4DR1C

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr1C02
4BSZA 3R9WA 1N36C 4LF5C 4NXMC 2HHHC 4DR5C 1UKKA 2CY1A 3IEVA 4GKKC 4OX9C 2ATWA 5BR8C 1N2FA 4DCVA 1EGAA 2UXBC 1JOSA 5LMUC 2DYJA 4JYAC 4XX2A 4LF4C 3T1YC 2QL8A 2UXDC 2VQFC 2YCBA 4DCTA 4JV5C 4DR3C 4LF8C 4JI6C 4X64C 1HNZC 5LMNC 2PT7G 4DV4C 1J5EC 4JI1C 2OPLA 3T1HC 1WF3A 1FJGC 1N34C 2E5LC 1K0RA 4JI7C 1ZB9A 1MKYA 1KKGA 2UUCC 4DV2C 1ML8A 3J80D 1N33C 1ZB8A 1XNQC 2ONFA 4MTNA 4DV7C 2F4VC 1IBLC 3I07A 4JI3C 3IEUA 2OPLB 3LUSA 4KHPC 4X62C 4B3TC 4DR1C 3CJEA 2HJGA 3J81D 2VQEC 4MH4A 4DCSA 1IBKC 4DR6C 4JI5C 4DV5C 2CXCA 1VLAA 4NOZA 4DV3C 2KZFA 4LFAC 4DV6C 2JMPA 4DCUA 2XR1A 1I94C 3R9XA 3GKUA 4LF6C 2ZM6C 2E8EA 4GKJC 2D7VA 4JI4C 5FLXD 4JI8C 1XNRC 4DR4C 2PN2A 4DUZC 1WH9A 4LF7C 4AQYC 4X65C 2E7GA 3EERA 1XMOC 2UUAC 1HR0C 1USPA 1PA4A 4K0KC 3AF5A 4LF9C 1QWIA 4DR2C 5IWAC 4X66C 4JI2C 2UU9C 4NXNC 4DV0C 1XMQC 4YHHC 3AF6A 4LFCC 3JAMD 2EGTA 5A2QD 2E8FA 1L2FA 4DV1C 4YY3C 4LFBC 1HNXC 1N32C 2UXCC 3J7AD 1HNWC 5IT9D 1USPB 2ASBA 4B3RC 4DUYC 2UUBC 1HH2P 4DR7C 2BJOA 4B3MC 2E8CA 4JI0C 1NYEA 3OTOC 1LQLA 1IBMC 4B3SC
chains in the Genus database with same CATH superfamily
3R9WA 2HHHC 3A26A 3R44A 3NYRA 3EQ6A 1EGAA 4RLFA 2UXBC 5LMUC 4XX2A 4LF4C 2ZZNA 2P2FA 3DLPX 3T1YC 3IMLA 2UXDC 4LF8C 4X64C 1HNZC 1J5EC 2PT7G 4DV4C 1V26A 4DG8A 2MM9A 1XDXA 2P2QA 3T1HC 3FCCA 2E5LC 4TPSB 1KKGA 1LCIA 4PUIA 4DV2C 2QVXX 1YJ7A 4U5YD 2F4VC 2P20A 1IBLC 3I07A 4BCAA 4G37A 2OPLB 3AY0A 4X62C 3GR1A 2VQEC 1IBKC 1VLAA 4JM1A 4NOZA 2OO4A 4DV6C 1I94C 3L95X 4GS5A 3CW9A 2Y4NA 2ZZMA 2E8EA 4GKJC 4L4QA 5AE1A 3A9VA 2OBVA 4AQYC 4G1IA 1P7LA 2D1TA 1UWDA 4LF9C 2Y4OA 4DR2C 3DHVA 1MDBA 4FUTA 5A1GA 3LGXA 1RY2A 3AF6A 2EGTA 4PUGA 1XRAA 4YY3C 4OYCA 2CU6A 3RV2A 1O9TA 3E7XA 1M6XC 1N32C 3J7AD 3DAYA 2ASBA 4DUYC 4DR7C 2VZEA 4BBYA 3UZ0A 2VSQA 4DG9A 2E8CA 4JI0C 1LQLA 1BA3A 4LF6C 3A9UA 4BSZA 4HPVA 4LF5C 4NXMC 4DR5C 4OX9C 2ATWA 4LE5A 3LNOA 3PBKA 4DCVA 1JOSA 5BURA 4OXIA 1M6XA 1O92A 4JV5C 2YX1A 5BSMA 1WF3A 1K0RA 1ZB9A 1MKYA 5BSRA 1N33C 5BUSA 1XNQC 3GR0A 4R1MA 4DV7C 5JRHA 4L2ZA 3ETOA 4WV3A 4KHPC 3NI2A 5K8FA 3CJEA 3J81D 1ULTA 4KTVA 4JI5C 2WP0C 2M5OA 2CXCA 1GPMA 4DV3C 2KZFA 4LFAC 4ODJA 3C5EA 4DCUA 3PESA 3R9XA 2WD9A 2PROA 3GKUA 4D4GA 3L8CA 2ZM6C 3UEBA 3B7WA 4WS9A 4DR4C 3TR3A 2PN2A 5BUQA 2P2BA 1XRCA 5KEIA 2Y27A 4X65C 3EERA 4ISBA 1USPA 2DHMA 4GXRA 1PA4A 3AF5A 3A25A 5IWAC 2D1RA 3TDEA 4X66C 4JI2C 2UU9C 1NY8A 4DV0C 1XMQC 4YHHC 4FTFA 3JAMD 1FUGA 5AE2A 4D4IA 2NCLA 4LFBC 1RG9A 1HNXC 3NYQA 3CQ2A 3FCEA 4R0MA 2KDNA 5BSWA 1PG3A 1O90A 1NYEA 3VNQA 2D1QA 4I9GA 5GTDA 1UKKA 3CW8X 3K6RA 4GKKC 4I9FA 3UX2A 1N2FA 3I08A 2DYJA 5IFIA 2QVZX 2V7BA 4JI6C 5E7QA 5LMNC 4PROC 1MD9A 1XRBA 4GXQA 4D56A 4JI7C 2JNVA 2KZ0A 3RG2A 2UUCC 1ML8A 5CZXA 3J80D 2AYAA 2ONFA 4MTNA 3CQ3A 3LNVA 2YWBA 1V25A 4PZPA 3IEUA 2MMAB 3LUSA 3KXWA 4B3TC 2HJGA 4RM3A 4MH4A 2P2MA 2QW0X 3GPCA 5AE3A 4DR6C 4NDNA 1FLOA 3N54B 2XR1A 1YGTA 3TUFA 1IB8A 2D7VA 5BSVA 2P02A 3O2EA 4JI8C 4RMNA 1WH9A 2E0GA 4RLQA 5A1IA 4K0KC 4G36A 5KYVA 4K0BA 5ADZA 4IZ6A 4R1LA 4BC7A 4L7IA 2MCQA 1O93A 3E7WA 5A2QD 5A19A 2ZTBA 2E8FA 1T5DX 4DV1C 2BH1X 2UXCC 1USPB 4ZJZA 4B3RC 3SO4A 1PU1A 5LCIA 3LAXA 4BC9A 4PUHA 2BJOA 4B3MC 4D57A 1TH5A 3OTOC 1IBMC 1MXBA 1N36C 5BSUA 2CY1A 3IEVA 5BR8C 4RM2A 1MXCA 5H9UA 4JYAC 3N2QA 4ZLPA 2QVYX 2QL8A 2VQFC 2YCBA 2YWCA 3PROC 4DCTA 4DR3C 4RVNA 4JI1C 2OPLA 3A4IA 1FJGC 1N34C 1XS3A 3FM7A 2P2JA 1ZB8A 4PHTA 2Z51A 3H2TA 1QM4A 2PG1E 4JI3C 1MDFA 4DR1C 3ETCA 1MXAA 4DCSA 5T8SA 2M5HA 4DV5C 1P4EC 1WCJA 2D1SA 2JMPA 5K85A 5BSTA 1T5HX 3IPLA 5DV9A 4FUQA 1VEHA 4JI4C 2DPLA 5FLXD 1XNRC 4DUZC 1AMUA 2D28C 4LF7C 3UOWA 5KYTA 2E7GA 1XMOC 3TQIA 2UUAC 1HR0C 4KTTA 1V60A 1QWIA 1PG4A 1P4EA 4IR7A 4NXNC 3CQ1A 3S82A 3VNRA 4LFCC 1L2FA 4RVOA 1HNWC 5IT9D 5CZVA 5T8TA 2UUBC 1HH2P 3UX3A 3VNSA 4EATA 2D27A 1XHJA 3NPDA 4B3SC 3G7SA
chains in the Genus database with same CATH topology
3R9WA 2HHHC 3R44A 3NYRA 3EQ6A 1EGAA 4RLFA 2UXBC 5LMUC 4XX2A 4LF4C 2P2FA 3DLPX 3T1YC 3IMLA 2UXDC 4LF8C 4X64C 1HNZC 1J5EC 2PT7G 4DV4C 1V26A 4DG8A 2P2QA 3T1HC 3FCCA 2E5LC 4TPSB 1KKGA 1LCIA 4DV2C 2QVXX 1YJ7A 4U5YD 2F4VC 2P20A 1IBLC 3I07A 4BCAA 4G37A 2OPLB 4X62C 3GR1A 2VQEC 1IBKC 1VLAA 4JM1A 4NOZA 2OO4A 4DV6C 1I94C 3L95X 4GS5A 3CW9A 2Y4NA 2E8EA 4GKJC 4L4QA 5AE1A 3A9VA 2OBVA 4AQYC 4G1IA 1P7LA 2D1TA 4LF9C 2Y4OA 4DR2C 3DHVA 1MDBA 4FUTA 5A1GA 3LGXA 1RY2A 3AF6A 2EGTA 1XRAA 4YY3C 4OYCA 1N32C 3RV2A 1O9TA 3E7XA 3J7AD 3DAYA 2ASBA 4DUYC 4DR7C 2VZEA 4BBYA 3UZ0A 2VSQA 4DG9A 2E8CA 4JI0C 1LQLA 1BA3A 4LF6C 3A9UA 4BSZA 4HPVA 4LF5C 4NXMC 4DR5C 4OX9C 2ATWA 4LE5A 3PBKA 4DCVA 1JOSA 5BURA 4OXIA 1O92A 4JV5C 5BSMA 1WF3A 1K0RA 1ZB9A 1MKYA 5BSRA 1N33C 5BUSA 1XNQC 3GR0A 4R1MA 4DV7C 5JRHA 4L2ZA 3ETOA 4WV3A 4KHPC 3NI2A 5K8FA 3CJEA 3J81D 1ULTA 4KTVA 4JI5C 2WP0C 2CXCA 1GPMA 4DV3C 2KZFA 4LFAC 4ODJA 3C5EA 4DCUA 3PESA 3R9XA 2WD9A 2PROA 3GKUA 4D4GA 3L8CA 2ZM6C 3B7WA 4WS9A 4DR4C 2PN2A 5BUQA 2P2BA 1XRCA 5KEIA 2Y27A 4X65C 3EERA 4ISBA 1USPA 4GXRA 1PA4A 3AF5A 5IWAC 2D1RA 3TDEA 4X66C 4JI2C 2UU9C 4DV0C 1XMQC 4YHHC 4FTFA 3JAMD 1FUGA 5AE2A 4D4IA 4LFBC 1RG9A 1HNXC 3NYQA 3FCEA 4R0MA 5BSWA 1PG3A 1O90A 1NYEA 3VNQA 2D1QA 4I9GA 5GTDA 1UKKA 3CW8X 4GKKC 4I9FA 1N2FA 3I08A 2DYJA 5IFIA 2QVZX 2V7BA 4JI6C 5E7QA 5LMNC 4PROC 1MD9A 1XRBA 4GXQA 4D56A 4JI7C 3RG2A 2UUCC 1ML8A 5CZXA 3J80D 2AYAA 2ONFA 4MTNA 3LNVA 2YWBA 1V25A 4PZPA 3IEUA 3LUSA 3KXWA 4B3TC 2HJGA 4RM3A 4MH4A 2P2MA 2QW0X 3GPCA 5AE3A 4DR6C 4NDNA 3N54B 2XR1A 3TUFA 2D7VA 5BSVA 2P02A 4JI8C 4RMNA 1WH9A 2E0GA 4RLQA 5A1IA 4K0KC 4G36A 5KYVA 4K0BA 5ADZA 4IZ6A 4R1LA 4BC7A 4L7IA 1O93A 3E7WA 5A2QD 5A19A 2E8FA 1T5DX 4DV1C 2BH1X 2UXCC 1USPB 4ZJZA 4B3RC 3SO4A 3LAXA 4BC9A 2BJOA 4B3MC 4D57A 3OTOC 1IBMC 1MXBA 1N36C 5BSUA 2CY1A 3IEVA 5BR8C 4RM2A 1MXCA 5H9UA 4JYAC 3N2QA 4ZLPA 2QVYX 2QL8A 2VQFC 2YCBA 2YWCA 3PROC 4DCTA 4DR3C 4RVNA 4JI1C 2OPLA 3A4IA 1FJGC 1N34C 2P2JA 1ZB8A 4PHTA 3H2TA 1QM4A 4JI3C 1MDFA 4DR1C 3ETCA 1MXAA 4DCSA 5T8SA 4DV5C 2D1SA 2JMPA 5K85A 5BSTA 1T5HX 3IPLA 5DV9A 4FUQA 4JI4C 2DPLA 5FLXD 1XNRC 4DUZC 1AMUA 2D28C 4LF7C 3UOWA 5KYTA 2E7GA 1XMOC 3TQIA 2UUAC 1HR0C 4KTTA 1QWIA 1PG4A 4IR7A 4NXNC 3S82A 3VNRA 4LFCC 1L2FA 4RVOA 1HNWC 5IT9D 5CZVA 5T8TA 2UUBC 1HH2P 3VNSA 4EATA 2D27A 3NPDA 4B3SC 3G7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSZ A;  3R9W A;  1N36 C;  4LF5 C;  4NXM C;  2HHH C;  4DR5 C;  1UKK A;  2CY1 A;  3IEV A;  4GKK C;  4OX9 C;  2ATW A;  5BR8 C;  1N2F A;  4DCV A;  1EGA A;  2UXB C;  1JOS A;  5LMU C;  2DYJ A;  4JYA C;  4XX2 A;  4LF4 C;  3T1Y C;  2QL8 A;  2UXD C;  2VQF C;  2YCB A;  4DCT A;  4JV5 C;  4DR3 C;  4LF8 C;  4JI6 C;  4X64 C;  1HNZ C;  5LMN C;  2PT7 G;  4DV4 C;  1J5E C;  4JI1 C;  2OPL A;  3T1H C;  1WF3 A;  1FJG C;  1N34 C;  2E5L C;  1K0R A;  4JI7 C;  1ZB9 A;  1MKY A;  1KKG A;  2UUC C;  4DV2 C;  1ML8 A;  3J80 D;  1N33 C;  1ZB8 A;  1XNQ C;  2ONF A;  4MTN A;  4DV7 C;  2F4V C;  1IBL C;  3I07 A;  4JI3 C;  3IEU A;  2OPL B;  3LUS A;  4KHP C;  4X62 C;  4B3T C;  4DR1 C;  3CJE A;  2HJG A;  3J81 D;  2VQE C;  4MH4 A;  4DCS A;  1IBK C;  4DR6 C;  4JI5 C;  4DV5 C;  2CXC A;  1VLA A;  4NOZ A;  4DV3 C;  2KZF A;  4LFA C;  4DV6 C;  2JMP A;  4DCU A;  2XR1 A;  1I94 C;  3R9X A;  3GKU A;  4LF6 C;  2ZM6 C;  2E8E A;  4GKJ C;  2D7V A;  4JI4 C;  5FLX D;  4JI8 C;  1XNR C;  4DR4 C;  2PN2 A;  4DUZ C;  1WH9 A;  4LF7 C;  4AQY C;  4X65 C;  2E7G A;  3EER A;  1XMO C;  2UUA C;  1HR0 C;  1USP A;  1PA4 A;  4K0K C;  3AF5 A;  4LF9 C;  1QWI A;  4DR2 C;  5IWA C;  4X66 C;  4JI2 C;  2UU9 C;  4NXN C;  4DV0 C;  1XMQ C;  4YHH C;  3AF6 A;  4LFC C;  3JAM D;  2EGT A;  5A2Q D;  2E8F A;  1L2F A;  4DV1 C;  4YY3 C;  4LFB C;  1HNX C;  1N32 C;  2UXC C;  3J7A D;  1HNW C;  5IT9 D;  1USP B;  2ASB A;  4B3R C;  4DUY C;  2UUB C;  1HH2 P;  4DR7 C;  2BJO A;  4B3M C;  2E8C A;  4JI0 C;  1NYE A;  3OTO C;  1LQL A;  1IBM C;  4B3S C; 
#chains in the Genus database with same CATH topology
 3R9W A;  2HHH C;  3A26 A;  3R44 A;  3NYR A;  3EQ6 A;  1EGA A;  4RLF A;  2UXB C;  5LMU C;  4XX2 A;  4LF4 C;  2ZZN A;  2P2F A;  3DLP X;  3T1Y C;  3IML A;  2UXD C;  4LF8 C;  4X64 C;  1HNZ C;  1J5E C;  2PT7 G;  4DV4 C;  1V26 A;  4DG8 A;  2MM9 A;  1XDX A;  2P2Q A;  3T1H C;  3FCC A;  2E5L C;  4TPS B;  1KKG A;  1LCI A;  4PUI A;  4DV2 C;  2QVX X;  1YJ7 A;  4U5Y D;  2F4V C;  2P20 A;  1IBL C;  3I07 A;  4BCA A;  4G37 A;  2OPL B;  3AY0 A;  4X62 C;  3GR1 A;  2VQE C;  1IBK C;  1VLA A;  4JM1 A;  4NOZ A;  2OO4 A;  4DV6 C;  1I94 C;  3L95 X;  4GS5 A;  3CW9 A;  2Y4N A;  2ZZM A;  2E8E A;  4GKJ C;  4L4Q A;  5AE1 A;  3A9V A;  2OBV A;  4AQY C;  4G1I A;  1P7L A;  2D1T A;  1UWD A;  4LF9 C;  2Y4O A;  4DR2 C;  3DHV A;  1MDB A;  4FUT A;  5A1G A;  3LGX A;  1RY2 A;  3AF6 A;  2EGT A;  4PUG A;  1XRA A;  4YY3 C;  4OYC A;  2CU6 A;  3RV2 A;  1O9T A;  3E7X A;  1M6X C;  1N32 C;  3J7A D;  3DAY A;  2ASB A;  4DUY C;  4DR7 C;  2VZE A;  4BBY A;  3UZ0 A;  2VSQ A;  4DG9 A;  2E8C A;  4JI0 C;  1LQL A;  1BA3 A;  4LF6 C;  3A9U A;  4BSZ A;  4HPV A;  4LF5 C;  4NXM C;  4DR5 C;  4OX9 C;  2ATW A;  4LE5 A;  3LNO A;  3PBK A;  4DCV A;  1JOS A;  5BUR A;  4OXI A;  1M6X A;  1O92 A;  4JV5 C;  2YX1 A;  5BSM A;  1WF3 A;  1K0R A;  1ZB9 A;  1MKY A;  5BSR A;  1N33 C;  5BUS A;  1XNQ C;  3GR0 A;  4R1M A;  4DV7 C;  5JRH A;  4L2Z A;  3ETO A;  4WV3 A;  4KHP C;  3NI2 A;  5K8F A;  3CJE A;  3J81 D;  1ULT A;  4KTV A;  4JI5 C;  2WP0 C;  2M5O A;  2CXC A;  1GPM A;  4DV3 C;  2KZF A;  4LFA C;  4ODJ A;  3C5E A;  4DCU A;  3PES A;  3R9X A;  2WD9 A;  2PRO A;  3GKU A;  4D4G A;  3L8C A;  2ZM6 C;  3UEB A;  3B7W A;  4WS9 A;  4DR4 C;  3TR3 A;  2PN2 A;  5BUQ A;  2P2B A;  1XRC A;  5KEI A;  2Y27 A;  4X65 C;  3EER A;  4ISB A;  1USP A;  2DHM A;  4GXR A;  1PA4 A;  3AF5 A;  3A25 A;  5IWA C;  2D1R A;  3TDE A;  4X66 C;  4JI2 C;  2UU9 C;  1NY8 A;  4DV0 C;  1XMQ C;  4YHH C;  4FTF A;  3JAM D;  1FUG A;  5AE2 A;  4D4I A;  2NCL A;  4LFB C;  1RG9 A;  1HNX C;  3NYQ A;  3CQ2 A;  3FCE A;  4R0M A;  2KDN A;  5BSW A;  1PG3 A;  1O90 A;  1NYE A;  3VNQ A;  2D1Q A;  4I9G A;  5GTD A;  1UKK A;  3CW8 X;  3K6R A;  4GKK C;  4I9F A;  3UX2 A;  1N2F A;  3I08 A;  2DYJ A;  5IFI A;  2QVZ X;  2V7B A;  4JI6 C;  5E7Q A;  5LMN C;  4PRO C;  1MD9 A;  1XRB A;  4GXQ A;  4D56 A;  4JI7 C;  2JNV A;  2KZ0 A;  3RG2 A;  2UUC C;  1ML8 A;  5CZX A;  3J80 D;  2AYA A;  2ONF A;  4MTN A;  3CQ3 A;  3LNV A;  2YWB A;  1V25 A;  4PZP A;  3IEU A;  2MMA B;  3LUS A;  3KXW A;  4B3T C;  2HJG A;  4RM3 A;  4MH4 A;  2P2M A;  2QW0 X;  3GPC A;  5AE3 A;  4DR6 C;  4NDN A;  1FLO A;  3N54 B;  2XR1 A;  1YGT A;  3TUF A;  1IB8 A;  2D7V A;  5BSV A;  2P02 A;  3O2E A;  4JI8 C;  4RMN A;  1WH9 A;  2E0G A;  4RLQ A;  5A1I A;  4K0K C;  4G36 A;  5KYV A;  4K0B A;  5ADZ A;  4IZ6 A;  4R1L A;  4BC7 A;  4L7I A;  2MCQ A;  1O93 A;  3E7W A;  5A2Q D;  5A19 A;  2ZTB A;  2E8F A;  1T5D X;  4DV1 C;  2BH1 X;  2UXC C;  1USP B;  4ZJZ A;  4B3R C;  3SO4 A;  1PU1 A;  5LCI A;  3LAX A;  4BC9 A;  4PUH A;  2BJO A;  4B3M C;  4D57 A;  1TH5 A;  3OTO C;  1IBM C;  1MXB A;  1N36 C;  5BSU A;  2CY1 A;  3IEV A;  5BR8 C;  4RM2 A;  1MXC A;  5H9U A;  4JYA C;  3N2Q A;  4ZLP A;  2QVY X;  2QL8 A;  2VQF C;  2YCB A;  2YWC A;  3PRO C;  4DCT A;  4DR3 C;  4RVN A;  4JI1 C;  2OPL A;  3A4I A;  1FJG C;  1N34 C;  1XS3 A;  3FM7 A;  2P2J A;  1ZB8 A;  4PHT A;  2Z51 A;  3H2T A;  1QM4 A;  2PG1 E;  4JI3 C;  1MDF A;  4DR1 C;  3ETC A;  1MXA A;  4DCS A;  5T8S A;  2M5H A;  4DV5 C;  1P4E C;  1WCJ A;  2D1S A;  2JMP A;  5K85 A;  5BST A;  1T5H X;  3IPL A;  5DV9 A;  4FUQ A;  1VEH A;  4JI4 C;  2DPL A;  5FLX D;  1XNR C;  4DUZ C;  1AMU A;  2D28 C;  4LF7 C;  3UOW A;  5KYT A;  2E7G A;  1XMO C;  3TQI A;  2UUA C;  1HR0 C;  4KTT A;  1V60 A;  1QWI A;  1PG4 A;  1P4E A;  4IR7 A;  4NXN C;  3CQ1 A;  3S82 A;  3VNR A;  4LFC C;  1L2F A;  4RVO A;  1HNW C;  5IT9 D;  5CZV A;  5T8T A;  2UUB C;  1HH2 P;  3UX3 A;  3VNS A;  4EAT A;  2D27 A;  1XHJ A;  3NPD A;  4B3S C;  3G7S A; 
#chains in the Genus database with same CATH homology
 3R9W A;  2HHH C;  3R44 A;  3NYR A;  3EQ6 A;  1EGA A;  4RLF A;  2UXB C;  5LMU C;  4XX2 A;  4LF4 C;  2P2F A;  3DLP X;  3T1Y C;  3IML A;  2UXD C;  4LF8 C;  4X64 C;  1HNZ C;  1J5E C;  2PT7 G;  4DV4 C;  1V26 A;  4DG8 A;  2P2Q A;  3T1H C;  3FCC A;  2E5L C;  4TPS B;  1KKG A;  1LCI A;  4DV2 C;  2QVX X;  1YJ7 A;  4U5Y D;  2F4V C;  2P20 A;  1IBL C;  3I07 A;  4BCA A;  4G37 A;  2OPL B;  4X62 C;  3GR1 A;  2VQE C;  1IBK C;  1VLA A;  4JM1 A;  4NOZ A;  2OO4 A;  4DV6 C;  1I94 C;  3L95 X;  4GS5 A;  3CW9 A;  2Y4N A;  2E8E A;  4GKJ C;  4L4Q A;  5AE1 A;  3A9V A;  2OBV A;  4AQY C;  4G1I A;  1P7L A;  2D1T A;  4LF9 C;  2Y4O A;  4DR2 C;  3DHV A;  1MDB A;  4FUT A;  5A1G A;  3LGX A;  1RY2 A;  3AF6 A;  2EGT A;  1XRA A;  4YY3 C;  4OYC A;  1N32 C;  3RV2 A;  1O9T A;  3E7X A;  3J7A D;  3DAY A;  2ASB A;  4DUY C;  4DR7 C;  2VZE A;  4BBY A;  3UZ0 A;  2VSQ A;  4DG9 A;  2E8C A;  4JI0 C;  1LQL A;  1BA3 A;  4LF6 C;  3A9U A;  4BSZ A;  4HPV A;  4LF5 C;  4NXM C;  4DR5 C;  4OX9 C;  2ATW A;  4LE5 A;  3PBK A;  4DCV A;  1JOS A;  5BUR A;  4OXI A;  1O92 A;  4JV5 C;  5BSM A;  1WF3 A;  1K0R A;  1ZB9 A;  1MKY A;  5BSR A;  1N33 C;  5BUS A;  1XNQ C;  3GR0 A;  4R1M A;  4DV7 C;  5JRH A;  4L2Z A;  3ETO A;  4WV3 A;  4KHP C;  3NI2 A;  5K8F A;  3CJE A;  3J81 D;  1ULT A;  4KTV A;  4JI5 C;  2WP0 C;  2CXC A;  1GPM A;  4DV3 C;  2KZF A;  4LFA C;  4ODJ A;  3C5E A;  4DCU A;  3PES A;  3R9X A;  2WD9 A;  2PRO A;  3GKU A;  4D4G A;  3L8C A;  2ZM6 C;  3B7W A;  4WS9 A;  4DR4 C;  2PN2 A;  5BUQ A;  2P2B A;  1XRC A;  5KEI A;  2Y27 A;  4X65 C;  3EER A;  4ISB A;  1USP A;  4GXR A;  1PA4 A;  3AF5 A;  5IWA C;  2D1R A;  3TDE A;  4X66 C;  4JI2 C;  2UU9 C;  4DV0 C;  1XMQ C;  4YHH C;  4FTF A;  3JAM D;  1FUG A;  5AE2 A;  4D4I A;  4LFB C;  1RG9 A;  1HNX C;  3NYQ A;  3FCE A;  4R0M A;  5BSW A;  1PG3 A;  1O90 A;  1NYE A;  3VNQ A;  2D1Q A;  4I9G A;  5GTD A;  1UKK A;  3CW8 X;  4GKK C;  4I9F A;  1N2F A;  3I08 A;  2DYJ A;  5IFI A;  2QVZ X;  2V7B A;  4JI6 C;  5E7Q A;  5LMN C;  4PRO C;  1MD9 A;  1XRB A;  4GXQ A;  4D56 A;  4JI7 C;  3RG2 A;  2UUC C;  1ML8 A;  5CZX A;  3J80 D;  2AYA A;  2ONF A;  4MTN A;  3LNV A;  2YWB A;  1V25 A;  4PZP A;  3IEU A;  3LUS A;  3KXW A;  4B3T C;  2HJG A;  4RM3 A;  4MH4 A;  2P2M A;  2QW0 X;  3GPC A;  5AE3 A;  4DR6 C;  4NDN A;  3N54 B;  2XR1 A;  3TUF A;  2D7V A;  5BSV A;  2P02 A;  4JI8 C;  4RMN A;  1WH9 A;  2E0G A;  4RLQ A;  5A1I A;  4K0K C;  4G36 A;  5KYV A;  4K0B A;  5ADZ A;  4IZ6 A;  4R1L A;  4BC7 A;  4L7I A;  1O93 A;  3E7W A;  5A2Q D;  5A19 A;  2E8F A;  1T5D X;  4DV1 C;  2BH1 X;  2UXC C;  1USP B;  4ZJZ A;  4B3R C;  3SO4 A;  3LAX A;  4BC9 A;  2BJO A;  4B3M C;  4D57 A;  3OTO C;  1IBM C;  1MXB A;  1N36 C;  5BSU A;  2CY1 A;  3IEV A;  5BR8 C;  4RM2 A;  1MXC A;  5H9U A;  4JYA C;  3N2Q A;  4ZLP A;  2QVY X;  2QL8 A;  2VQF C;  2YCB A;  2YWC A;  3PRO C;  4DCT A;  4DR3 C;  4RVN A;  4JI1 C;  2OPL A;  3A4I A;  1FJG C;  1N34 C;  2P2J A;  1ZB8 A;  4PHT A;  3H2T A;  1QM4 A;  4JI3 C;  1MDF A;  4DR1 C;  3ETC A;  1MXA A;  4DCS A;  5T8S A;  4DV5 C;  2D1S A;  2JMP A;  5K85 A;  5BST A;  1T5H X;  3IPL A;  5DV9 A;  4FUQ A;  4JI4 C;  2DPL A;  5FLX D;  1XNR C;  4DUZ C;  1AMU A;  2D28 C;  4LF7 C;  3UOW A;  5KYT A;  2E7G A;  1XMO C;  3TQI A;  2UUA C;  1HR0 C;  4KTT A;  1QWI A;  1PG4 A;  4IR7 A;  4NXN C;  3S82 A;  3VNR A;  4LFC C;  1L2F A;  4RVO A;  1HNW C;  5IT9 D;  5CZV A;  5T8T A;  2UUB C;  1HH2 P;  3VNS A;  4EAT A;  2D27 A;  3NPD A;  4B3S C;  3G7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...