4DR1C

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dr1C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dr1C02
4DR2C 4LFCC 2OPLB 4DV0C 3AF5A 4X66C 4LF8C 4DCVA 1HH2P 4DR5C 2BJOA 3T1HC 3J7AD 1HNZC 1FJGC 3T1YC 2HJGA 4K0KC 1XMOC 4LF9C 2VQFC 4KHPC 2D7VA 4LFBC 1LQLA 3J80D 2DYJA 1XMQC 1IBMC 4DR3C 2UXBC 1PA4A 2PT7G 3EERA 5FLXD 1ZB9A 4LF4C 4JI5C 1EGAA 1N34C 4JI1C 5BR8C 1WF3A 5IWAC 4JI8C 1HR0C 1WH9A 4DR6C 4DR1C 3AF6A 4DV2C 5LMUC 4GKJC 1L2FA 5IT9D 1JOSA 1HNXC 2PN2A 2E8FA 4DUYC 2EGTA 4X64C 1UKKA 4LF6C 4NXNC 4JI7C 1QWIA 4NXMC 2UXCC 4X65C 5LMNC 3R9XA 4MTNA 1USPB 4DCSA 1XNQC 1VLAA 4JI3C 3J81D 2JMPA 3IEVA 4B3RC 2OPLA 2E8EA 4X62C 4B3TC 3I07A 2KZFA 4DV3C 2CY1A 2E7GA 2E8CA 2HHHC 4DV7C 2F4VC 1ZB8A 2CXCA 4BSZA 2UXDC 2VQEC 4DCTA 4JYAC 2UUCC 1I94C 4AQYC 1N36C 4B3SC 4JV5C 4DV5C 4JI6C 4DV4C 1NYEA 4JI0C 4DUZC 4NOZA 3R9WA 3JAMD 3OTOC 1IBKC 1ML8A 1MKYA 3IEUA 5A2QD 2ONFA 2UUBC 2UUAC 4LFAC 1IBLC 1K0RA 2UU9C 4YHHC 2ASBA 4JI2C 3GKUA 1KKGA 2XR1A 4MH4A 1HNWC 4LF7C 4DV6C 1N2FA 4LF5C 3CJEA 2ZM6C 1XNRC 2ATWA 4DR4C 3LUSA 4DV1C 1N33C 2E5LC 1N32C 4OX9C 4GKKC 1USPA 2QL8A 2YCBA 4DR7C 4B3MC 1J5EC 4XX2A 4JI4C 4YY3C 4DCUA
chains in the Genus database with same CATH superfamily
2YX1A 4ZLPA 4LFCC 5BSMA 3AF5A 4LF8C 4OXIA 3TDEA 4G37A 1HH2P 2D27A 1PG3A 4WV3A 4D57A 1LQLA 3GR0A 3J80D 1PA4A 3UEBA 2MMAB 5FLXD 2D1QA 2PROA 1WCJA 4JI8C 4DR6C 3CQ1A 5A1IA 2M5HA 1L2FA 1HNXC 1GPMA 1QM4A 2E8FA 4R0MA 2MM9A 1T5HX 3A9UA 3CQ3A 4IZ6A 4RMNA 2YWCA 5A1GA 4MTNA 3IEVA 2E8EA 2NCLA 2KZFA 4RM2A 4DV7C 1ZB8A 1M6XC 3R44A 4DCTA 1I94C 4AQYC 4B3SC 2AYAA 1VEHA 4FTFA 4L4QA 2D28C 1ML8A 5BSRA 2QVYX 3IEUA 1V60A 4BCAA 4RLFA 1O93A 1PG4A 2DPLA 1MDBA 5T8SA 1AMUA 4JI2C 3GKUA 1P4EC 1HNWC 3UX3A 2P2FA 4GXQA 4FUQA 5BUSA 1N32C 4GS5A 4L7IA 3C5EA 4OX9C 2QL8A 2MCQA 1J5EC 4IR7A 1MXBA 4PZPA 3L8CA 3LNOA 4DR5C 1FJGC 3T1YC 2HJGA 4K0KC 1XMOC 4LF9C 3VNQA 4KHPC 2D7VA 4LFBC 2DYJA 2PT7G 2PG1E 1N34C 5AE1A 5BR8C 1WF3A 2VSQA 5LCIA 3K6RA 1NY8A 5BUQA 2PN2A 2EGTA 2P2BA 1MD9A 4X64C 1UKKA 1T5DX 3A26A 3CW9A 3FCEA 5JRHA 5T8TA 2UXCC 5ADZA 4X65C 5LMNC 1USPB 1VLAA 2Z51A 4LE5A 4JI3C 4X62C 3TR3A 4BBYA 2P2MA 2E8CA 1O9TA 1MXAA 2KDNA 4ISBA 2VQEC 2WD9A 2V7BA 3NI2A 3TUFA 1FLOA 4JI0C 3OTOC 1IBKC 1LCIA 1V26A 4RVOA 3S82A 1K0RA 3IPLA 2UU9C 2E0GA 2ASBA 1KKGA 4MH4A 4PUIA 3RG2A 4NDNA 4DV6C 4LF5C 5E7QA 5AE3A 1XNRC 2ZM6C 3B7WA 4D4IA 2ZTBA 4PUGA 1N33C 1O92A 2E5LC 4GKKC 3N2QA 4DR7C 2QVZX 2D1TA 4ZJZA 5AE2A 1XRAA 4JI4C 4DCUA 4OYCA 5KYTA 4DR2C 2OPLB 4DV0C 1XS3A 4X66C 3DLPX 1XDXA 3T1HC 2VZEA 1TH5A 3CW8X 5KEIA 4ODJA 1XMQC 5BSWA 4DR3C 3EERA 4I9GA 2ZZNA 1ZB9A 4KTTA 2P2JA 4LF4C 4FUTA 4HPVA 5CZXA 4R1MA 1WH9A 3A4IA 4DR1C 4DV2C 5LMUC 3KXWA 1JOSA 4DG8A 3LAXA 5BURA 4DUYC 4U5YD 4GXRA 3UOWA 5H9UA 4NXMC 3NYRA 3DHVA 3VNSA 3R9XA 1XNQC 4DCSA 5KYVA 4B3TC 1ULTA 4G1IA 3RV2A 4DV3C 2E7GA 3L95X 2WP0C 2HHHC 2F4VC 4BSZA 2UXDC 2P02A 2UUCC 3E7XA 1N36C 4DV5C 1NYEA 3R9WA 3JAMD 3H2TA 2D1RA 1MKYA 2D1SA 2ONFA 2UUAC 4PROC 4LFAC 5GTDA 2M5OA 4YHHC 5IFIA 2P2QA 4WS9A 1YGTA 4KTVA 2ZZMA 1XRCA 3FCCA 1FUGA 4PUHA 3TQIA 4DV1C 3N54B 5K8FA 3NYQA 1USPA 4I9FA 1O90A 3G7SA 1XRBA 4PHTA 3ETCA 3GPCA 4R1LA 2KZ0A 3LNVA 4RVNA 3A25A 4DCVA 2BJOA 2DHMA 1RG9A 3UX2A 5A19A 3J7AD 1HNZC 1V25A 3NPDA 4D4GA 2VQFC 1IBMC 3VNRA 1XHJA 2UXBC 3UZ0A 3DAYA 2P20A 3CQ2A 1PU1A 3O2EA 4JI5C 1EGAA 4JI1C 3PROC 1BA3A 5IWAC 4L2ZA 1HR0C 3E7WA 3AF6A 1YJ7A 4GKJC 5IT9D 2OO4A 1RY2A 2QVXX 4JM1A 3I08A 4LF6C 4NXNC 4JI7C 3A9VA 5CZVA 1QWIA 2QW0X 3FM7A 3PBKA 5K85A 2JNVA 3IMLA 1UWDA 2JMPA 3J81D 4B3RC 2OPLA 4G36A 3I07A 2BH1X 2CY1A 2Y4NA 3AY0A 2CXCA 5DV9A 4BC7A 4JYAC 2OBVA 3LGXA 1MXCA 4JV5C 4JI6C 4DV4C 4DUZC 3EQ6A 1M6XA 4K0BA 2CU6A 4NOZA 3SO4A 3PESA 3GR1A 4DG9A 1P7LA 5A2QD 2UUBC 1IBLC 5BSUA 1MDFA 1IB8A 4TPSB 2Y4OA 2XR1A 5BSTA 4LF7C 2Y27A 4D56A 4RM3A 5BSVA 4BC9A 1N2FA 3ETOA 3CJEA 2ATWA 1P4EA 4DR4C 3LUSA 2YWBA 2YCBA 4RLQA 4EATA 4B3MC 4XX2A 4YY3C
chains in the Genus database with same CATH topology
4ZLPA 4LFCC 5BSMA 3AF5A 4LF8C 4OXIA 3TDEA 4G37A 1HH2P 2D27A 1PG3A 4WV3A 4D57A 1LQLA 3GR0A 3J80D 1PA4A 5FLXD 2D1QA 2PROA 4JI8C 4DR6C 5A1IA 1L2FA 1HNXC 1GPMA 1QM4A 2E8FA 4R0MA 1T5HX 3A9UA 4IZ6A 4RMNA 2YWCA 5A1GA 4MTNA 3IEVA 2E8EA 2KZFA 4RM2A 4DV7C 1ZB8A 3R44A 4DCTA 1I94C 4AQYC 4B3SC 2AYAA 4FTFA 4L4QA 2D28C 1ML8A 5BSRA 2QVYX 3IEUA 4BCAA 4RLFA 1O93A 1PG4A 2DPLA 1MDBA 5T8SA 1AMUA 4JI2C 3GKUA 1HNWC 2P2FA 4GXQA 4FUQA 5BUSA 1N32C 4GS5A 4L7IA 3C5EA 4OX9C 2QL8A 1J5EC 4IR7A 1MXBA 4PZPA 3L8CA 4DR5C 1FJGC 3T1YC 2HJGA 4K0KC 1XMOC 4LF9C 3VNQA 4KHPC 2D7VA 4LFBC 2DYJA 2PT7G 1N34C 5AE1A 5BR8C 1WF3A 2VSQA 5BUQA 2PN2A 2EGTA 2P2BA 1MD9A 4X64C 1UKKA 1T5DX 3CW9A 3FCEA 5JRHA 5T8TA 2UXCC 5ADZA 4X65C 5LMNC 1USPB 1VLAA 4LE5A 4JI3C 4X62C 4BBYA 2P2MA 2E8CA 1O9TA 1MXAA 4ISBA 2VQEC 2WD9A 2V7BA 3NI2A 3TUFA 4JI0C 3OTOC 1IBKC 1LCIA 1V26A 4RVOA 3S82A 1K0RA 3IPLA 2UU9C 2E0GA 2ASBA 1KKGA 4MH4A 3RG2A 4NDNA 4DV6C 4LF5C 5E7QA 5AE3A 1XNRC 2ZM6C 3B7WA 4D4IA 1N33C 1O92A 2E5LC 4GKKC 3N2QA 4DR7C 2QVZX 2D1TA 4ZJZA 5AE2A 1XRAA 4JI4C 4DCUA 4OYCA 5KYTA 4DR2C 2OPLB 4DV0C 4X66C 3DLPX 3T1HC 2VZEA 3CW8X 5KEIA 4ODJA 1XMQC 5BSWA 4DR3C 3EERA 4I9GA 1ZB9A 4KTTA 2P2JA 4LF4C 4FUTA 4HPVA 5CZXA 4R1MA 1WH9A 3A4IA 4DR1C 4DV2C 5LMUC 3KXWA 1JOSA 4DG8A 3LAXA 5BURA 4DUYC 4U5YD 4GXRA 3UOWA 5H9UA 4NXMC 3NYRA 3DHVA 3VNSA 3R9XA 1XNQC 4DCSA 5KYVA 4B3TC 1ULTA 4G1IA 3RV2A 4DV3C 2E7GA 3L95X 2WP0C 2HHHC 2F4VC 4BSZA 2UXDC 2P02A 2UUCC 3E7XA 1N36C 4DV5C 1NYEA 3R9WA 3JAMD 3H2TA 2D1RA 1MKYA 2D1SA 2ONFA 2UUAC 4PROC 4LFAC 5GTDA 4YHHC 5IFIA 2P2QA 4WS9A 4KTVA 1XRCA 3FCCA 1FUGA 3TQIA 4DV1C 3N54B 5K8FA 3NYQA 1USPA 4I9FA 1O90A 3G7SA 1XRBA 4PHTA 3ETCA 3GPCA 4R1LA 3LNVA 4RVNA 4DCVA 2BJOA 1RG9A 5A19A 3J7AD 1HNZC 1V25A 3NPDA 4D4GA 2VQFC 1IBMC 3VNRA 2UXBC 3UZ0A 3DAYA 2P20A 4JI5C 1EGAA 4JI1C 3PROC 1BA3A 5IWAC 4L2ZA 1HR0C 3E7WA 3AF6A 1YJ7A 4GKJC 5IT9D 2OO4A 1RY2A 2QVXX 4JM1A 3I08A 4LF6C 4NXNC 4JI7C 3A9VA 5CZVA 1QWIA 2QW0X 3PBKA 5K85A 3IMLA 2JMPA 3J81D 4B3RC 2OPLA 4G36A 3I07A 2BH1X 2CY1A 2Y4NA 2CXCA 5DV9A 4BC7A 4JYAC 2OBVA 3LGXA 1MXCA 4JV5C 4JI6C 4DV4C 4DUZC 3EQ6A 4K0BA 4NOZA 3SO4A 3PESA 3GR1A 4DG9A 1P7LA 5A2QD 2UUBC 1IBLC 5BSUA 1MDFA 4TPSB 2Y4OA 2XR1A 5BSTA 4LF7C 2Y27A 4D56A 4RM3A 5BSVA 4BC9A 1N2FA 3ETOA 3CJEA 2ATWA 4DR4C 3LUSA 2YWBA 2YCBA 4RLQA 4EATA 4B3MC 4XX2A 4YY3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 C;  4LFC C;  2OPL B;  4DV0 C;  3AF5 A;  4X66 C;  4LF8 C;  4DCV A;  1HH2 P;  4DR5 C;  2BJO A;  3T1H C;  3J7A D;  1HNZ C;  1FJG C;  3T1Y C;  2HJG A;  4K0K C;  1XMO C;  4LF9 C;  2VQF C;  4KHP C;  2D7V A;  4LFB C;  1LQL A;  3J80 D;  2DYJ A;  1XMQ C;  1IBM C;  4DR3 C;  2UXB C;  1PA4 A;  2PT7 G;  3EER A;  5FLX D;  1ZB9 A;  4LF4 C;  4JI5 C;  1EGA A;  1N34 C;  4JI1 C;  5BR8 C;  1WF3 A;  5IWA C;  4JI8 C;  1HR0 C;  1WH9 A;  4DR6 C;  4DR1 C;  3AF6 A;  4DV2 C;  5LMU C;  4GKJ C;  1L2F A;  5IT9 D;  1JOS A;  1HNX C;  2PN2 A;  2E8F A;  4DUY C;  2EGT A;  4X64 C;  1UKK A;  4LF6 C;  4NXN C;  4JI7 C;  1QWI A;  4NXM C;  2UXC C;  4X65 C;  5LMN C;  3R9X A;  4MTN A;  1USP B;  4DCS A;  1XNQ C;  1VLA A;  4JI3 C;  3J81 D;  2JMP A;  3IEV A;  4B3R C;  2OPL A;  2E8E A;  4X62 C;  4B3T C;  3I07 A;  2KZF A;  4DV3 C;  2CY1 A;  2E7G A;  2E8C A;  2HHH C;  4DV7 C;  2F4V C;  1ZB8 A;  2CXC A;  4BSZ A;  2UXD C;  2VQE C;  4DCT A;  4JYA C;  2UUC C;  1I94 C;  4AQY C;  1N36 C;  4B3S C;  4JV5 C;  4DV5 C;  4JI6 C;  4DV4 C;  1NYE A;  4JI0 C;  4DUZ C;  4NOZ A;  3R9W A;  3JAM D;  3OTO C;  1IBK C;  1ML8 A;  1MKY A;  3IEU A;  5A2Q D;  2ONF A;  2UUB C;  2UUA C;  4LFA C;  1IBL C;  1K0R A;  2UU9 C;  4YHH C;  2ASB A;  4JI2 C;  3GKU A;  1KKG A;  2XR1 A;  4MH4 A;  1HNW C;  4LF7 C;  4DV6 C;  1N2F A;  4LF5 C;  3CJE A;  2ZM6 C;  1XNR C;  2ATW A;  4DR4 C;  3LUS A;  4DV1 C;  1N33 C;  2E5L C;  1N32 C;  4OX9 C;  4GKK C;  1USP A;  2QL8 A;  2YCB A;  4DR7 C;  4B3M C;  1J5E C;  4XX2 A;  4JI4 C;  4YY3 C;  4DCU A; 
#chains in the Genus database with same CATH topology
 2YX1 A;  4ZLP A;  4LFC C;  5BSM A;  3AF5 A;  4LF8 C;  4OXI A;  3TDE A;  4G37 A;  1HH2 P;  2D27 A;  1PG3 A;  4WV3 A;  4D57 A;  1LQL A;  3GR0 A;  3J80 D;  1PA4 A;  3UEB A;  2MMA B;  5FLX D;  2D1Q A;  2PRO A;  1WCJ A;  4JI8 C;  4DR6 C;  3CQ1 A;  5A1I A;  2M5H A;  1L2F A;  1HNX C;  1GPM A;  1QM4 A;  2E8F A;  4R0M A;  2MM9 A;  1T5H X;  3A9U A;  3CQ3 A;  4IZ6 A;  4RMN A;  2YWC A;  5A1G A;  4MTN A;  3IEV A;  2E8E A;  2NCL A;  2KZF A;  4RM2 A;  4DV7 C;  1ZB8 A;  1M6X C;  3R44 A;  4DCT A;  1I94 C;  4AQY C;  4B3S C;  2AYA A;  1VEH A;  4FTF A;  4L4Q A;  2D28 C;  1ML8 A;  5BSR A;  2QVY X;  3IEU A;  1V60 A;  4BCA A;  4RLF A;  1O93 A;  1PG4 A;  2DPL A;  1MDB A;  5T8S A;  1AMU A;  4JI2 C;  3GKU A;  1P4E C;  1HNW C;  3UX3 A;  2P2F A;  4GXQ A;  4FUQ A;  5BUS A;  1N32 C;  4GS5 A;  4L7I A;  3C5E A;  4OX9 C;  2QL8 A;  2MCQ A;  1J5E C;  4IR7 A;  1MXB A;  4PZP A;  3L8C A;  3LNO A;  4DR5 C;  1FJG C;  3T1Y C;  2HJG A;  4K0K C;  1XMO C;  4LF9 C;  3VNQ A;  4KHP C;  2D7V A;  4LFB C;  2DYJ A;  2PT7 G;  2PG1 E;  1N34 C;  5AE1 A;  5BR8 C;  1WF3 A;  2VSQ A;  5LCI A;  3K6R A;  1NY8 A;  5BUQ A;  2PN2 A;  2EGT A;  2P2B A;  1MD9 A;  4X64 C;  1UKK A;  1T5D X;  3A26 A;  3CW9 A;  3FCE A;  5JRH A;  5T8T A;  2UXC C;  5ADZ A;  4X65 C;  5LMN C;  1USP B;  1VLA A;  2Z51 A;  4LE5 A;  4JI3 C;  4X62 C;  3TR3 A;  4BBY A;  2P2M A;  2E8C A;  1O9T A;  1MXA A;  2KDN A;  4ISB A;  2VQE C;  2WD9 A;  2V7B A;  3NI2 A;  3TUF A;  1FLO A;  4JI0 C;  3OTO C;  1IBK C;  1LCI A;  1V26 A;  4RVO A;  3S82 A;  1K0R A;  3IPL A;  2UU9 C;  2E0G A;  2ASB A;  1KKG A;  4MH4 A;  4PUI A;  3RG2 A;  4NDN A;  4DV6 C;  4LF5 C;  5E7Q A;  5AE3 A;  1XNR C;  2ZM6 C;  3B7W A;  4D4I A;  2ZTB A;  4PUG A;  1N33 C;  1O92 A;  2E5L C;  4GKK C;  3N2Q A;  4DR7 C;  2QVZ X;  2D1T A;  4ZJZ A;  5AE2 A;  1XRA A;  4JI4 C;  4DCU A;  4OYC A;  5KYT A;  4DR2 C;  2OPL B;  4DV0 C;  1XS3 A;  4X66 C;  3DLP X;  1XDX A;  3T1H C;  2VZE A;  1TH5 A;  3CW8 X;  5KEI A;  4ODJ A;  1XMQ C;  5BSW A;  4DR3 C;  3EER A;  4I9G A;  2ZZN A;  1ZB9 A;  4KTT A;  2P2J A;  4LF4 C;  4FUT A;  4HPV A;  5CZX A;  4R1M A;  1WH9 A;  3A4I A;  4DR1 C;  4DV2 C;  5LMU C;  3KXW A;  1JOS A;  4DG8 A;  3LAX A;  5BUR A;  4DUY C;  4U5Y D;  4GXR A;  3UOW A;  5H9U A;  4NXM C;  3NYR A;  3DHV A;  3VNS A;  3R9X A;  1XNQ C;  4DCS A;  5KYV A;  4B3T C;  1ULT A;  4G1I A;  3RV2 A;  4DV3 C;  2E7G A;  3L95 X;  2WP0 C;  2HHH C;  2F4V C;  4BSZ A;  2UXD C;  2P02 A;  2UUC C;  3E7X A;  1N36 C;  4DV5 C;  1NYE A;  3R9W A;  3JAM D;  3H2T A;  2D1R A;  1MKY A;  2D1S A;  2ONF A;  2UUA C;  4PRO C;  4LFA C;  5GTD A;  2M5O A;  4YHH C;  5IFI A;  2P2Q A;  4WS9 A;  1YGT A;  4KTV A;  2ZZM A;  1XRC A;  3FCC A;  1FUG A;  4PUH A;  3TQI A;  4DV1 C;  3N54 B;  5K8F A;  3NYQ A;  1USP A;  4I9F A;  1O90 A;  3G7S A;  1XRB A;  4PHT A;  3ETC A;  3GPC A;  4R1L A;  2KZ0 A;  3LNV A;  4RVN A;  3A25 A;  4DCV A;  2BJO A;  2DHM A;  1RG9 A;  3UX2 A;  5A19 A;  3J7A D;  1HNZ C;  1V25 A;  3NPD A;  4D4G A;  2VQF C;  1IBM C;  3VNR A;  1XHJ A;  2UXB C;  3UZ0 A;  3DAY A;  2P20 A;  3CQ2 A;  1PU1 A;  3O2E A;  4JI5 C;  1EGA A;  4JI1 C;  3PRO C;  1BA3 A;  5IWA C;  4L2Z A;  1HR0 C;  3E7W A;  3AF6 A;  1YJ7 A;  4GKJ C;  5IT9 D;  2OO4 A;  1RY2 A;  2QVX X;  4JM1 A;  3I08 A;  4LF6 C;  4NXN C;  4JI7 C;  3A9V A;  5CZV A;  1QWI A;  2QW0 X;  3FM7 A;  3PBK A;  5K85 A;  2JNV A;  3IML A;  1UWD A;  2JMP A;  3J81 D;  4B3R C;  2OPL A;  4G36 A;  3I07 A;  2BH1 X;  2CY1 A;  2Y4N A;  3AY0 A;  2CXC A;  5DV9 A;  4BC7 A;  4JYA C;  2OBV A;  3LGX A;  1MXC A;  4JV5 C;  4JI6 C;  4DV4 C;  4DUZ C;  3EQ6 A;  1M6X A;  4K0B A;  2CU6 A;  4NOZ A;  3SO4 A;  3PES A;  3GR1 A;  4DG9 A;  1P7L A;  5A2Q D;  2UUB C;  1IBL C;  5BSU A;  1MDF A;  1IB8 A;  4TPS B;  2Y4O A;  2XR1 A;  5BST A;  4LF7 C;  2Y27 A;  4D56 A;  4RM3 A;  5BSV A;  4BC9 A;  1N2F A;  3ETO A;  3CJE A;  2ATW A;  1P4E A;  4DR4 C;  3LUS A;  2YWB A;  2YCB A;  4RLQ A;  4EAT A;  4B3M C;  4XX2 A;  4YY3 C; 
#chains in the Genus database with same CATH homology
 4ZLP A;  4LFC C;  5BSM A;  3AF5 A;  4LF8 C;  4OXI A;  3TDE A;  4G37 A;  1HH2 P;  2D27 A;  1PG3 A;  4WV3 A;  4D57 A;  1LQL A;  3GR0 A;  3J80 D;  1PA4 A;  5FLX D;  2D1Q A;  2PRO A;  4JI8 C;  4DR6 C;  5A1I A;  1L2F A;  1HNX C;  1GPM A;  1QM4 A;  2E8F A;  4R0M A;  1T5H X;  3A9U A;  4IZ6 A;  4RMN A;  2YWC A;  5A1G A;  4MTN A;  3IEV A;  2E8E A;  2KZF A;  4RM2 A;  4DV7 C;  1ZB8 A;  3R44 A;  4DCT A;  1I94 C;  4AQY C;  4B3S C;  2AYA A;  4FTF A;  4L4Q A;  2D28 C;  1ML8 A;  5BSR A;  2QVY X;  3IEU A;  4BCA A;  4RLF A;  1O93 A;  1PG4 A;  2DPL A;  1MDB A;  5T8S A;  1AMU A;  4JI2 C;  3GKU A;  1HNW C;  2P2F A;  4GXQ A;  4FUQ A;  5BUS A;  1N32 C;  4GS5 A;  4L7I A;  3C5E A;  4OX9 C;  2QL8 A;  1J5E C;  4IR7 A;  1MXB A;  4PZP A;  3L8C A;  4DR5 C;  1FJG C;  3T1Y C;  2HJG A;  4K0K C;  1XMO C;  4LF9 C;  3VNQ A;  4KHP C;  2D7V A;  4LFB C;  2DYJ A;  2PT7 G;  1N34 C;  5AE1 A;  5BR8 C;  1WF3 A;  2VSQ A;  5BUQ A;  2PN2 A;  2EGT A;  2P2B A;  1MD9 A;  4X64 C;  1UKK A;  1T5D X;  3CW9 A;  3FCE A;  5JRH A;  5T8T A;  2UXC C;  5ADZ A;  4X65 C;  5LMN C;  1USP B;  1VLA A;  4LE5 A;  4JI3 C;  4X62 C;  4BBY A;  2P2M A;  2E8C A;  1O9T A;  1MXA A;  4ISB A;  2VQE C;  2WD9 A;  2V7B A;  3NI2 A;  3TUF A;  4JI0 C;  3OTO C;  1IBK C;  1LCI A;  1V26 A;  4RVO A;  3S82 A;  1K0R A;  3IPL A;  2UU9 C;  2E0G A;  2ASB A;  1KKG A;  4MH4 A;  3RG2 A;  4NDN A;  4DV6 C;  4LF5 C;  5E7Q A;  5AE3 A;  1XNR C;  2ZM6 C;  3B7W A;  4D4I A;  1N33 C;  1O92 A;  2E5L C;  4GKK C;  3N2Q A;  4DR7 C;  2QVZ X;  2D1T A;  4ZJZ A;  5AE2 A;  1XRA A;  4JI4 C;  4DCU A;  4OYC A;  5KYT A;  4DR2 C;  2OPL B;  4DV0 C;  4X66 C;  3DLP X;  3T1H C;  2VZE A;  3CW8 X;  5KEI A;  4ODJ A;  1XMQ C;  5BSW A;  4DR3 C;  3EER A;  4I9G A;  1ZB9 A;  4KTT A;  2P2J A;  4LF4 C;  4FUT A;  4HPV A;  5CZX A;  4R1M A;  1WH9 A;  3A4I A;  4DR1 C;  4DV2 C;  5LMU C;  3KXW A;  1JOS A;  4DG8 A;  3LAX A;  5BUR A;  4DUY C;  4U5Y D;  4GXR A;  3UOW A;  5H9U A;  4NXM C;  3NYR A;  3DHV A;  3VNS A;  3R9X A;  1XNQ C;  4DCS A;  5KYV A;  4B3T C;  1ULT A;  4G1I A;  3RV2 A;  4DV3 C;  2E7G A;  3L95 X;  2WP0 C;  2HHH C;  2F4V C;  4BSZ A;  2UXD C;  2P02 A;  2UUC C;  3E7X A;  1N36 C;  4DV5 C;  1NYE A;  3R9W A;  3JAM D;  3H2T A;  2D1R A;  1MKY A;  2D1S A;  2ONF A;  2UUA C;  4PRO C;  4LFA C;  5GTD A;  4YHH C;  5IFI A;  2P2Q A;  4WS9 A;  4KTV A;  1XRC A;  3FCC A;  1FUG A;  3TQI A;  4DV1 C;  3N54 B;  5K8F A;  3NYQ A;  1USP A;  4I9F A;  1O90 A;  3G7S A;  1XRB A;  4PHT A;  3ETC A;  3GPC A;  4R1L A;  3LNV A;  4RVN A;  4DCV A;  2BJO A;  1RG9 A;  5A19 A;  3J7A D;  1HNZ C;  1V25 A;  3NPD A;  4D4G A;  2VQF C;  1IBM C;  3VNR A;  2UXB C;  3UZ0 A;  3DAY A;  2P20 A;  4JI5 C;  1EGA A;  4JI1 C;  3PRO C;  1BA3 A;  5IWA C;  4L2Z A;  1HR0 C;  3E7W A;  3AF6 A;  1YJ7 A;  4GKJ C;  5IT9 D;  2OO4 A;  1RY2 A;  2QVX X;  4JM1 A;  3I08 A;  4LF6 C;  4NXN C;  4JI7 C;  3A9V A;  5CZV A;  1QWI A;  2QW0 X;  3PBK A;  5K85 A;  3IML A;  2JMP A;  3J81 D;  4B3R C;  2OPL A;  4G36 A;  3I07 A;  2BH1 X;  2CY1 A;  2Y4N A;  2CXC A;  5DV9 A;  4BC7 A;  4JYA C;  2OBV A;  3LGX A;  1MXC A;  4JV5 C;  4JI6 C;  4DV4 C;  4DUZ C;  3EQ6 A;  4K0B A;  4NOZ A;  3SO4 A;  3PES A;  3GR1 A;  4DG9 A;  1P7L A;  5A2Q D;  2UUB C;  1IBL C;  5BSU A;  1MDF A;  4TPS B;  2Y4O A;  2XR1 A;  5BST A;  4LF7 C;  2Y27 A;  4D56 A;  4RM3 A;  5BSV A;  4BC9 A;  1N2F A;  3ETO A;  3CJE A;  2ATW A;  4DR4 C;  3LUS A;  2YWB A;  2YCB A;  4RLQ A;  4EAT A;  4B3M C;  4XX2 A;  4YY3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...