4DR1C

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr1C02
1NYEA 1HH2P 2QL8A 1N32C 4X66C 1HNXC 5IT9D 4NXMC 1FJGC 4LF6C 2XR1A 3IEUA 4JI2C 1N33C 4JI5C 1XMQC 1KKGA 1QWIA 2KZFA 4X62C 1WF3A 4XX2A 5LMNC 4DV7C 1HR0C 2UUBC 1N36C 2ASBA 2UXCC 4LF7C 1PA4A 1I94C 4JI3C 4JI0C 1N2FA 1HNWC 4GKJC 4LF4C 3AF5A 4DR3C 1USPA 4JI8C 3I07A 2E8FA 4DR2C 2OPLB 1XNRC 2E5LC 5FLXD 1WH9A 4DV0C 1LQLA 2CY1A 4JI6C 4DV3C 4B3MC 4DR5C 4OX9C 1XNQC 4LFBC 4LF9C 2OPLA 3JAMD 2PN2A 4DUZC 5LMUC 1USPB 2ZM6C 4DUYC 4DCVA 1IBKC 4LFCC 2D7VA 1IBLC 4JYAC 2ATWA 2ONFA 3GKUA 4X65C 2VQEC 4DV1C 4DR1C 4JI7C 2UXDC 1L2FA 4DV6C 4JV5C 3J81D 2YCBA 4LFAC 1EGAA 2EGTA 4YY3C 2CXCA 1ML8A 1JOSA 5IWAC 3IEVA 4LF5C 4NOZA 3T1HC 1MKYA 3R9XA 1ZB8A 3CJEA 2E8EA 2HJGA 4NXNC 4DCTA 5BR8C 1UKKA 2BJOA 3J80D 4B3SC 4B3RC 4JI1C 1HNZC 4LF8C 3J7AD 2E8CA 3R9WA 4MH4A 1N34C 2HHHC 2E7GA 4DV2C 4DV5C 3T1YC 3AF6A 2VQFC 4KHPC 5A2QD 4MTNA 1XMOC 1IBMC 4AQYC 3LUSA 3EERA 1K0RA 3OTOC 4DCSA 4DR7C 2PT7G 2UUAC 4YHHC 4GKKC 1VLAA 4DV4C 2DYJA 2UU9C 2F4VC 2UUCC 4DCUA 2UXBC 1ZB9A 4BSZA 4X64C 4K0KC 4B3TC 1J5EC 4JI4C 4DR6C 2JMPA 4DR4C
chains in the Genus database with same CATH superfamily
1NYEA 1QM4A 1N32C 1HNXC 1FJGC 4JI2C 3IEUA 1NY8A 2KZFA 1WF3A 4XX2A 1XRCA 4R0MA 5KEIA 2ASBA 2UXCC 1MXBA 4ODJA 4BC7A 5E7QA 3R44A 3N54B 4JI8C 3ETOA 5T8SA 3CW9A 3B7WA 4DR2C 5AE1A 2V7BA 4L7IA 1XNRC 1BA3A 4DV0C 4JI6C 4B3MC 4G1IA 2D1TA 2PN2A 1USPB 3E7XA 3E7WA 2ZM6C 3G7SA 3AY0A 1IBLC 2ATWA 2ONFA 2D27A 2YWCA 3RG2A 2ZZNA 3ETCA 2YCBA 3TR3A 5IWAC 3L95X 3R9XA 5BURA 3GR0A 3A26A 3CJEA 5BSRA 2BJOA 3NPDA 2M5OA 2P2MA 4B3SC 5IFIA 3DAYA 2AYAA 1N34C 2HHHC 4BBYA 4BCAA 1O90A 2VQFC 4KHPC 3CQ2A 4PZPA 5K8FA 4AQYC 3NI2A 2MCQA 4I9FA 2P2JA 3DHVA 4DR7C 2PT7G 2UUAC 2QVXX 2YX1A 2MMAB 2PROA 2QVYX 2UXBC 2P2QA 1J5EC 2D28C 4DR6C 2QL8A 4X66C 1P4EC 3NYRA 2D1SA 2QW0X 3SO4A 5A1GA 4JI0C 1HNWC 2VSQA 1O93A 4IR7A 2ZZMA 2DPLA 5GTDA 4FUTA 4DG8A 2E8FA 2D1RA 1V26A 4GXRA 3N2QA 3L8CA 2CY1A 4DV3C 1YGTA 1XNQC 2OPLA 3JAMD 4GS5A 1YJ7A 2PG1E 4L4QA 3DLPX 4BC9A 3PESA 2D1QA 3LGXA 1O9TA 3GKUA 4JI7C 1L2FA 4HPVA 4JV5C 4PROC 3GR1A 1WCJA 2CXCA 4ZJZA 1ML8A 4JM1A 1V60A 1FLOA 2E8EA 4KTTA 4OYCA 2Y4OA 4JI1C 1VEHA 2E8CA 3R9WA 4MH4A 2E7GA 3EQ6A 4RLQA 3RV2A 3VNSA 1P4EA 5A2QD 4G37A 2P02A 4MTNA 4ISBA 3NYQA 4PUHA 1M6XC 5BUQA 3FCEA 3OTOC 4DCSA 4GKKC 4L2ZA 2P2BA 3S82A 3GPCA 1ULTA 4RM2A 2F4VC 2UUCC 1ZB9A 4X64C 4K0KC 4WV3A 2OO4A 2JMPA 3CW8X 4FTFA 3LNVA 1HH2P 2YWBA 4D57A 4U5YD 4PHTA 4LF6C 1N33C 5BSVA 1XMQC 2WD9A 3A9VA 4FUQA 2QVZX 4X62C 1HR0C 1N36C 1T5HX 1MXCA 4LF7C 1PA4A 3H2TA 3O2EA 4LF4C 4DR3C 4D4GA 2NCLA 1USPA 3KXWA 2CU6A 5BSUA 3TUFA 2MM9A 2OPLB 1MD9A 2E5LC 5FLXD 1IB8A 4PUGA 5LCIA 2Y4NA 3A9UA 5LMUC 1FUGA 4DUYC 4TPSB 2VZEA 4RMNA 2D7VA 1P7LA 4JYAC 3PBKA 4ZLPA 3LAXA 4DR1C 2Y27A 4DV6C 4RVOA 4KTVA 4LFAC 4GXQA 3IEVA 1M6XA 1RY2A 3UX2A 4NXNC 4DCTA 5BR8C 1PU1A 1UKKA 4PUIA 5BSTA 5H9UA 1O92A 4B3RC 5CZXA 3LNOA 1MXAA 1HNZC 3J7AD 1T5DX 3TDEA 4DV2C 3T1YC 3AF6A 3C5EA 1V25A 5JRHA 1IBMC 1RG9A 2P2FA 1AMUA 1K0RA 4RVNA 4YHHC 4DV4C 3I08A 1MDBA 2UU9C 4DCUA 5T8TA 5KYVA 4B3TC 2ZTBA 3K6RA 5ADZA 2OBVA 3TQIA 2BH1X 5IT9D 4NXMC 2XR1A 4RM3A 4JI5C 1KKGA 1QWIA 5CZVA 5LMNC 4DV7C 5A1IA 3UEBA 2DHMA 2UUBC 1I94C 4JI3C 5DV9A 4NDNA 1N2FA 4GKJC 4OXIA 4DG9A 3AF5A 3I07A 3CQ1A 5AE2A 1TH5A 3UOWA 1WH9A 2WP0C 3A25A 1LQLA 1XRBA 4DR5C 4OX9C 4LFBC 4LF9C 4DUZC 4WS9A 3UZ0A 1XRAA 1PG3A 4DCVA 5AE3A 1IBKC 4LFCC 3UX3A 2JNVA 3FM7A 4X65C 2VQEC 4DV1C 2UXDC 1XS3A 3J81D 2P20A 1EGAA 2EGTA 4YY3C 4K0BA 1MDFA 2M5HA 1JOSA 3VNQA 4LF5C 4NOZA 5BUSA 1MKYA 3T1HC 1UWDA 1ZB8A 5BSWA 2HJGA 4EATA 5BSMA 4LE5A 3J80D 2E0GA 5A19A 1PG4A 4LF8C 2Z51A 2KDNA 1XDXA 4DV5C 3IMLA 4D4IA 1XMOC 1GPMA 3LUSA 4D56A 3EERA 2KZ0A 3CQ3A 4R1MA 4I9GA 1VLAA 2DYJA 1LCIA 4RLFA 3IPLA 5KYTA 3PROC 4BSZA 1XHJA 4G36A 4R1LA 5K85A 4IZ6A 3VNRA 4JI4C 3FCCA 4DR4C 3A4IA
chains in the Genus database with same CATH topology
1NYEA 1QM4A 1N32C 1HNXC 1FJGC 4JI2C 3IEUA 2KZFA 1WF3A 4XX2A 1XRCA 4R0MA 5KEIA 2ASBA 2UXCC 1MXBA 4ODJA 4BC7A 5E7QA 3R44A 3N54B 4JI8C 3ETOA 5T8SA 3CW9A 3B7WA 4DR2C 5AE1A 2V7BA 4L7IA 1XNRC 1BA3A 4DV0C 4JI6C 4B3MC 4G1IA 2D1TA 2PN2A 1USPB 3E7XA 3E7WA 2ZM6C 3G7SA 1IBLC 2ATWA 2ONFA 2D27A 2YWCA 3RG2A 3ETCA 2YCBA 5IWAC 3L95X 3R9XA 5BURA 3GR0A 3CJEA 5BSRA 2BJOA 3NPDA 2P2MA 4B3SC 5IFIA 3DAYA 2AYAA 1N34C 2HHHC 4BBYA 4BCAA 1O90A 2VQFC 4KHPC 4PZPA 5K8FA 4AQYC 3NI2A 4I9FA 2P2JA 3DHVA 4DR7C 2PT7G 2UUAC 2QVXX 2PROA 2QVYX 2UXBC 2P2QA 1J5EC 2D28C 4DR6C 2QL8A 4X66C 3NYRA 2D1SA 2QW0X 3SO4A 5A1GA 4JI0C 1HNWC 2VSQA 1O93A 4IR7A 2DPLA 5GTDA 4FUTA 4DG8A 2E8FA 2D1RA 1V26A 4GXRA 3N2QA 3L8CA 2CY1A 4DV3C 1XNQC 2OPLA 3JAMD 4GS5A 1YJ7A 4L4QA 3DLPX 4BC9A 3PESA 2D1QA 3LGXA 1O9TA 3GKUA 4JI7C 1L2FA 4HPVA 4JV5C 4PROC 3GR1A 2CXCA 4ZJZA 1ML8A 4JM1A 2E8EA 4KTTA 4OYCA 2Y4OA 4JI1C 2E8CA 3R9WA 4MH4A 2E7GA 3EQ6A 4RLQA 3RV2A 3VNSA 5A2QD 4G37A 2P02A 4MTNA 4ISBA 3NYQA 5BUQA 3FCEA 3OTOC 4DCSA 4GKKC 4L2ZA 2P2BA 3S82A 3GPCA 1ULTA 4RM2A 2F4VC 2UUCC 1ZB9A 4X64C 4K0KC 4WV3A 2OO4A 2JMPA 3CW8X 4FTFA 3LNVA 1HH2P 2YWBA 4D57A 4U5YD 4PHTA 4LF6C 1N33C 5BSVA 1XMQC 2WD9A 3A9VA 4FUQA 2QVZX 4X62C 1HR0C 1N36C 1T5HX 1MXCA 4LF7C 1PA4A 3H2TA 4LF4C 4DR3C 4D4GA 1USPA 3KXWA 5BSUA 3TUFA 2OPLB 1MD9A 2E5LC 5FLXD 2Y4NA 3A9UA 5LMUC 1FUGA 4DUYC 4TPSB 2VZEA 4RMNA 2D7VA 1P7LA 4JYAC 3PBKA 4ZLPA 3LAXA 4DR1C 2Y27A 4DV6C 4RVOA 4KTVA 4LFAC 4GXQA 3IEVA 1RY2A 4NXNC 4DCTA 5BR8C 5BSTA 1UKKA 5H9UA 1O92A 4B3RC 5CZXA 1MXAA 1HNZC 3J7AD 1T5DX 3TDEA 4DV2C 3T1YC 3AF6A 3C5EA 1V25A 5JRHA 1IBMC 1RG9A 2P2FA 1AMUA 1K0RA 4RVNA 4YHHC 4DV4C 3I08A 1MDBA 2UU9C 4DCUA 5T8TA 5KYVA 4B3TC 5ADZA 2OBVA 3TQIA 2BH1X 5IT9D 4NXMC 2XR1A 4RM3A 4JI5C 1KKGA 1QWIA 5CZVA 5LMNC 4DV7C 5A1IA 2UUBC 1I94C 4JI3C 5DV9A 4NDNA 1N2FA 4GKJC 4OXIA 4DG9A 3AF5A 3I07A 5AE2A 3UOWA 1WH9A 2WP0C 1LQLA 1XRBA 4DR5C 4OX9C 4LFBC 4LF9C 4DUZC 4WS9A 3UZ0A 1XRAA 1PG3A 4DCVA 5AE3A 1IBKC 4LFCC 4X65C 2VQEC 4DV1C 2UXDC 3J81D 2P20A 1EGAA 2EGTA 4YY3C 4K0BA 1MDFA 1JOSA 3VNQA 4LF5C 4NOZA 5BUSA 1MKYA 3T1HC 1ZB8A 5BSWA 2HJGA 4EATA 5BSMA 4LE5A 3J80D 2E0GA 5A19A 1PG4A 4LF8C 4DV5C 3IMLA 4D4IA 1XMOC 1GPMA 3LUSA 4D56A 3EERA 4R1MA 4I9GA 1VLAA 2DYJA 1LCIA 4RLFA 3IPLA 5KYTA 3PROC 4BSZA 5K85A 4G36A 4R1LA 4IZ6A 3VNRA 4JI4C 3FCCA 4DR4C 3A4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYE A;  1HH2 P;  2QL8 A;  1N32 C;  4X66 C;  1HNX C;  5IT9 D;  4NXM C;  1FJG C;  4LF6 C;  2XR1 A;  3IEU A;  4JI2 C;  1N33 C;  4JI5 C;  1XMQ C;  1KKG A;  1QWI A;  2KZF A;  4X62 C;  1WF3 A;  4XX2 A;  5LMN C;  4DV7 C;  1HR0 C;  2UUB C;  1N36 C;  2ASB A;  2UXC C;  4LF7 C;  1PA4 A;  1I94 C;  4JI3 C;  4JI0 C;  1N2F A;  1HNW C;  4GKJ C;  4LF4 C;  3AF5 A;  4DR3 C;  1USP A;  4JI8 C;  3I07 A;  2E8F A;  4DR2 C;  2OPL B;  1XNR C;  2E5L C;  5FLX D;  1WH9 A;  4DV0 C;  1LQL A;  2CY1 A;  4JI6 C;  4DV3 C;  4B3M C;  4DR5 C;  4OX9 C;  1XNQ C;  4LFB C;  4LF9 C;  2OPL A;  3JAM D;  2PN2 A;  4DUZ C;  5LMU C;  1USP B;  2ZM6 C;  4DUY C;  4DCV A;  1IBK C;  4LFC C;  2D7V A;  1IBL C;  4JYA C;  2ATW A;  2ONF A;  3GKU A;  4X65 C;  2VQE C;  4DV1 C;  4DR1 C;  4JI7 C;  2UXD C;  1L2F A;  4DV6 C;  4JV5 C;  3J81 D;  2YCB A;  4LFA C;  1EGA A;  2EGT A;  4YY3 C;  2CXC A;  1ML8 A;  1JOS A;  5IWA C;  3IEV A;  4LF5 C;  4NOZ A;  3T1H C;  1MKY A;  3R9X A;  1ZB8 A;  3CJE A;  2E8E A;  2HJG A;  4NXN C;  4DCT A;  5BR8 C;  1UKK A;  2BJO A;  3J80 D;  4B3S C;  4B3R C;  4JI1 C;  1HNZ C;  4LF8 C;  3J7A D;  2E8C A;  3R9W A;  4MH4 A;  1N34 C;  2HHH C;  2E7G A;  4DV2 C;  4DV5 C;  3T1Y C;  3AF6 A;  2VQF C;  4KHP C;  5A2Q D;  4MTN A;  1XMO C;  1IBM C;  4AQY C;  3LUS A;  3EER A;  1K0R A;  3OTO C;  4DCS A;  4DR7 C;  2PT7 G;  2UUA C;  4YHH C;  4GKK C;  1VLA A;  4DV4 C;  2DYJ A;  2UU9 C;  2F4V C;  2UUC C;  4DCU A;  2UXB C;  1ZB9 A;  4BSZ A;  4X64 C;  4K0K C;  4B3T C;  1J5E C;  4JI4 C;  4DR6 C;  2JMP A;  4DR4 C; 
#chains in the Genus database with same CATH topology
 1NYE A;  1QM4 A;  1N32 C;  1HNX C;  1FJG C;  4JI2 C;  3IEU A;  1NY8 A;  2KZF A;  1WF3 A;  4XX2 A;  1XRC A;  4R0M A;  5KEI A;  2ASB A;  2UXC C;  1MXB A;  4ODJ A;  4BC7 A;  5E7Q A;  3R44 A;  3N54 B;  4JI8 C;  3ETO A;  5T8S A;  3CW9 A;  3B7W A;  4DR2 C;  5AE1 A;  2V7B A;  4L7I A;  1XNR C;  1BA3 A;  4DV0 C;  4JI6 C;  4B3M C;  4G1I A;  2D1T A;  2PN2 A;  1USP B;  3E7X A;  3E7W A;  2ZM6 C;  3G7S A;  3AY0 A;  1IBL C;  2ATW A;  2ONF A;  2D27 A;  2YWC A;  3RG2 A;  2ZZN A;  3ETC A;  2YCB A;  3TR3 A;  5IWA C;  3L95 X;  3R9X A;  5BUR A;  3GR0 A;  3A26 A;  3CJE A;  5BSR A;  2BJO A;  3NPD A;  2M5O A;  2P2M A;  4B3S C;  5IFI A;  3DAY A;  2AYA A;  1N34 C;  2HHH C;  4BBY A;  4BCA A;  1O90 A;  2VQF C;  4KHP C;  3CQ2 A;  4PZP A;  5K8F A;  4AQY C;  3NI2 A;  2MCQ A;  4I9F A;  2P2J A;  3DHV A;  4DR7 C;  2PT7 G;  2UUA C;  2QVX X;  2YX1 A;  2MMA B;  2PRO A;  2QVY X;  2UXB C;  2P2Q A;  1J5E C;  2D28 C;  4DR6 C;  2QL8 A;  4X66 C;  1P4E C;  3NYR A;  2D1S A;  2QW0 X;  3SO4 A;  5A1G A;  4JI0 C;  1HNW C;  2VSQ A;  1O93 A;  4IR7 A;  2ZZM A;  2DPL A;  5GTD A;  4FUT A;  4DG8 A;  2E8F A;  2D1R A;  1V26 A;  4GXR A;  3N2Q A;  3L8C A;  2CY1 A;  4DV3 C;  1YGT A;  1XNQ C;  2OPL A;  3JAM D;  4GS5 A;  1YJ7 A;  2PG1 E;  4L4Q A;  3DLP X;  4BC9 A;  3PES A;  2D1Q A;  3LGX A;  1O9T A;  3GKU A;  4JI7 C;  1L2F A;  4HPV A;  4JV5 C;  4PRO C;  3GR1 A;  1WCJ A;  2CXC A;  4ZJZ A;  1ML8 A;  4JM1 A;  1V60 A;  1FLO A;  2E8E A;  4KTT A;  4OYC A;  2Y4O A;  4JI1 C;  1VEH A;  2E8C A;  3R9W A;  4MH4 A;  2E7G A;  3EQ6 A;  4RLQ A;  3RV2 A;  3VNS A;  1P4E A;  5A2Q D;  4G37 A;  2P02 A;  4MTN A;  4ISB A;  3NYQ A;  4PUH A;  1M6X C;  5BUQ A;  3FCE A;  3OTO C;  4DCS A;  4GKK C;  4L2Z A;  2P2B A;  3S82 A;  3GPC A;  1ULT A;  4RM2 A;  2F4V C;  2UUC C;  1ZB9 A;  4X64 C;  4K0K C;  4WV3 A;  2OO4 A;  2JMP A;  3CW8 X;  4FTF A;  3LNV A;  1HH2 P;  2YWB A;  4D57 A;  4U5Y D;  4PHT A;  4LF6 C;  1N33 C;  5BSV A;  1XMQ C;  2WD9 A;  3A9V A;  4FUQ A;  2QVZ X;  4X62 C;  1HR0 C;  1N36 C;  1T5H X;  1MXC A;  4LF7 C;  1PA4 A;  3H2T A;  3O2E A;  4LF4 C;  4DR3 C;  4D4G A;  2NCL A;  1USP A;  3KXW A;  2CU6 A;  5BSU A;  3TUF A;  2MM9 A;  2OPL B;  1MD9 A;  2E5L C;  5FLX D;  1IB8 A;  4PUG A;  5LCI A;  2Y4N A;  3A9U A;  5LMU C;  1FUG A;  4DUY C;  4TPS B;  2VZE A;  4RMN A;  2D7V A;  1P7L A;  4JYA C;  3PBK A;  4ZLP A;  3LAX A;  4DR1 C;  2Y27 A;  4DV6 C;  4RVO A;  4KTV A;  4LFA C;  4GXQ A;  3IEV A;  1M6X A;  1RY2 A;  3UX2 A;  4NXN C;  4DCT A;  5BR8 C;  1PU1 A;  1UKK A;  4PUI A;  5BST A;  5H9U A;  1O92 A;  4B3R C;  5CZX A;  3LNO A;  1MXA A;  1HNZ C;  3J7A D;  1T5D X;  3TDE A;  4DV2 C;  3T1Y C;  3AF6 A;  3C5E A;  1V25 A;  5JRH A;  1IBM C;  1RG9 A;  2P2F A;  1AMU A;  1K0R A;  4RVN A;  4YHH C;  4DV4 C;  3I08 A;  1MDB A;  2UU9 C;  4DCU A;  5T8T A;  5KYV A;  4B3T C;  2ZTB A;  3K6R A;  5ADZ A;  2OBV A;  3TQI A;  2BH1 X;  5IT9 D;  4NXM C;  2XR1 A;  4RM3 A;  4JI5 C;  1KKG A;  1QWI A;  5CZV A;  5LMN C;  4DV7 C;  5A1I A;  3UEB A;  2DHM A;  2UUB C;  1I94 C;  4JI3 C;  5DV9 A;  4NDN A;  1N2F A;  4GKJ C;  4OXI A;  4DG9 A;  3AF5 A;  3I07 A;  3CQ1 A;  5AE2 A;  1TH5 A;  3UOW A;  1WH9 A;  2WP0 C;  3A25 A;  1LQL A;  1XRB A;  4DR5 C;  4OX9 C;  4LFB C;  4LF9 C;  4DUZ C;  4WS9 A;  3UZ0 A;  1XRA A;  1PG3 A;  4DCV A;  5AE3 A;  1IBK C;  4LFC C;  3UX3 A;  2JNV A;  3FM7 A;  4X65 C;  2VQE C;  4DV1 C;  2UXD C;  1XS3 A;  3J81 D;  2P20 A;  1EGA A;  2EGT A;  4YY3 C;  4K0B A;  1MDF A;  2M5H A;  1JOS A;  3VNQ A;  4LF5 C;  4NOZ A;  5BUS A;  1MKY A;  3T1H C;  1UWD A;  1ZB8 A;  5BSW A;  2HJG A;  4EAT A;  5BSM A;  4LE5 A;  3J80 D;  2E0G A;  5A19 A;  1PG4 A;  4LF8 C;  2Z51 A;  2KDN A;  1XDX A;  4DV5 C;  3IML A;  4D4I A;  1XMO C;  1GPM A;  3LUS A;  4D56 A;  3EER A;  2KZ0 A;  3CQ3 A;  4R1M A;  4I9G A;  1VLA A;  2DYJ A;  1LCI A;  4RLF A;  3IPL A;  5KYT A;  3PRO C;  4BSZ A;  1XHJ A;  4G36 A;  4R1L A;  5K85 A;  4IZ6 A;  3VNR A;  4JI4 C;  3FCC A;  4DR4 C;  3A4I A; 
#chains in the Genus database with same CATH homology
 1NYE A;  1QM4 A;  1N32 C;  1HNX C;  1FJG C;  4JI2 C;  3IEU A;  2KZF A;  1WF3 A;  4XX2 A;  1XRC A;  4R0M A;  5KEI A;  2ASB A;  2UXC C;  1MXB A;  4ODJ A;  4BC7 A;  5E7Q A;  3R44 A;  3N54 B;  4JI8 C;  3ETO A;  5T8S A;  3CW9 A;  3B7W A;  4DR2 C;  5AE1 A;  2V7B A;  4L7I A;  1XNR C;  1BA3 A;  4DV0 C;  4JI6 C;  4B3M C;  4G1I A;  2D1T A;  2PN2 A;  1USP B;  3E7X A;  3E7W A;  2ZM6 C;  3G7S A;  1IBL C;  2ATW A;  2ONF A;  2D27 A;  2YWC A;  3RG2 A;  3ETC A;  2YCB A;  5IWA C;  3L95 X;  3R9X A;  5BUR A;  3GR0 A;  3CJE A;  5BSR A;  2BJO A;  3NPD A;  2P2M A;  4B3S C;  5IFI A;  3DAY A;  2AYA A;  1N34 C;  2HHH C;  4BBY A;  4BCA A;  1O90 A;  2VQF C;  4KHP C;  4PZP A;  5K8F A;  4AQY C;  3NI2 A;  4I9F A;  2P2J A;  3DHV A;  4DR7 C;  2PT7 G;  2UUA C;  2QVX X;  2PRO A;  2QVY X;  2UXB C;  2P2Q A;  1J5E C;  2D28 C;  4DR6 C;  2QL8 A;  4X66 C;  3NYR A;  2D1S A;  2QW0 X;  3SO4 A;  5A1G A;  4JI0 C;  1HNW C;  2VSQ A;  1O93 A;  4IR7 A;  2DPL A;  5GTD A;  4FUT A;  4DG8 A;  2E8F A;  2D1R A;  1V26 A;  4GXR A;  3N2Q A;  3L8C A;  2CY1 A;  4DV3 C;  1XNQ C;  2OPL A;  3JAM D;  4GS5 A;  1YJ7 A;  4L4Q A;  3DLP X;  4BC9 A;  3PES A;  2D1Q A;  3LGX A;  1O9T A;  3GKU A;  4JI7 C;  1L2F A;  4HPV A;  4JV5 C;  4PRO C;  3GR1 A;  2CXC A;  4ZJZ A;  1ML8 A;  4JM1 A;  2E8E A;  4KTT A;  4OYC A;  2Y4O A;  4JI1 C;  2E8C A;  3R9W A;  4MH4 A;  2E7G A;  3EQ6 A;  4RLQ A;  3RV2 A;  3VNS A;  5A2Q D;  4G37 A;  2P02 A;  4MTN A;  4ISB A;  3NYQ A;  5BUQ A;  3FCE A;  3OTO C;  4DCS A;  4GKK C;  4L2Z A;  2P2B A;  3S82 A;  3GPC A;  1ULT A;  4RM2 A;  2F4V C;  2UUC C;  1ZB9 A;  4X64 C;  4K0K C;  4WV3 A;  2OO4 A;  2JMP A;  3CW8 X;  4FTF A;  3LNV A;  1HH2 P;  2YWB A;  4D57 A;  4U5Y D;  4PHT A;  4LF6 C;  1N33 C;  5BSV A;  1XMQ C;  2WD9 A;  3A9V A;  4FUQ A;  2QVZ X;  4X62 C;  1HR0 C;  1N36 C;  1T5H X;  1MXC A;  4LF7 C;  1PA4 A;  3H2T A;  4LF4 C;  4DR3 C;  4D4G A;  1USP A;  3KXW A;  5BSU A;  3TUF A;  2OPL B;  1MD9 A;  2E5L C;  5FLX D;  2Y4N A;  3A9U A;  5LMU C;  1FUG A;  4DUY C;  4TPS B;  2VZE A;  4RMN A;  2D7V A;  1P7L A;  4JYA C;  3PBK A;  4ZLP A;  3LAX A;  4DR1 C;  2Y27 A;  4DV6 C;  4RVO A;  4KTV A;  4LFA C;  4GXQ A;  3IEV A;  1RY2 A;  4NXN C;  4DCT A;  5BR8 C;  5BST A;  1UKK A;  5H9U A;  1O92 A;  4B3R C;  5CZX A;  1MXA A;  1HNZ C;  3J7A D;  1T5D X;  3TDE A;  4DV2 C;  3T1Y C;  3AF6 A;  3C5E A;  1V25 A;  5JRH A;  1IBM C;  1RG9 A;  2P2F A;  1AMU A;  1K0R A;  4RVN A;  4YHH C;  4DV4 C;  3I08 A;  1MDB A;  2UU9 C;  4DCU A;  5T8T A;  5KYV A;  4B3T C;  5ADZ A;  2OBV A;  3TQI A;  2BH1 X;  5IT9 D;  4NXM C;  2XR1 A;  4RM3 A;  4JI5 C;  1KKG A;  1QWI A;  5CZV A;  5LMN C;  4DV7 C;  5A1I A;  2UUB C;  1I94 C;  4JI3 C;  5DV9 A;  4NDN A;  1N2F A;  4GKJ C;  4OXI A;  4DG9 A;  3AF5 A;  3I07 A;  5AE2 A;  3UOW A;  1WH9 A;  2WP0 C;  1LQL A;  1XRB A;  4DR5 C;  4OX9 C;  4LFB C;  4LF9 C;  4DUZ C;  4WS9 A;  3UZ0 A;  1XRA A;  1PG3 A;  4DCV A;  5AE3 A;  1IBK C;  4LFC C;  4X65 C;  2VQE C;  4DV1 C;  2UXD C;  3J81 D;  2P20 A;  1EGA A;  2EGT A;  4YY3 C;  4K0B A;  1MDF A;  1JOS A;  3VNQ A;  4LF5 C;  4NOZ A;  5BUS A;  1MKY A;  3T1H C;  1ZB8 A;  5BSW A;  2HJG A;  4EAT A;  5BSM A;  4LE5 A;  3J80 D;  2E0G A;  5A19 A;  1PG4 A;  4LF8 C;  4DV5 C;  3IML A;  4D4I A;  1XMO C;  1GPM A;  3LUS A;  4D56 A;  3EER A;  4R1M A;  4I9G A;  1VLA A;  2DYJ A;  1LCI A;  4RLF A;  3IPL A;  5KYT A;  3PRO C;  4BSZ A;  5K85 A;  4G36 A;  4R1L A;  4IZ6 A;  3VNR A;  4JI4 C;  3FCC A;  4DR4 C;  3A4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...