1IBMC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ibmC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1ibmC02
3GKUA 1HNZC 3R9XA 3LUSA 1WF3A 2XR1A 4GKKC 4B3TC 3AF5A 2ATWA 1HNWC 1JOSA 4JYAC 4DCTA 2E5LC 2ONFA 2E8EA 4DR7C 4YY3C 1N34C 2E8FA 3T1YC 4DR3C 1N36C 4GKJC 4LFCC 3JAMD 1ML8A 4OX9C 2UUBC 4LF9C 4YHHC 5IT9D 3J7AD 4JI4C 4JI7C 4B3SC 1NYEA 1I94C 1WH9A 4K0KC 4JI5C 4DCUA 1HNXC 5LMNC 4JI6C 1HH2P 4DUZC 1J5EC 4LFAC 2EGTA 4NXNC 1ZB8A 4AQYC 4DV7C 1QWIA 4X65C 1IBKC 1UKKA 3J80D 2YCBA 3EERA 4DV6C 2UU9C 4XX2A 4B3RC 1USPB 1HR0C 4X66C 1IBLC 1ZB9A 4LF6C 4X64C 4JI0C 4LF7C 2VQFC 2UXBC 3CJEA 2DYJA 1MKYA 4DR5C 2HHHC 4DCVA 2UUCC 5A2QD 1XNRC 4LFBC 3R9WA 1USPA 2BJOA 4DV5C 2CXCA 4B3MC 2JMPA 4DUYC 1KKGA 3T1HC 1IBMC 2OPLB 4DR2C 4DV3C 1XMOC 3IEVA 2UXDC 4DR6C 4NXMC 1XNQC 2HJGA 4DV2C 4DR4C 4LF5C 1FJGC 2QL8A 2VQEC 4DCSA 4DV4C 3OTOC 4JI2C 2OPLA 4JV5C 1L2FA 4MTNA 4X62C 2ZM6C 3J81D 4JI1C 4JI8C 1N33C 4JI3C 1N32C 5BR8C 2KZFA 1XMQC 2UXCC 2UUAC 4NOZA 4KHPC 5LMUC 5IWAC 1N2FA 1LQLA 1EGAA 4DV1C 4DR1C 2PN2A 3IEUA 2E8CA 2CY1A 1VLAA 4DV0C 4MH4A 5FLXD 1K0RA 4LF8C 2F4VC 2ASBA 3I07A 1PA4A 4BSZA 4LF4C 2D7VA 2E7GA 2PT7G 3AF6A
chains in the Genus database with same CATH superfamily
2YX1A 2WD9A 5E7QA 1WF3A 2XR1A 3H2TA 3AF5A 1HNWC 1MXBA 4DR7C 4YY3C 1N34C 2NCLA 1T5DX 2JNVA 4L7IA 4BC7A 1PU1A 2QVXX 1ML8A 4OX9C 2P2QA 4BBYA 4JI7C 2P2BA 4DCUA 4FTFA 1MDBA 4LFAC 4NXNC 4PROC 4FUQA 4GXQA 2ZTBA 2BH1X 3EERA 4DV6C 4XX2A 2DPLA 2PG1E 5BURA 3A9UA 3CW9A 1P7LA 1RG9A 4DR5C 5A2QD 5JRHA 4LFBC 3O2EA 3R9WA 2P02A 3TDEA 2OBVA 5BSRA 2OPLB 4NXMC 1ULTA 4FUTA 4LF5C 5BUQA 1XRBA 2QL8A 3DAYA 1GPMA 5KEIA 3OTOC 4JI2C 5CZVA 2OPLA 3E7XA 4X62C 4JI1C 4JI8C 1N33C 4EATA 2KZFA 2QVZX 2UXCC 3A26A 3CQ1A 2UUAC 4WS9A 1YJ7A 2DHMA 3FM7A 1LQLA 2D1SA 3IEUA 4R1MA 3B7WA 5T8TA 2ASBA 2M5HA 3I07A 1BA3A 2MM9A 4BSZA 3K6RA 4LF4C 2E7GA 1HNZC 3LUSA 4LE5A 4G37A 4B3TC 1JOSA 2ONFA 4PUHA 3PROC 3T1YC 3A25A 4DR3C 1N36C 3TR3A 3NYRA 4LFCC 3PBKA 3JAMD 4U5YD 3UZ0A 4PUIA 3IMLA 2PROA 4L2ZA 2D1RA 4K0KC 5BUSA 4KTTA 1YGTA 5IFIA 1MDFA 3N2QA 1FUGA 3R44A 1HH2P 4DUZC 4BCAA 2D1QA 4I9GA 1QWIA 4X65C 3I08A 2KZ0A 4R1LA 1UKKA 1O92A 1O9TA 1USPB 4LF6C 4X64C 4JI0C 2VQFC 3GR0A 1MKYA 2HHHC 4OYCA 3PESA 2AYAA 5AE2A 3ETOA 1USPA 2BJOA 4DV5C 2CXCA 4R0MA 5BSTA 5KYVA 1KKGA 4ZLPA 2P2FA 4DV3C 1XMOC 2VZEA 3IEVA 4DR6C 1XNQC 2HJGA 1VEHA 3E7WA 2VQEC 4BC9A 5AE1A 4DCSA 1L2FA 4G1IA 2ZM6C 5ADZA 5BR8C 2Y4OA 3UX2A 1T5HX 5A1IA 5LMUC 5K85A 4RVNA 1N2FA 4DV1C 3S82A 3UEBA 1QM4A 3ETCA 2CY1A 2ZZNA 1XRCA 5FLXD 1XDXA 4ZJZA 1FLOA 3N54B 5BSUA 2D7VA 2PT7G 3GKUA 2Y4NA 2Y27A 1PG4A 4GXRA 2ZZMA 2ATWA 4JYAC 3IPLA 1P4EC 4PZPA 2QW0X 2E8FA 4RM3A 1M6XC 5A1GA 2CU6A 4PUGA 2D28C 4LF9C 3LAXA 2P2MA 4YHHC 5IT9D 3J7AD 3NYQA 1WH9A 1O93A 5LCIA 4D4IA 3FCEA 1HNXC 5LMNC 5GTDA 2OO4A 4AQYC 4DV7C 3C5EA 5K8FA 3GPCA 2YCBA 3TUFA 4TPSB 1HR0C 4X66C 1IBLC 4D4GA 2Z51A 1MXCA 3DLPX 5A19A 4DCVA 2UUCC 3NPDA 1XNRC 3L95X 3G7SA 2D1TA 1RY2A 1XRAA 5CZXA 2P20A 4DG9A 3AY0A 1P4EA 5H9UA 4ISBA 3VNQA 4HPVA 2MMAB 1LCIA 4IR7A 3VNSA 1M6XA 4DV4C 5AE3A 3TQIA 4JV5C 4MTNA 4JI3C 3CW8X 4K0BA 3LNOA 2WP0C 5IWAC 2PN2A 5BSMA 2E8CA 4DV0C 4D56A 1K0RA 4LF8C 4I9FA 2F4VC 1PA4A 3L8CA 2M5OA 2D27A 2YWCA 3AF6A 1XHJA 3R9XA 5BSWA 3RV2A 4GKKC 4RLQA 4DCTA 2E5LC 2P2JA 2E8EA 4WV3A 4GKJC 1V25A 3SO4A 3UOWA 1O90A 1WCJA 3FCCA 3UX3A 2UUBC 3DHVA 5DV9A 4JM1A 4JI4C 4IZ6A 4B3SC 1NYEA 3EQ6A 5T8SA 1I94C 3GR1A 4OXIA 4JI5C 4JI6C 1J5EC 2EGTA 3A4IA 1XS3A 1ZB8A 2MCQA 4RVOA 4D57A 1NY8A 4RLFA 1IBKC 3J80D 1AMUA 5BSVA 2E0GA 2UU9C 4B3RC 1ZB9A 4LF7C 2UXBC 3CJEA 4L4QA 3NI2A 2YWBA 4NDNA 1V60A 1MXAA 4B3MC 3LGXA 4GS5A 2KDNA 4DG8A 2JMPA 1MD9A 4DUYC 3T1HC 1IBMC 3RG2A 4DR2C 2UXDC 4RM2A 4DV2C 4DR4C 2VSQA 1FJGC 4KTVA 2QVYX 1UWDA 2V7BA 3J81D 3VNRA 1N32C 1XMQC 3CQ3A 3KXWA 1TH5A 3LNVA 4NOZA 4KHPC 3CQ2A 1EGAA 4DR1C 4PHTA 5KYTA 4RMNA 1VLAA 4MH4A 4ODJA 1PG3A 1V26A 1IB8A 4G36A 3A9VA 2DYJA
chains in the Genus database with same CATH topology
2WD9A 5E7QA 1WF3A 2XR1A 3H2TA 3AF5A 1HNWC 1MXBA 4DR7C 4YY3C 1N34C 1T5DX 4L7IA 4BC7A 2QVXX 1ML8A 4OX9C 2P2QA 4BBYA 4JI7C 2P2BA 4DCUA 4FTFA 1MDBA 4LFAC 4NXNC 4PROC 4FUQA 4GXQA 2BH1X 3EERA 4DV6C 4XX2A 2DPLA 5BURA 3A9UA 3CW9A 1P7LA 1RG9A 4DR5C 5A2QD 5JRHA 4LFBC 3R9WA 2P02A 3TDEA 2OBVA 5BSRA 2OPLB 4NXMC 1ULTA 4FUTA 4LF5C 5BUQA 1XRBA 2QL8A 3DAYA 1GPMA 5KEIA 3OTOC 4JI2C 5CZVA 2OPLA 3E7XA 4X62C 4JI1C 4JI8C 1N33C 4EATA 2KZFA 2QVZX 2UXCC 2UUAC 4WS9A 1YJ7A 1LQLA 2D1SA 3IEUA 4R1MA 3B7WA 5T8TA 2ASBA 3I07A 1BA3A 4BSZA 4LF4C 2E7GA 1HNZC 3LUSA 4LE5A 4G37A 4B3TC 1JOSA 2ONFA 3PROC 3T1YC 4DR3C 1N36C 3NYRA 4LFCC 3PBKA 3JAMD 4U5YD 3UZ0A 3IMLA 2PROA 4L2ZA 2D1RA 4K0KC 5BUSA 4KTTA 5IFIA 1MDFA 3N2QA 1FUGA 3R44A 1HH2P 4DUZC 4BCAA 2D1QA 4I9GA 1QWIA 4X65C 3I08A 4R1LA 1UKKA 1O92A 1O9TA 1USPB 4LF6C 4X64C 4JI0C 2VQFC 3GR0A 1MKYA 2HHHC 4OYCA 3PESA 2AYAA 5AE2A 3ETOA 1USPA 2BJOA 4DV5C 2CXCA 4R0MA 5BSTA 5KYVA 1KKGA 4ZLPA 2P2FA 4DV3C 1XMOC 2VZEA 3IEVA 4DR6C 1XNQC 2HJGA 3E7WA 2VQEC 4BC9A 5AE1A 4DCSA 1L2FA 4G1IA 2ZM6C 5ADZA 5BR8C 2Y4OA 1T5HX 5A1IA 5LMUC 5K85A 4RVNA 1N2FA 4DV1C 3S82A 1QM4A 3ETCA 2CY1A 1XRCA 5FLXD 4ZJZA 3N54B 5BSUA 2D7VA 2PT7G 3GKUA 2Y4NA 2Y27A 1PG4A 4GXRA 2ATWA 4JYAC 3IPLA 4PZPA 2QW0X 2E8FA 4RM3A 5A1GA 2D28C 4LF9C 3LAXA 2P2MA 4YHHC 5IT9D 3J7AD 3NYQA 1WH9A 1O93A 4D4IA 3FCEA 1HNXC 5LMNC 5GTDA 2OO4A 4AQYC 4DV7C 3C5EA 5K8FA 3GPCA 2YCBA 3TUFA 4TPSB 1HR0C 4X66C 1IBLC 4D4GA 1MXCA 3DLPX 5A19A 4DCVA 2UUCC 3NPDA 1XNRC 3L95X 3G7SA 2D1TA 1RY2A 1XRAA 5CZXA 2P20A 4DG9A 5H9UA 4ISBA 3VNQA 4HPVA 1LCIA 4IR7A 3VNSA 4DV4C 5AE3A 3TQIA 4JV5C 4MTNA 4JI3C 3CW8X 4K0BA 2WP0C 5IWAC 2PN2A 5BSMA 2E8CA 4DV0C 4D56A 1K0RA 4LF8C 4I9FA 2F4VC 1PA4A 3L8CA 2D27A 2YWCA 3AF6A 3R9XA 5BSWA 3RV2A 4GKKC 4RLQA 4DCTA 2E5LC 2P2JA 2E8EA 4WV3A 4GKJC 1V25A 3SO4A 3UOWA 1O90A 3FCCA 2UUBC 3DHVA 5DV9A 4JM1A 4JI4C 4IZ6A 4B3SC 1NYEA 3EQ6A 5T8SA 1I94C 3GR1A 4OXIA 4JI5C 4JI6C 1J5EC 2EGTA 3A4IA 1ZB8A 4RVOA 4D57A 4RLFA 1IBKC 3J80D 1AMUA 5BSVA 2E0GA 2UU9C 4B3RC 1ZB9A 4LF7C 2UXBC 3CJEA 4L4QA 3NI2A 2YWBA 4NDNA 1MXAA 4B3MC 3LGXA 4GS5A 4DG8A 2JMPA 1MD9A 4DUYC 3T1HC 1IBMC 3RG2A 4DR2C 2UXDC 4RM2A 4DV2C 4DR4C 2VSQA 1FJGC 4KTVA 2QVYX 2V7BA 3J81D 3VNRA 1N32C 1XMQC 3KXWA 3LNVA 4NOZA 4KHPC 1EGAA 4DR1C 4PHTA 5KYTA 4RMNA 1VLAA 4MH4A 4ODJA 1PG3A 1V26A 4G36A 3A9VA 2DYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKU A;  1HNZ C;  3R9X A;  3LUS A;  1WF3 A;  2XR1 A;  4GKK C;  4B3T C;  3AF5 A;  2ATW A;  1HNW C;  1JOS A;  4JYA C;  4DCT A;  2E5L C;  2ONF A;  2E8E A;  4DR7 C;  4YY3 C;  1N34 C;  2E8F A;  3T1Y C;  4DR3 C;  1N36 C;  4GKJ C;  4LFC C;  3JAM D;  1ML8 A;  4OX9 C;  2UUB C;  4LF9 C;  4YHH C;  5IT9 D;  3J7A D;  4JI4 C;  4JI7 C;  4B3S C;  1NYE A;  1I94 C;  1WH9 A;  4K0K C;  4JI5 C;  4DCU A;  1HNX C;  5LMN C;  4JI6 C;  1HH2 P;  4DUZ C;  1J5E C;  4LFA C;  2EGT A;  4NXN C;  1ZB8 A;  4AQY C;  4DV7 C;  1QWI A;  4X65 C;  1IBK C;  1UKK A;  3J80 D;  2YCB A;  3EER A;  4DV6 C;  2UU9 C;  4XX2 A;  4B3R C;  1USP B;  1HR0 C;  4X66 C;  1IBL C;  1ZB9 A;  4LF6 C;  4X64 C;  4JI0 C;  4LF7 C;  2VQF C;  2UXB C;  3CJE A;  2DYJ A;  1MKY A;  4DR5 C;  2HHH C;  4DCV A;  2UUC C;  5A2Q D;  1XNR C;  4LFB C;  3R9W A;  1USP A;  2BJO A;  4DV5 C;  2CXC A;  4B3M C;  2JMP A;  4DUY C;  1KKG A;  3T1H C;  1IBM C;  2OPL B;  4DR2 C;  4DV3 C;  1XMO C;  3IEV A;  2UXD C;  4DR6 C;  4NXM C;  1XNQ C;  2HJG A;  4DV2 C;  4DR4 C;  4LF5 C;  1FJG C;  2QL8 A;  2VQE C;  4DCS A;  4DV4 C;  3OTO C;  4JI2 C;  2OPL A;  4JV5 C;  1L2F A;  4MTN A;  4X62 C;  2ZM6 C;  3J81 D;  4JI1 C;  4JI8 C;  1N33 C;  4JI3 C;  1N32 C;  5BR8 C;  2KZF A;  1XMQ C;  2UXC C;  2UUA C;  4NOZ A;  4KHP C;  5LMU C;  5IWA C;  1N2F A;  1LQL A;  1EGA A;  4DV1 C;  4DR1 C;  2PN2 A;  3IEU A;  2E8C A;  2CY1 A;  1VLA A;  4DV0 C;  4MH4 A;  5FLX D;  1K0R A;  4LF8 C;  2F4V C;  2ASB A;  3I07 A;  1PA4 A;  4BSZ A;  4LF4 C;  2D7V A;  2E7G A;  2PT7 G;  3AF6 A; 
#chains in the Genus database with same CATH topology
 2YX1 A;  2WD9 A;  5E7Q A;  1WF3 A;  2XR1 A;  3H2T A;  3AF5 A;  1HNW C;  1MXB A;  4DR7 C;  4YY3 C;  1N34 C;  2NCL A;  1T5D X;  2JNV A;  4L7I A;  4BC7 A;  1PU1 A;  2QVX X;  1ML8 A;  4OX9 C;  2P2Q A;  4BBY A;  4JI7 C;  2P2B A;  4DCU A;  4FTF A;  1MDB A;  4LFA C;  4NXN C;  4PRO C;  4FUQ A;  4GXQ A;  2ZTB A;  2BH1 X;  3EER A;  4DV6 C;  4XX2 A;  2DPL A;  2PG1 E;  5BUR A;  3A9U A;  3CW9 A;  1P7L A;  1RG9 A;  4DR5 C;  5A2Q D;  5JRH A;  4LFB C;  3O2E A;  3R9W A;  2P02 A;  3TDE A;  2OBV A;  5BSR A;  2OPL B;  4NXM C;  1ULT A;  4FUT A;  4LF5 C;  5BUQ A;  1XRB A;  2QL8 A;  3DAY A;  1GPM A;  5KEI A;  3OTO C;  4JI2 C;  5CZV A;  2OPL A;  3E7X A;  4X62 C;  4JI1 C;  4JI8 C;  1N33 C;  4EAT A;  2KZF A;  2QVZ X;  2UXC C;  3A26 A;  3CQ1 A;  2UUA C;  4WS9 A;  1YJ7 A;  2DHM A;  3FM7 A;  1LQL A;  2D1S A;  3IEU A;  4R1M A;  3B7W A;  5T8T A;  2ASB A;  2M5H A;  3I07 A;  1BA3 A;  2MM9 A;  4BSZ A;  3K6R A;  4LF4 C;  2E7G A;  1HNZ C;  3LUS A;  4LE5 A;  4G37 A;  4B3T C;  1JOS A;  2ONF A;  4PUH A;  3PRO C;  3T1Y C;  3A25 A;  4DR3 C;  1N36 C;  3TR3 A;  3NYR A;  4LFC C;  3PBK A;  3JAM D;  4U5Y D;  3UZ0 A;  4PUI A;  3IML A;  2PRO A;  4L2Z A;  2D1R A;  4K0K C;  5BUS A;  4KTT A;  1YGT A;  5IFI A;  1MDF A;  3N2Q A;  1FUG A;  3R44 A;  1HH2 P;  4DUZ C;  4BCA A;  2D1Q A;  4I9G A;  1QWI A;  4X65 C;  3I08 A;  2KZ0 A;  4R1L A;  1UKK A;  1O92 A;  1O9T A;  1USP B;  4LF6 C;  4X64 C;  4JI0 C;  2VQF C;  3GR0 A;  1MKY A;  2HHH C;  4OYC A;  3PES A;  2AYA A;  5AE2 A;  3ETO A;  1USP A;  2BJO A;  4DV5 C;  2CXC A;  4R0M A;  5BST A;  5KYV A;  1KKG A;  4ZLP A;  2P2F A;  4DV3 C;  1XMO C;  2VZE A;  3IEV A;  4DR6 C;  1XNQ C;  2HJG A;  1VEH A;  3E7W A;  2VQE C;  4BC9 A;  5AE1 A;  4DCS A;  1L2F A;  4G1I A;  2ZM6 C;  5ADZ A;  5BR8 C;  2Y4O A;  3UX2 A;  1T5H X;  5A1I A;  5LMU C;  5K85 A;  4RVN A;  1N2F A;  4DV1 C;  3S82 A;  3UEB A;  1QM4 A;  3ETC A;  2CY1 A;  2ZZN A;  1XRC A;  5FLX D;  1XDX A;  4ZJZ A;  1FLO A;  3N54 B;  5BSU A;  2D7V A;  2PT7 G;  3GKU A;  2Y4N A;  2Y27 A;  1PG4 A;  4GXR A;  2ZZM A;  2ATW A;  4JYA C;  3IPL A;  1P4E C;  4PZP A;  2QW0 X;  2E8F A;  4RM3 A;  1M6X C;  5A1G A;  2CU6 A;  4PUG A;  2D28 C;  4LF9 C;  3LAX A;  2P2M A;  4YHH C;  5IT9 D;  3J7A D;  3NYQ A;  1WH9 A;  1O93 A;  5LCI A;  4D4I A;  3FCE A;  1HNX C;  5LMN C;  5GTD A;  2OO4 A;  4AQY C;  4DV7 C;  3C5E A;  5K8F A;  3GPC A;  2YCB A;  3TUF A;  4TPS B;  1HR0 C;  4X66 C;  1IBL C;  4D4G A;  2Z51 A;  1MXC A;  3DLP X;  5A19 A;  4DCV A;  2UUC C;  3NPD A;  1XNR C;  3L95 X;  3G7S A;  2D1T A;  1RY2 A;  1XRA A;  5CZX A;  2P20 A;  4DG9 A;  3AY0 A;  1P4E A;  5H9U A;  4ISB A;  3VNQ A;  4HPV A;  2MMA B;  1LCI A;  4IR7 A;  3VNS A;  1M6X A;  4DV4 C;  5AE3 A;  3TQI A;  4JV5 C;  4MTN A;  4JI3 C;  3CW8 X;  4K0B A;  3LNO A;  2WP0 C;  5IWA C;  2PN2 A;  5BSM A;  2E8C A;  4DV0 C;  4D56 A;  1K0R A;  4LF8 C;  4I9F A;  2F4V C;  1PA4 A;  3L8C A;  2M5O A;  2D27 A;  2YWC A;  3AF6 A;  1XHJ A;  3R9X A;  5BSW A;  3RV2 A;  4GKK C;  4RLQ A;  4DCT A;  2E5L C;  2P2J A;  2E8E A;  4WV3 A;  4GKJ C;  1V25 A;  3SO4 A;  3UOW A;  1O90 A;  1WCJ A;  3FCC A;  3UX3 A;  2UUB C;  3DHV A;  5DV9 A;  4JM1 A;  4JI4 C;  4IZ6 A;  4B3S C;  1NYE A;  3EQ6 A;  5T8S A;  1I94 C;  3GR1 A;  4OXI A;  4JI5 C;  4JI6 C;  1J5E C;  2EGT A;  3A4I A;  1XS3 A;  1ZB8 A;  2MCQ A;  4RVO A;  4D57 A;  1NY8 A;  4RLF A;  1IBK C;  3J80 D;  1AMU A;  5BSV A;  2E0G A;  2UU9 C;  4B3R C;  1ZB9 A;  4LF7 C;  2UXB C;  3CJE A;  4L4Q A;  3NI2 A;  2YWB A;  4NDN A;  1V60 A;  1MXA A;  4B3M C;  3LGX A;  4GS5 A;  2KDN A;  4DG8 A;  2JMP A;  1MD9 A;  4DUY C;  3T1H C;  1IBM C;  3RG2 A;  4DR2 C;  2UXD C;  4RM2 A;  4DV2 C;  4DR4 C;  2VSQ A;  1FJG C;  4KTV A;  2QVY X;  1UWD A;  2V7B A;  3J81 D;  3VNR A;  1N32 C;  1XMQ C;  3CQ3 A;  3KXW A;  1TH5 A;  3LNV A;  4NOZ A;  4KHP C;  3CQ2 A;  1EGA A;  4DR1 C;  4PHT A;  5KYT A;  4RMN A;  1VLA A;  4MH4 A;  4ODJ A;  1PG3 A;  1V26 A;  1IB8 A;  4G36 A;  3A9V A;  2DYJ A; 
#chains in the Genus database with same CATH homology
 2WD9 A;  5E7Q A;  1WF3 A;  2XR1 A;  3H2T A;  3AF5 A;  1HNW C;  1MXB A;  4DR7 C;  4YY3 C;  1N34 C;  1T5D X;  4L7I A;  4BC7 A;  2QVX X;  1ML8 A;  4OX9 C;  2P2Q A;  4BBY A;  4JI7 C;  2P2B A;  4DCU A;  4FTF A;  1MDB A;  4LFA C;  4NXN C;  4PRO C;  4FUQ A;  4GXQ A;  2BH1 X;  3EER A;  4DV6 C;  4XX2 A;  2DPL A;  5BUR A;  3A9U A;  3CW9 A;  1P7L A;  1RG9 A;  4DR5 C;  5A2Q D;  5JRH A;  4LFB C;  3R9W A;  2P02 A;  3TDE A;  2OBV A;  5BSR A;  2OPL B;  4NXM C;  1ULT A;  4FUT A;  4LF5 C;  5BUQ A;  1XRB A;  2QL8 A;  3DAY A;  1GPM A;  5KEI A;  3OTO C;  4JI2 C;  5CZV A;  2OPL A;  3E7X A;  4X62 C;  4JI1 C;  4JI8 C;  1N33 C;  4EAT A;  2KZF A;  2QVZ X;  2UXC C;  2UUA C;  4WS9 A;  1YJ7 A;  1LQL A;  2D1S A;  3IEU A;  4R1M A;  3B7W A;  5T8T A;  2ASB A;  3I07 A;  1BA3 A;  4BSZ A;  4LF4 C;  2E7G A;  1HNZ C;  3LUS A;  4LE5 A;  4G37 A;  4B3T C;  1JOS A;  2ONF A;  3PRO C;  3T1Y C;  4DR3 C;  1N36 C;  3NYR A;  4LFC C;  3PBK A;  3JAM D;  4U5Y D;  3UZ0 A;  3IML A;  2PRO A;  4L2Z A;  2D1R A;  4K0K C;  5BUS A;  4KTT A;  5IFI A;  1MDF A;  3N2Q A;  1FUG A;  3R44 A;  1HH2 P;  4DUZ C;  4BCA A;  2D1Q A;  4I9G A;  1QWI A;  4X65 C;  3I08 A;  4R1L A;  1UKK A;  1O92 A;  1O9T A;  1USP B;  4LF6 C;  4X64 C;  4JI0 C;  2VQF C;  3GR0 A;  1MKY A;  2HHH C;  4OYC A;  3PES A;  2AYA A;  5AE2 A;  3ETO A;  1USP A;  2BJO A;  4DV5 C;  2CXC A;  4R0M A;  5BST A;  5KYV A;  1KKG A;  4ZLP A;  2P2F A;  4DV3 C;  1XMO C;  2VZE A;  3IEV A;  4DR6 C;  1XNQ C;  2HJG A;  3E7W A;  2VQE C;  4BC9 A;  5AE1 A;  4DCS A;  1L2F A;  4G1I A;  2ZM6 C;  5ADZ A;  5BR8 C;  2Y4O A;  1T5H X;  5A1I A;  5LMU C;  5K85 A;  4RVN A;  1N2F A;  4DV1 C;  3S82 A;  1QM4 A;  3ETC A;  2CY1 A;  1XRC A;  5FLX D;  4ZJZ A;  3N54 B;  5BSU A;  2D7V A;  2PT7 G;  3GKU A;  2Y4N A;  2Y27 A;  1PG4 A;  4GXR A;  2ATW A;  4JYA C;  3IPL A;  4PZP A;  2QW0 X;  2E8F A;  4RM3 A;  5A1G A;  2D28 C;  4LF9 C;  3LAX A;  2P2M A;  4YHH C;  5IT9 D;  3J7A D;  3NYQ A;  1WH9 A;  1O93 A;  4D4I A;  3FCE A;  1HNX C;  5LMN C;  5GTD A;  2OO4 A;  4AQY C;  4DV7 C;  3C5E A;  5K8F A;  3GPC A;  2YCB A;  3TUF A;  4TPS B;  1HR0 C;  4X66 C;  1IBL C;  4D4G A;  1MXC A;  3DLP X;  5A19 A;  4DCV A;  2UUC C;  3NPD A;  1XNR C;  3L95 X;  3G7S A;  2D1T A;  1RY2 A;  1XRA A;  5CZX A;  2P20 A;  4DG9 A;  5H9U A;  4ISB A;  3VNQ A;  4HPV A;  1LCI A;  4IR7 A;  3VNS A;  4DV4 C;  5AE3 A;  3TQI A;  4JV5 C;  4MTN A;  4JI3 C;  3CW8 X;  4K0B A;  2WP0 C;  5IWA C;  2PN2 A;  5BSM A;  2E8C A;  4DV0 C;  4D56 A;  1K0R A;  4LF8 C;  4I9F A;  2F4V C;  1PA4 A;  3L8C A;  2D27 A;  2YWC A;  3AF6 A;  3R9X A;  5BSW A;  3RV2 A;  4GKK C;  4RLQ A;  4DCT A;  2E5L C;  2P2J A;  2E8E A;  4WV3 A;  4GKJ C;  1V25 A;  3SO4 A;  3UOW A;  1O90 A;  3FCC A;  2UUB C;  3DHV A;  5DV9 A;  4JM1 A;  4JI4 C;  4IZ6 A;  4B3S C;  1NYE A;  3EQ6 A;  5T8S A;  1I94 C;  3GR1 A;  4OXI A;  4JI5 C;  4JI6 C;  1J5E C;  2EGT A;  3A4I A;  1ZB8 A;  4RVO A;  4D57 A;  4RLF A;  1IBK C;  3J80 D;  1AMU A;  5BSV A;  2E0G A;  2UU9 C;  4B3R C;  1ZB9 A;  4LF7 C;  2UXB C;  3CJE A;  4L4Q A;  3NI2 A;  2YWB A;  4NDN A;  1MXA A;  4B3M C;  3LGX A;  4GS5 A;  4DG8 A;  2JMP A;  1MD9 A;  4DUY C;  3T1H C;  1IBM C;  3RG2 A;  4DR2 C;  2UXD C;  4RM2 A;  4DV2 C;  4DR4 C;  2VSQ A;  1FJG C;  4KTV A;  2QVY X;  2V7B A;  3J81 D;  3VNR A;  1N32 C;  1XMQ C;  3KXW A;  3LNV A;  4NOZ A;  4KHP C;  1EGA A;  4DR1 C;  4PHT A;  5KYT A;  4RMN A;  1VLA A;  4MH4 A;  4ODJ A;  1PG3 A;  1V26 A;  4G36 A;  3A9V A;  2DYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...