#chains in the Genus database with same CATH homology
 2BJO A;  5DV9 A;  2UXB C;  3GKU A;  3E7X A;  2OPL A;  5IFI A;  2P2J A;  4RVN A;  3R9W A;  3R9X A;  2AYA A;  3TQI A;  2OBV A;  4DUZ C;  4EAT A;  1QM4 A;  1ZB9 A;  4JI7 C;  4DCS A;  3IML A;  2UUA C;  3A4I A;  1RY2 A;  4X64 C;  3DLP X;  3J80 D;  4LFC C;  1KKG A;  4DCU A;  1HNZ C;  2E8C A;  1N32 C;  2PT7 G;  1IBL C;  2BH1 X;  3AF6 A;  2E8F A;  4JI3 C;  1HH2 P;  4YHH C;  2PRO A;  2UUB C;  1HNW C;  3LGX A;  5BST A;  1J5E C;  1FJG C;  4FTF A;  3L95 X;  3LAX A;  1MDB A;  4DV7 C;  2HJG A;  5KEI A;  4JI6 C;  4JM1 A;  3A9V A;  3DAY A;  1O9T A;  3B7W A;  5BUQ A;  5GTD A;  4LF5 C;  1NYE A;  4D4G A;  5BSM A;  3LNV A;  3UZ0 A;  4KTT A;  4GXQ A;  5KYT A;  1HNX C;  3VNR A;  3IEV A;  2P2F A;  4NDN A;  3J81 D;  4AQY C;  3NYR A;  1K0R A;  4BC9 A;  2UUC C;  4U5Y D;  1PG3 A;  3T1H C;  2WD9 A;  4L7I A;  4LFA C;  4DV2 C;  4IZ6 A;  3SO4 A;  2ASB A;  4JV5 C;  4PZP A;  4RM2 A;  4K0K C;  2D1Q A;  3E7W A;  4DV1 C;  2OPL B;  3I07 A;  3TDE A;  1LCI A;  4GS5 A;  5LMN C;  5A1G A;  3GR0 A;  1JOS A;  1XRA A;  4LE5 A;  4RMN A;  1IBK C;  1WH9 A;  4FUQ A;  1XMO C;  2QVY X;  1P7L A;  2E7G A;  2CXC A;  4WS9 A;  5A2Q D;  2HHH C;  5K85 A;  4I9F A;  4LF4 C;  2P20 A;  3VNQ A;  5BSU A;  5A1I A;  1XNQ C;  4R0M A;  3PES A;  4OX9 C;  2E8E A;  3VNS A;  5ADZ A;  1MDF A;  4JYA C;  4DR7 C;  5AE1 A;  1XRB A;  3J7A D;  3IPL A;  1N34 C;  4B3T C;  4JI5 C;  1RG9 A;  4DCT A;  1ZB8 A;  2Y4O A;  2ATW A;  4ODJ A;  4DR2 C;  4X66 C;  3NYQ A;  4WV3 A;  2JMP A;  2KZF A;  2VZE A;  4XX2 A;  1USP A;  1O90 A;  3G7S A;  4G1I A;  2VSQ A;  5LMU C;  3EER A;  4G36 A;  1UKK A;  2OO4 A;  4IR7 A;  2ZM6 C;  4GKK C;  1MKY A;  4NXM C;  3R44 A;  4R1M A;  4DR5 C;  2P2B A;  5AE3 A;  5H9U A;  4DCV A;  2YWB A;  2DYJ A;  4LF6 C;  4NXN C;  4RM3 A;  4I9G A;  4JI0 C;  4BSZ A;  5CZX A;  4YY3 C;  1ML8 A;  3L8C A;  4JI2 C;  1N33 C;  4DV4 C;  3PBK A;  4JI4 C;  5E7Q A;  1N36 C;  1V25 A;  2UXC C;  2WP0 C;  4L4Q A;  4D56 A;  1QWI A;  1GPM A;  2YCB A;  5CZV A;  2Y27 A;  2QVZ X;  1ULT A;  2D27 A;  2E0G A;  2PN2 A;  4LFB C;  4DR4 C;  5BUR A;  4R1L A;  1N2F A;  4DV5 C;  2D1R A;  3GR1 A;  5BR8 C;  4JI8 C;  4RVO A;  2P02 A;  4DV3 C;  4L2Z A;  3N54 B;  4DG9 A;  1USP B;  1O93 A;  4DV6 C;  1O92 A;  2D1S A;  3AF5 A;  1T5H X;  4RLF A;  3I08 A;  4RLQ A;  5BSR A;  3C5E A;  2QL8 A;  3IEU A;  1HR0 C;  1IBM C;  2CY1 A;  4ISB A;  1EGA A;  4GKJ C;  2VQF C;  4DV0 C;  2Y4N A;  4MTN A;  4BBY A;  3ETC A;  3T1Y C;  3GPC A;  1MD9 A;  4NOZ A;  2ONF A;  4ZJZ A;  3S82 A;  2UU9 C;  4LF7 C;  3CJE A;  5IWA C;  1I94 C;  1PG4 A;  3FCC A;  1MXA A;  4B3S C;  4MH4 A;  3RV2 A;  2P2M A;  3PRO C;  5BUS A;  4KHP C;  3CW8 X;  1FUG A;  3FCE A;  4G37 A;  1PA4 A;  4DUY C;  3UOW A;  2F4V C;  4D57 A;  4KTV A;  4HPV A;  1MXB A;  3KXW A;  5FLX D;  4DR3 C;  2DPL A;  4B3M C;  4ZLP A;  2P2Q A;  4LF9 C;  3OTO C;  3ETO A;  4TPS B;  5BSW A;  4DG8 A;  4LF8 C;  5A19 A;  4X65 C;  4B3R C;  5IT9 D;  3JAM D;  3H2T A;  5T8T A;  4DR1 C;  5BSV A;  2UXD C;  5JRH A;  2EGT A;  2QVX X;  3NPD A;  3EQ6 A;  3TUF A;  4BCA A;  1XRC A;  2XR1 A;  4DR6 C;  1MXC A;  3LUS A;  3A9U A;  2V7B A;  5KYV A;  1L2F A;  4PHT A;  1LQL A;  3N2Q A;  1YJ7 A;  4X62 C;  5AE2 A;  1XMQ C;  1BA3 A;  1XNR C;  4OYC A;  4JI1 C;  1VLA A;  2D28 C;  1AMU A;  4FUT A;  5T8S A;  4D4I A;  4BC7 A;  4K0B A;  2D7V A;  3RG2 A;  4PRO C;  1WF3 A;  3CW9 A;  2YWC A;  5K8F A;  2QW0 X;  4GXR A;  3NI2 A;  2D1T A;  2E5L C;  1T5D X;  3DHV A;  1V26 A;  4OXI A;  2VQE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...