1IBMC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibmC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibmC02
5IT9D 4B3MC 3AF5A 4DUYC 4JI5C 4DV1C 4JI6C 2E7GA 4BSZA 1HNXC 3T1YC 4DUZC 5LMUC 4LF5C 4X66C 4YHHC 4JI4C 2UUBC 2ZM6C 3J81D 1QWIA 1IBLC 4NXMC 2OPLA 2ONFA 4X62C 1N34C 4X64C 1UKKA 3AF6A 3LUSA 1JOSA 1VLAA 4DV4C 4X65C 4JI1C 4DCUA 4JI2C 3CJEA 1WF3A 1N36C 4LF4C 1LQLA 4MH4A 4DCVA 4B3TC 2QL8A 4LFAC 2F4VC 1NYEA 2UXCC 2YCBA 1XMOC 4DV5C 1ML8A 1ZB9A 2VQFC 2PT7G 4LF7C 4JI0C 1K0RA 4JV5C 1ZB8A 3JAMD 4LF8C 4XX2A 1N33C 1XNRC 4DCSA 2UUAC 4KHPC 1PA4A 3OTOC 1I94C 4JI7C 1N2FA 1WH9A 4DV3C 4K0KC 1XMQC 4MTNA 3IEUA 4AQYC 4DR1C 4YY3C 2UXDC 3J80D 3EERA 4B3RC 2XR1A 4GKKC 2VQEC 2ATWA 1L2FA 4DR5C 3T1HC 4DV0C 4DCTA 4DR7C 4DV2C 1FJGC 4JI8C 2E8FA 1KKGA 1USPB 2HJGA 4LFBC 5LMNC 2EGTA 5FLXD 4LF9C 2UXBC 4LF6C 2DYJA 1J5EC 1HR0C 2CY1A 4B3SC 4DR6C 4DR2C 2UUCC 4NXNC 2D7VA 4DR3C 5A2QD 1MKYA 1IBMC 1HNWC 1HNZC 1N32C 2E5LC 1USPA 4OX9C 2KZFA 3R9WA 2BJOA 2HHHC 2E8EA 3GKUA 1XNQC 1HH2P 2PN2A 3I07A 3IEVA 4GKJC 5IWAC 1IBKC 5BR8C 2E8CA 1EGAA 4NOZA 3J7AD 4DV7C 4LFCC 3R9XA 4DR4C 2OPLB 2JMPA 2CXCA 4JYAC 2UU9C 2ASBA 4JI3C 4DV6C
chains in the Genus database with same CATH superfamily
2KDNA 5IT9D 3RG2A 1V26A 5T8TA 4BSZA 1BA3A 1O90A 1TH5A 2M5OA 3A25A 3UZ0A 4GXQA 3UX3A 1FLOA 4PROC 1IBLC 3B7WA 4NXMC 2OPLA 1N34C 1MXAA 3N54B 4X64C 2YX1A 4PUIA 1JOSA 4DV4C 3NI2A 4JI1C 3E7WA 4LF4C 1LQLA 4MH4A 2MM9A 3SO4A 2YCBA 2VQFC 5KYVA 3GR0A 4I9GA 3DHVA 3ETOA 2M5HA 4JV5C 1ZB8A 1O92A 4XX2A 1N33C 4RLQA 1ULTA 1WCJA 2UUAC 4IR7A 3L95X 4RM2A 3A9UA 5BUSA 3FCCA 1N2FA 3UEBA 3IPLA 2Y4OA 1XMQC 4R1MA 2D1QA 2D1RA 3EERA 5AE3A 1V25A 3LNOA 3S82A 2ATWA 4DR5C 2DPLA 4DCTA 4DR7C 4ODJA 3A9VA 2DYJA 2CY1A 4RM3A 3TDEA 3PROC 4DR6C 4DR2C 2D7VA 2E0GA 4DR3C 5H9UA 2DHMA 1HNZC 2QVXX 5KYTA 3R9WA 3TQIA 2PN2A 3I07A 2YWBA 5LCIA 4WV3A 3K6RA 3VNQA 1IBKC 5BR8C 2E8CA 3CQ3A 5K85A 5ADZA 2WP0C 3J7AD 3EQ6A 5BSTA 4DR4C 4IZ6A 2OPLB 4L7IA 3LNVA 2CXCA 1KKGA 4JI3C 3CQ1A 4U5YD 4DG9A 4B3MC 1YJ7A 2D1TA 4DUYC 5E7QA 4JI6C 2E7GA 4LE5A 5LMUC 4LF5C 4JI4C 2UUBC 2ZM6C 1MDFA 2ONFA 4X62C 2P2QA 1GPMA 4DCUA 4FUQA 3CJEA 1WF3A 5KEIA 2AYAA 4RVNA 4B3TC 4RLFA 4ISBA 2UXCC 1XMOC 1ML8A 1ZB9A 2Z51A 1V60A 4G36A 1K0RA 4LF8C 3E7XA 2D28C 2P2BA 1MXBA 1XNRC 1PA4A 1QM4A 1AMUA 1WH9A 2OO4A 4I9FA 5AE1A 3IEUA 4MTNA 4YY3C 2D27A 2VQEC 4BBYA 3IMLA 1M6XA 3N2QA 1FJGC 4JI8C 2HJGA 4LFBC 3LAXA 1RG9A 3KXWA 4LF6C 1MDBA 4D4GA 4PHTA 2UUCC 4D4IA 3C5EA 4D56A 1MKYA 5A19A 2P2JA 5AE2A 1HNWC 3AY0A 4FTFA 1N32C 5BURA 1USPA 2BJOA 2HHHC 3GKUA 4GKJC 4BC7A 4D57A 4L4QA 3R44A 3FCEA 4WS9A 4LFCC 3CQ2A 4R0MA 3A4IA 2P02A 2VSQA 4PZPA 4OYCA 3GPCA 2ASBA 4DV6C 3AF5A 2JNVA 2PG1E 4RVOA 1HNXC 4K0BA 4DUZC 3TUFA 3I08A 4X66C 4YHHC 5IFIA 5BSRA 1MXCA 1UKKA 4BC9A 3LUSA 1FUGA 4X65C 3TR3A 1N36C 4BCAA 4ZLPA 4LFAC 5CZVA 2ZZMA 2F4VC 1NYEA 2Y4NA 1XDXA 1LCIA 4DV5C 2VZEA 2P2MA 2PT7G 4HPVA 2P20A 5A1GA 2ZZNA 4JI0C 2KZ0A 1PU1A 4L2ZA 1I94C 4JI7C 4DV3C 2UXDC 4PUGA 4ZJZA 3J80D 4B3RC 1M6XC 1L2FA 3T1HC 4DV0C 4DV2C 1MD9A 2QVZX 3VNRA 1T5DX 1USPB 3FM7A 5LMNC 2YWCA 4LF9C 5GTDA 1J5EC 4B3SC 4JM1A 4RMNA 4FUTA 5K8FA 5A2QD 1NY8A 2E5LC 5T8SA 4OX9C 3UOWA 2E8EA 1XNQC 5IWAC 1EGAA 4NOZA 5BSVA 3CW8X 2QW0X 4TPSB 5DV9A 4DV7C 1P4EA 2V7BA 4JYAC 2UU9C 4G37A 4JI5C 4DV1C 1XHJA 1YGTA 3CW9A 1XS3A 5BSMA 3T1YC 1PG4A 1XRAA 4EATA 3NYRA 5BSWA 3PBKA 2OBVA 3J81D 1QWIA 3ETCA 1O9TA 3AF6A 1T5HX 1VLAA 4KTTA 4JI2C 3O2EA 1VEHA 4KTVA 5A1IA 2Y27A 4DCVA 2QL8A 3NPDA 2ZTBA 3DAYA 2QVYX 4LF7C 2MMAB 2P2FA 3JAMD 2NCLA 3UX2A 5JRHA 3A26A 4DCSA 3OTOC 1P7LA 3H2TA 4K0KC 1RY2A 3VNSA 4AQYC 4DR1C 2CU6A 4OXIA 4R1LA 2XR1A 5BSUA 4GKKC 1IB8A 3GR1A 2D1SA 2E8FA 2EGTA 4PUHA 5FLXD 2MCQA 3LGXA 2UXBC 1UWDA 1HR0C 3RV2A 4DG8A 4NXNC 5BUQA 1PG3A 3G7SA 1IBMC 4GXRA 2PROA 3NYQA 2KZFA 4G1IA 4NDNA 1HH2P 1O93A 3IEVA 4GS5A 3L8CA 1XRCA 1P4EC 1XRBA 2BH1X 2WD9A 3R9XA 5CZXA 3DLPX 2JMPA 4KHPC 3PESA
chains in the Genus database with same CATH topology
5IT9D 3RG2A 1V26A 5T8TA 4BSZA 1BA3A 1O90A 3UZ0A 4GXQA 4PROC 1IBLC 3B7WA 4NXMC 2OPLA 1N34C 1MXAA 3N54B 4X64C 1JOSA 4DV4C 3NI2A 4JI1C 3E7WA 4LF4C 1LQLA 4MH4A 3SO4A 2YCBA 2VQFC 5KYVA 3GR0A 4I9GA 3DHVA 3ETOA 4JV5C 1ZB8A 1O92A 4XX2A 1N33C 4RLQA 1ULTA 2UUAC 4IR7A 3L95X 4RM2A 3A9UA 5BUSA 3FCCA 1N2FA 3IPLA 2Y4OA 1XMQC 4R1MA 2D1QA 2D1RA 3EERA 5AE3A 1V25A 3S82A 2ATWA 4DR5C 2DPLA 4DCTA 4DR7C 4ODJA 3A9VA 2DYJA 2CY1A 4RM3A 3TDEA 3PROC 4DR6C 4DR2C 2D7VA 2E0GA 4DR3C 5H9UA 1HNZC 2QVXX 5KYTA 3R9WA 3TQIA 2PN2A 3I07A 2YWBA 4WV3A 3VNQA 1IBKC 5BR8C 2E8CA 5K85A 5ADZA 2WP0C 3J7AD 3EQ6A 5BSTA 4DR4C 4IZ6A 2OPLB 4L7IA 3LNVA 2CXCA 1KKGA 4JI3C 4U5YD 4DG9A 4B3MC 1YJ7A 2D1TA 4DUYC 5E7QA 4JI6C 2E7GA 4LE5A 5LMUC 4LF5C 4JI4C 2UUBC 2ZM6C 1MDFA 2ONFA 4X62C 2P2QA 1GPMA 4DCUA 4FUQA 3CJEA 1WF3A 5KEIA 2AYAA 4RVNA 4B3TC 4RLFA 4ISBA 2UXCC 1XMOC 1ML8A 1ZB9A 4G36A 1K0RA 4LF8C 3E7XA 2D28C 2P2BA 1MXBA 1XNRC 1PA4A 1QM4A 1AMUA 1WH9A 2OO4A 4I9FA 5AE1A 3IEUA 4MTNA 4YY3C 2D27A 2VQEC 4BBYA 3IMLA 3N2QA 1FJGC 4JI8C 2HJGA 4LFBC 3LAXA 1RG9A 3KXWA 4LF6C 1MDBA 4D4GA 4PHTA 2UUCC 4D4IA 3C5EA 4D56A 1MKYA 5A19A 2P2JA 5AE2A 1HNWC 4FTFA 1N32C 5BURA 1USPA 2BJOA 2HHHC 3GKUA 4GKJC 4BC7A 4D57A 4L4QA 3R44A 3FCEA 4WS9A 4LFCC 4R0MA 3A4IA 2P02A 2VSQA 4PZPA 4OYCA 3GPCA 2ASBA 4DV6C 3AF5A 4RVOA 1HNXC 4K0BA 4DUZC 3TUFA 3I08A 4X66C 4YHHC 5IFIA 5BSRA 1MXCA 1UKKA 4BC9A 3LUSA 1FUGA 4X65C 1N36C 4BCAA 4ZLPA 4LFAC 5CZVA 2F4VC 1NYEA 2Y4NA 1LCIA 4DV5C 2VZEA 2P2MA 2PT7G 4HPVA 2P20A 5A1GA 4JI0C 4L2ZA 1I94C 4JI7C 4DV3C 2UXDC 4ZJZA 3J80D 4B3RC 1L2FA 3T1HC 4DV0C 4DV2C 1MD9A 2QVZX 3VNRA 1T5DX 1USPB 5LMNC 2YWCA 4LF9C 5GTDA 1J5EC 4B3SC 4JM1A 4RMNA 4FUTA 5K8FA 5A2QD 2E5LC 5T8SA 4OX9C 3UOWA 2E8EA 1XNQC 5IWAC 1EGAA 4NOZA 5BSVA 3CW8X 2QW0X 4TPSB 5DV9A 4DV7C 2V7BA 4JYAC 2UU9C 4G37A 4JI5C 4DV1C 3CW9A 5BSMA 3T1YC 1PG4A 1XRAA 4EATA 3NYRA 5BSWA 3PBKA 2OBVA 3J81D 1QWIA 3ETCA 1O9TA 3AF6A 1T5HX 1VLAA 4KTTA 4JI2C 4KTVA 5A1IA 2Y27A 4DCVA 2QL8A 3NPDA 3DAYA 2QVYX 4LF7C 2P2FA 3JAMD 5JRHA 4DCSA 3OTOC 1P7LA 3H2TA 4K0KC 1RY2A 3VNSA 4AQYC 4DR1C 4OXIA 4R1LA 2XR1A 5BSUA 4GKKC 3GR1A 2D1SA 2E8FA 2EGTA 5FLXD 2UXBC 3LGXA 1HR0C 3RV2A 4DG8A 4NXNC 5BUQA 1PG3A 3G7SA 1IBMC 4GXRA 2PROA 3NYQA 2KZFA 4G1IA 4NDNA 1HH2P 1O93A 3IEVA 4GS5A 3L8CA 1XRCA 1XRBA 2BH1X 2WD9A 3R9XA 5CZXA 3DLPX 2JMPA 4KHPC 3PESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 D;  4B3M C;  3AF5 A;  4DUY C;  4JI5 C;  4DV1 C;  4JI6 C;  2E7G A;  4BSZ A;  1HNX C;  3T1Y C;  4DUZ C;  5LMU C;  4LF5 C;  4X66 C;  4YHH C;  4JI4 C;  2UUB C;  2ZM6 C;  3J81 D;  1QWI A;  1IBL C;  4NXM C;  2OPL A;  2ONF A;  4X62 C;  1N34 C;  4X64 C;  1UKK A;  3AF6 A;  3LUS A;  1JOS A;  1VLA A;  4DV4 C;  4X65 C;  4JI1 C;  4DCU A;  4JI2 C;  3CJE A;  1WF3 A;  1N36 C;  4LF4 C;  1LQL A;  4MH4 A;  4DCV A;  4B3T C;  2QL8 A;  4LFA C;  2F4V C;  1NYE A;  2UXC C;  2YCB A;  1XMO C;  4DV5 C;  1ML8 A;  1ZB9 A;  2VQF C;  2PT7 G;  4LF7 C;  4JI0 C;  1K0R A;  4JV5 C;  1ZB8 A;  3JAM D;  4LF8 C;  4XX2 A;  1N33 C;  1XNR C;  4DCS A;  2UUA C;  4KHP C;  1PA4 A;  3OTO C;  1I94 C;  4JI7 C;  1N2F A;  1WH9 A;  4DV3 C;  4K0K C;  1XMQ C;  4MTN A;  3IEU A;  4AQY C;  4DR1 C;  4YY3 C;  2UXD C;  3J80 D;  3EER A;  4B3R C;  2XR1 A;  4GKK C;  2VQE C;  2ATW A;  1L2F A;  4DR5 C;  3T1H C;  4DV0 C;  4DCT A;  4DR7 C;  4DV2 C;  1FJG C;  4JI8 C;  2E8F A;  1KKG A;  1USP B;  2HJG A;  4LFB C;  5LMN C;  2EGT A;  5FLX D;  4LF9 C;  2UXB C;  4LF6 C;  2DYJ A;  1J5E C;  1HR0 C;  2CY1 A;  4B3S C;  4DR6 C;  4DR2 C;  2UUC C;  4NXN C;  2D7V A;  4DR3 C;  5A2Q D;  1MKY A;  1IBM C;  1HNW C;  1HNZ C;  1N32 C;  2E5L C;  1USP A;  4OX9 C;  2KZF A;  3R9W A;  2BJO A;  2HHH C;  2E8E A;  3GKU A;  1XNQ C;  1HH2 P;  2PN2 A;  3I07 A;  3IEV A;  4GKJ C;  5IWA C;  1IBK C;  5BR8 C;  2E8C A;  1EGA A;  4NOZ A;  3J7A D;  4DV7 C;  4LFC C;  3R9X A;  4DR4 C;  2OPL B;  2JMP A;  2CXC A;  4JYA C;  2UU9 C;  2ASB A;  4JI3 C;  4DV6 C; 
#chains in the Genus database with same CATH topology
 2KDN A;  5IT9 D;  3RG2 A;  1V26 A;  5T8T A;  4BSZ A;  1BA3 A;  1O90 A;  1TH5 A;  2M5O A;  3A25 A;  3UZ0 A;  4GXQ A;  3UX3 A;  1FLO A;  4PRO C;  1IBL C;  3B7W A;  4NXM C;  2OPL A;  1N34 C;  1MXA A;  3N54 B;  4X64 C;  2YX1 A;  4PUI A;  1JOS A;  4DV4 C;  3NI2 A;  4JI1 C;  3E7W A;  4LF4 C;  1LQL A;  4MH4 A;  2MM9 A;  3SO4 A;  2YCB A;  2VQF C;  5KYV A;  3GR0 A;  4I9G A;  3DHV A;  3ETO A;  2M5H A;  4JV5 C;  1ZB8 A;  1O92 A;  4XX2 A;  1N33 C;  4RLQ A;  1ULT A;  1WCJ A;  2UUA C;  4IR7 A;  3L95 X;  4RM2 A;  3A9U A;  5BUS A;  3FCC A;  1N2F A;  3UEB A;  3IPL A;  2Y4O A;  1XMQ C;  4R1M A;  2D1Q A;  2D1R A;  3EER A;  5AE3 A;  1V25 A;  3LNO A;  3S82 A;  2ATW A;  4DR5 C;  2DPL A;  4DCT A;  4DR7 C;  4ODJ A;  3A9V A;  2DYJ A;  2CY1 A;  4RM3 A;  3TDE A;  3PRO C;  4DR6 C;  4DR2 C;  2D7V A;  2E0G A;  4DR3 C;  5H9U A;  2DHM A;  1HNZ C;  2QVX X;  5KYT A;  3R9W A;  3TQI A;  2PN2 A;  3I07 A;  2YWB A;  5LCI A;  4WV3 A;  3K6R A;  3VNQ A;  1IBK C;  5BR8 C;  2E8C A;  3CQ3 A;  5K85 A;  5ADZ A;  2WP0 C;  3J7A D;  3EQ6 A;  5BST A;  4DR4 C;  4IZ6 A;  2OPL B;  4L7I A;  3LNV A;  2CXC A;  1KKG A;  4JI3 C;  3CQ1 A;  4U5Y D;  4DG9 A;  4B3M C;  1YJ7 A;  2D1T A;  4DUY C;  5E7Q A;  4JI6 C;  2E7G A;  4LE5 A;  5LMU C;  4LF5 C;  4JI4 C;  2UUB C;  2ZM6 C;  1MDF A;  2ONF A;  4X62 C;  2P2Q A;  1GPM A;  4DCU A;  4FUQ A;  3CJE A;  1WF3 A;  5KEI A;  2AYA A;  4RVN A;  4B3T C;  4RLF A;  4ISB A;  2UXC C;  1XMO C;  1ML8 A;  1ZB9 A;  2Z51 A;  1V60 A;  4G36 A;  1K0R A;  4LF8 C;  3E7X A;  2D28 C;  2P2B A;  1MXB A;  1XNR C;  1PA4 A;  1QM4 A;  1AMU A;  1WH9 A;  2OO4 A;  4I9F A;  5AE1 A;  3IEU A;  4MTN A;  4YY3 C;  2D27 A;  2VQE C;  4BBY A;  3IML A;  1M6X A;  3N2Q A;  1FJG C;  4JI8 C;  2HJG A;  4LFB C;  3LAX A;  1RG9 A;  3KXW A;  4LF6 C;  1MDB A;  4D4G A;  4PHT A;  2UUC C;  4D4I A;  3C5E A;  4D56 A;  1MKY A;  5A19 A;  2P2J A;  5AE2 A;  1HNW C;  3AY0 A;  4FTF A;  1N32 C;  5BUR A;  1USP A;  2BJO A;  2HHH C;  3GKU A;  4GKJ C;  4BC7 A;  4D57 A;  4L4Q A;  3R44 A;  3FCE A;  4WS9 A;  4LFC C;  3CQ2 A;  4R0M A;  3A4I A;  2P02 A;  2VSQ A;  4PZP A;  4OYC A;  3GPC A;  2ASB A;  4DV6 C;  3AF5 A;  2JNV A;  2PG1 E;  4RVO A;  1HNX C;  4K0B A;  4DUZ C;  3TUF A;  3I08 A;  4X66 C;  4YHH C;  5IFI A;  5BSR A;  1MXC A;  1UKK A;  4BC9 A;  3LUS A;  1FUG A;  4X65 C;  3TR3 A;  1N36 C;  4BCA A;  4ZLP A;  4LFA C;  5CZV A;  2ZZM A;  2F4V C;  1NYE A;  2Y4N A;  1XDX A;  1LCI A;  4DV5 C;  2VZE A;  2P2M A;  2PT7 G;  4HPV A;  2P20 A;  5A1G A;  2ZZN A;  4JI0 C;  2KZ0 A;  1PU1 A;  4L2Z A;  1I94 C;  4JI7 C;  4DV3 C;  2UXD C;  4PUG A;  4ZJZ A;  3J80 D;  4B3R C;  1M6X C;  1L2F A;  3T1H C;  4DV0 C;  4DV2 C;  1MD9 A;  2QVZ X;  3VNR A;  1T5D X;  1USP B;  3FM7 A;  5LMN C;  2YWC A;  4LF9 C;  5GTD A;  1J5E C;  4B3S C;  4JM1 A;  4RMN A;  4FUT A;  5K8F A;  5A2Q D;  1NY8 A;  2E5L C;  5T8S A;  4OX9 C;  3UOW A;  2E8E A;  1XNQ C;  5IWA C;  1EGA A;  4NOZ A;  5BSV A;  3CW8 X;  2QW0 X;  4TPS B;  5DV9 A;  4DV7 C;  1P4E A;  2V7B A;  4JYA C;  2UU9 C;  4G37 A;  4JI5 C;  4DV1 C;  1XHJ A;  1YGT A;  3CW9 A;  1XS3 A;  5BSM A;  3T1Y C;  1PG4 A;  1XRA A;  4EAT A;  3NYR A;  5BSW A;  3PBK A;  2OBV A;  3J81 D;  1QWI A;  3ETC A;  1O9T A;  3AF6 A;  1T5H X;  1VLA A;  4KTT A;  4JI2 C;  3O2E A;  1VEH A;  4KTV A;  5A1I A;  2Y27 A;  4DCV A;  2QL8 A;  3NPD A;  2ZTB A;  3DAY A;  2QVY X;  4LF7 C;  2MMA B;  2P2F A;  3JAM D;  2NCL A;  3UX2 A;  5JRH A;  3A26 A;  4DCS A;  3OTO C;  1P7L A;  3H2T A;  4K0K C;  1RY2 A;  3VNS A;  4AQY C;  4DR1 C;  2CU6 A;  4OXI A;  4R1L A;  2XR1 A;  5BSU A;  4GKK C;  1IB8 A;  3GR1 A;  2D1S A;  2E8F A;  2EGT A;  4PUH A;  5FLX D;  2MCQ A;  3LGX A;  2UXB C;  1UWD A;  1HR0 C;  3RV2 A;  4DG8 A;  4NXN C;  5BUQ A;  1PG3 A;  3G7S A;  1IBM C;  4GXR A;  2PRO A;  3NYQ A;  2KZF A;  4G1I A;  4NDN A;  1HH2 P;  1O93 A;  3IEV A;  4GS5 A;  3L8C A;  1XRC A;  1P4E C;  1XRB A;  2BH1 X;  2WD9 A;  3R9X A;  5CZX A;  3DLP X;  2JMP A;  4KHP C;  3PES A; 
#chains in the Genus database with same CATH homology
 5IT9 D;  3RG2 A;  1V26 A;  5T8T A;  4BSZ A;  1BA3 A;  1O90 A;  3UZ0 A;  4GXQ A;  4PRO C;  1IBL C;  3B7W A;  4NXM C;  2OPL A;  1N34 C;  1MXA A;  3N54 B;  4X64 C;  1JOS A;  4DV4 C;  3NI2 A;  4JI1 C;  3E7W A;  4LF4 C;  1LQL A;  4MH4 A;  3SO4 A;  2YCB A;  2VQF C;  5KYV A;  3GR0 A;  4I9G A;  3DHV A;  3ETO A;  4JV5 C;  1ZB8 A;  1O92 A;  4XX2 A;  1N33 C;  4RLQ A;  1ULT A;  2UUA C;  4IR7 A;  3L95 X;  4RM2 A;  3A9U A;  5BUS A;  3FCC A;  1N2F A;  3IPL A;  2Y4O A;  1XMQ C;  4R1M A;  2D1Q A;  2D1R A;  3EER A;  5AE3 A;  1V25 A;  3S82 A;  2ATW A;  4DR5 C;  2DPL A;  4DCT A;  4DR7 C;  4ODJ A;  3A9V A;  2DYJ A;  2CY1 A;  4RM3 A;  3TDE A;  3PRO C;  4DR6 C;  4DR2 C;  2D7V A;  2E0G A;  4DR3 C;  5H9U A;  1HNZ C;  2QVX X;  5KYT A;  3R9W A;  3TQI A;  2PN2 A;  3I07 A;  2YWB A;  4WV3 A;  3VNQ A;  1IBK C;  5BR8 C;  2E8C A;  5K85 A;  5ADZ A;  2WP0 C;  3J7A D;  3EQ6 A;  5BST A;  4DR4 C;  4IZ6 A;  2OPL B;  4L7I A;  3LNV A;  2CXC A;  1KKG A;  4JI3 C;  4U5Y D;  4DG9 A;  4B3M C;  1YJ7 A;  2D1T A;  4DUY C;  5E7Q A;  4JI6 C;  2E7G A;  4LE5 A;  5LMU C;  4LF5 C;  4JI4 C;  2UUB C;  2ZM6 C;  1MDF A;  2ONF A;  4X62 C;  2P2Q A;  1GPM A;  4DCU A;  4FUQ A;  3CJE A;  1WF3 A;  5KEI A;  2AYA A;  4RVN A;  4B3T C;  4RLF A;  4ISB A;  2UXC C;  1XMO C;  1ML8 A;  1ZB9 A;  4G36 A;  1K0R A;  4LF8 C;  3E7X A;  2D28 C;  2P2B A;  1MXB A;  1XNR C;  1PA4 A;  1QM4 A;  1AMU A;  1WH9 A;  2OO4 A;  4I9F A;  5AE1 A;  3IEU A;  4MTN A;  4YY3 C;  2D27 A;  2VQE C;  4BBY A;  3IML A;  3N2Q A;  1FJG C;  4JI8 C;  2HJG A;  4LFB C;  3LAX A;  1RG9 A;  3KXW A;  4LF6 C;  1MDB A;  4D4G A;  4PHT A;  2UUC C;  4D4I A;  3C5E A;  4D56 A;  1MKY A;  5A19 A;  2P2J A;  5AE2 A;  1HNW C;  4FTF A;  1N32 C;  5BUR A;  1USP A;  2BJO A;  2HHH C;  3GKU A;  4GKJ C;  4BC7 A;  4D57 A;  4L4Q A;  3R44 A;  3FCE A;  4WS9 A;  4LFC C;  4R0M A;  3A4I A;  2P02 A;  2VSQ A;  4PZP A;  4OYC A;  3GPC A;  2ASB A;  4DV6 C;  3AF5 A;  4RVO A;  1HNX C;  4K0B A;  4DUZ C;  3TUF A;  3I08 A;  4X66 C;  4YHH C;  5IFI A;  5BSR A;  1MXC A;  1UKK A;  4BC9 A;  3LUS A;  1FUG A;  4X65 C;  1N36 C;  4BCA A;  4ZLP A;  4LFA C;  5CZV A;  2F4V C;  1NYE A;  2Y4N A;  1LCI A;  4DV5 C;  2VZE A;  2P2M A;  2PT7 G;  4HPV A;  2P20 A;  5A1G A;  4JI0 C;  4L2Z A;  1I94 C;  4JI7 C;  4DV3 C;  2UXD C;  4ZJZ A;  3J80 D;  4B3R C;  1L2F A;  3T1H C;  4DV0 C;  4DV2 C;  1MD9 A;  2QVZ X;  3VNR A;  1T5D X;  1USP B;  5LMN C;  2YWC A;  4LF9 C;  5GTD A;  1J5E C;  4B3S C;  4JM1 A;  4RMN A;  4FUT A;  5K8F A;  5A2Q D;  2E5L C;  5T8S A;  4OX9 C;  3UOW A;  2E8E A;  1XNQ C;  5IWA C;  1EGA A;  4NOZ A;  5BSV A;  3CW8 X;  2QW0 X;  4TPS B;  5DV9 A;  4DV7 C;  2V7B A;  4JYA C;  2UU9 C;  4G37 A;  4JI5 C;  4DV1 C;  3CW9 A;  5BSM A;  3T1Y C;  1PG4 A;  1XRA A;  4EAT A;  3NYR A;  5BSW A;  3PBK A;  2OBV A;  3J81 D;  1QWI A;  3ETC A;  1O9T A;  3AF6 A;  1T5H X;  1VLA A;  4KTT A;  4JI2 C;  4KTV A;  5A1I A;  2Y27 A;  4DCV A;  2QL8 A;  3NPD A;  3DAY A;  2QVY X;  4LF7 C;  2P2F A;  3JAM D;  5JRH A;  4DCS A;  3OTO C;  1P7L A;  3H2T A;  4K0K C;  1RY2 A;  3VNS A;  4AQY C;  4DR1 C;  4OXI A;  4R1L A;  2XR1 A;  5BSU A;  4GKK C;  3GR1 A;  2D1S A;  2E8F A;  2EGT A;  5FLX D;  2UXB C;  3LGX A;  1HR0 C;  3RV2 A;  4DG8 A;  4NXN C;  5BUQ A;  1PG3 A;  3G7S A;  1IBM C;  4GXR A;  2PRO A;  3NYQ A;  2KZF A;  4G1I A;  4NDN A;  1HH2 P;  1O93 A;  3IEV A;  4GS5 A;  3L8C A;  1XRC A;  1XRB A;  2BH1 X;  2WD9 A;  3R9X A;  5CZX A;  3DLP X;  2JMP A;  4KHP C;  3PES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...