1N33C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n33C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n33C02
2HJGA 2BJOA 4DCSA 1NYEA 4DV5C 4X66C 4B3SC 1N32C 1XMQC 2OPLB 5A2QD 4B3TC 4JI5C 1J5EC 4DR6C 4DV6C 4DV0C 2QL8A 2ATWA 4LF4C 1HNXC 4DUZC 4LF7C 4X64C 2UXBC 4B3RC 1EGAA 1WH9A 3CJEA 4DR4C 2VQEC 2OPLA 1JOSA 4NXMC 1HNZC 1N2FA 4DV1C 5BR8C 4JI2C 4LFBC 2VQFC 5IWAC 4DUYC 1HR0C 4DR2C 2D7VA 2ONFA 1I94C 1XMOC 2UUAC 4JI1C 1N36C 4GKJC 2E8EA 4LF5C 2ASBA 2ZM6C 3J81D 4DV4C 5FLXD 4DV2C 2UXCC 1USPA 3I07A 4DCVA 2E7GA 1VLAA 2CY1A 1L2FA 1IBKC 4MH4A 3AF6A 2UUBC 2UXDC 4LFAC 2UUCC 4JI8C 4JV5C 3R9WA 5LMNC 1N34C 4AQYC 2F4VC 4K0KC 1KKGA 4BSZA 3IEVA 4GKKC 3J80D 3LUSA 1HH2P 1UKKA 4DV3C 2CXCA 2PT7G 5IT9D 4X65C 3GKUA 4JI4C 4NXNC 1FJGC 2PN2A 1HNWC 1ZB8A 1MKYA 4YY3C 2E8CA 2XR1A 1N33C 2E5LC 1XNQC 4DCTA 1IBLC 4XX2A 2HHHC 3EERA 4JI3C 2JMPA 4DCUA 3T1HC 1ML8A 2DYJA 2E8FA 1LQLA 2KZFA 4DR7C 3J7AD 4LF8C 4DR1C 4DV7C 4JI0C 1ZB9A 4LF9C 3IEUA 4YHHC 3T1YC 2UU9C 3OTOC 1K0RA 4LFCC 1QWIA 4JI7C 4X62C 4KHPC 4MTNA 4JYAC 1PA4A 3JAMD 1IBMC 1WF3A 4DR5C 4OX9C 4NOZA 4JI6C 4LF6C 1XNRC 1USPB 2EGTA 4DR3C 5LMUC 4B3MC 2YCBA 3AF5A 3R9XA
chains in the Genus database with same CATH superfamily
5A19A 1NYEA 4B3SC 4GXQA 1N32C 3S82A 4D57A 1MXAA 4DR6C 4LF4C 3ETOA 2Y27A 1HNXC 1NY8A 3CQ2A 5LCIA 3CJEA 5BSWA 5BUSA 2OPLA 1V26A 4JI2C 4LFBC 4L4QA 2VQFC 4DUYC 1P4EC 1HR0C 3GR0A 2M5HA 3VNRA 2V7BA 4JI1C 3KXWA 2CU6A 2ASBA 2QVZX 5E7QA 1XRBA 2VZEA 5FLXD 2BH1X 2KDNA 3N2QA 4G36A 1IB8A 1IBKC 2D1TA 2UUCC 3NI2A 2P2QA 3A4IA 1N34C 2F4VC 4K0KC 4PUGA 4KTVA 4BC7A 1O90A 5K85A 3LUSA 5BSMA 3A26A 2CXCA 4DG8A 2ZZNA 4JI4C 2P2FA 1FJGC 2PN2A 1O9TA 2YX1A 4YY3C 4BC9A 1QM4A 1N33C 4I9FA 5GTDA 1IBLC 4RVNA 2PG1E 3EERA 2JMPA 3VNQA 3E7WA 1XDXA 3CW8X 2OO4A 1ML8A 2E8FA 4DR7C 3J7AD 3FCCA 4ISBA 4DR1C 1ZB9A 3VNSA 3IEUA 5K8FA 4FUTA 5IFIA 2QVYX 2NCLA 4K0BA 3E7XA 4JYAC 3UX2A 1IBMC 4OX9C 3TDEA 2AYAA 4LF6C 3RV2A 3R9XA 2BJOA 3GR1A 1YGTA 5KYTA 4PROC 1FUGA 2OPLB 1XMQC 2Y4OA 4JI5C 2P20A 4DV6C 3IMLA 4DV0C 4RVOA 3RG2A 3UZ0A 2D28C 4HPVA 5A1GA 4DUZC 4LF7C 4X64C 4B3RC 1EGAA 1WH9A 2WD9A 1O92A 2D27A 2E0GA 1BA3A 3LNVA 4RLFA 1N2FA 2D1SA 5BR8C 5IWAC 4DR2C 1I94C 1XMOC 4WV3A 2YWBA 1RG9A 3H2TA 1P4EA 4RM3A 2E7GA 2CY1A 3DHVA 4G37A 2UUBC 5AE2A 2MMAB 4NDNA 2YWCA 4OXIA 4ODJA 4L7IA 2P2BA 1HH2P 1UKKA 3UEBA 5KEIA 5A1IA 5IT9D 2P02A 3DAYA 4WS9A 4NXNC 3EQ6A 1ZB8A 3NYQA 3GPCA 1LCIA 4GXRA 2Z51A 4JI3C 2KZ0A 3LAXA 4DCUA 3T1HC 2DYJA 2VSQA 4RMNA 5BSUA 3CQ1A 4LFCC 4ZLPA 4X62C 5KYVA 3C5EA 4I9GA 1O93A 2P2JA 1USPB 2DHMA 2EGTA 4DR3C 4B3MC 4BBYA 3AF5A 4DCSA 4FUQA 4DV5C 4X66C 5BSRA 2MM9A 2QVXX 5A2QD 4B3TC 1J5EC 2ATWA 1T5HX 5BSTA 1WCJA 3TUFA 4G1IA 3O2EA 1HNZC 1MDBA 1AMUA 3AY0A 5BUQA 3CQ3A 4JM1A 4IR7A 2ONFA 3R44A 4PHTA 3A9VA 2UUAC 1PG4A 4GKJC 4LF5C 4DV2C 3NYRA 1USPA 2UXCC 3I07A 2ZZMA 3PROC 1MXBA 4MH4A 4LFAC 3R9WA 5LMNC 1TH5A 5T8SA 1MXCA 4L2ZA 4D4GA 1KKGA 5BURA 2DPLA 1RY2A 3L8CA 4U5YD 5BSVA 4RLQA 3A9UA 3G7SA 4FTFA 3FCEA 2D1RA 4DV3C 1MDFA 2PT7G 1VEHA 1V25A 1XRAA 3GKUA 1XS3A 4R1MA 1M6XC 1ULTA 1MKYA 3UOWA 4ZJZA 2E5LC 1XNQC 3FM7A 1MD9A 4BCAA 2JNVA 4LF8C 4JI0C 3N54B 4LF9C 4PZPA 2UU9C 1QWIA 1XHJA 4KHPC 1FLOA 3DLPX 4MTNA 3JAMD 4R0MA 4JI6C 5LMUC 2HJGA 3PBKA 2QL8A 5CZVA 2QW0X 3L95X 3PESA 4PUHA 2UXBC 3LNOA 5DV9A 3K6RA 4DR4C 2VQEC 4NXMC 1JOSA 4R1LA 4DV1C 2M5OA 4D56A 1PU1A 2D7VA 3IPLA 4EATA 2Y4NA 3NPDA 3TR3A 1N36C 2E8EA 2MCQA 4TPSB 2ZM6C 3J81D 4DV4C 3ETCA 1PG3A 2D1QA 4DCVA 1VLAA 1L2FA 5ADZA 2PROA 3AF6A 3TQIA 3LGXA 5T8TA 2UXDC 3I08A 4JI8C 3SO4A 1T5DX 4JV5C 4PUIA 4AQYC 1P7LA 4DG9A 4BSZA 3IEVA 2ZTBA 4GKKC 3J80D 1GPMA 4KTTA 4X65C 4IZ6A 3B7WA 3CW9A 1HNWC 2E8CA 2XR1A 4DCTA 4XX2A 2HHHC 5CZXA 1M6XA 4D4IA 2WP0C 1LQLA 2KZFA 1V60A 1XRCA 3A25A 4DV7C 5AE3A 1UWDA 4YHHC 4GS5A 4RM2A 3T1YC 3OTOC 1K0RA 4JI7C 2P2MA 5H9UA 1PA4A 5AE1A 1WF3A 4DR5C 2OBVA 4NOZA 4OYCA 1YJ7A 1XNRC 4LE5A 5JRHA 2YCBA 3UX3A
chains in the Genus database with same CATH topology
5A19A 1NYEA 4B3SC 4GXQA 1N32C 3S82A 4D57A 1MXAA 4DR6C 4LF4C 3ETOA 2Y27A 1HNXC 3CJEA 5BSWA 5BUSA 2OPLA 1V26A 4JI2C 4LFBC 4L4QA 2VQFC 4DUYC 1HR0C 3GR0A 3VNRA 2V7BA 4JI1C 3KXWA 2ASBA 2QVZX 5E7QA 1XRBA 2VZEA 5FLXD 2BH1X 3N2QA 4G36A 1IBKC 2D1TA 2UUCC 3NI2A 2P2QA 3A4IA 1N34C 2F4VC 4K0KC 4KTVA 1O90A 5K85A 3LUSA 4BC7A 5BSMA 2CXCA 4DG8A 4JI4C 2P2FA 1FJGC 2PN2A 1O9TA 4YY3C 4BC9A 1QM4A 1N33C 4I9FA 5GTDA 1IBLC 4RVNA 3EERA 2JMPA 3VNQA 3E7WA 3CW8X 2OO4A 1ML8A 2E8FA 4DR7C 3J7AD 3FCCA 4ISBA 4DR1C 1ZB9A 3VNSA 3IEUA 5K8FA 4FUTA 5IFIA 2QVYX 4K0BA 3E7XA 4JYAC 1IBMC 4OX9C 3TDEA 2AYAA 4LF6C 3RV2A 3R9XA 2BJOA 3GR1A 5KYTA 4PROC 1FUGA 2OPLB 1XMQC 2Y4OA 4JI5C 2P20A 4DV6C 3IMLA 4DV0C 4RVOA 3RG2A 3UZ0A 2D28C 4HPVA 5A1GA 4DUZC 4LF7C 4X64C 4B3RC 1EGAA 1WH9A 2WD9A 1O92A 2D27A 2E0GA 1BA3A 3LNVA 4RLFA 1N2FA 2D1SA 5BR8C 5IWAC 4DR2C 1I94C 1XMOC 4WV3A 2YWBA 1RG9A 3H2TA 4RM3A 2E7GA 2CY1A 3DHVA 4G37A 2UUBC 5AE2A 4NDNA 2YWCA 4OXIA 4ODJA 4L7IA 2P2BA 1HH2P 1UKKA 5KEIA 5A1IA 5IT9D 2P02A 3DAYA 4WS9A 4NXNC 3EQ6A 1ZB8A 3NYQA 3GPCA 1LCIA 4GXRA 4JI3C 3LAXA 4DCUA 3T1HC 2DYJA 2VSQA 4RMNA 5BSUA 4LFCC 4ZLPA 4X62C 5KYVA 3C5EA 4I9GA 1O93A 2P2JA 1USPB 2EGTA 4DR3C 4B3MC 4BBYA 3AF5A 4DCSA 4FUQA 4DV5C 4X66C 5BSRA 2QVXX 5A2QD 4B3TC 1J5EC 2ATWA 1T5HX 5BSTA 3TUFA 4G1IA 1HNZC 1MDBA 1AMUA 5BUQA 4JM1A 4IR7A 2ONFA 3R44A 4PHTA 3A9VA 2UUAC 1PG4A 4GKJC 4LF5C 4DV2C 3NYRA 1USPA 2UXCC 3I07A 3PROC 1MXBA 4MH4A 4LFAC 3R9WA 5LMNC 5T8SA 1MXCA 4L2ZA 4D4GA 1KKGA 5BURA 2DPLA 1RY2A 3L8CA 4U5YD 5BSVA 4RLQA 3A9UA 3G7SA 4FTFA 4DV3C 3FCEA 2D1RA 1MDFA 2PT7G 1V25A 1XRAA 3GKUA 4R1MA 1ULTA 1MKYA 3UOWA 4ZJZA 2E5LC 1XNQC 1MD9A 4BCAA 4LF8C 4JI0C 3N54B 4LF9C 4PZPA 2UU9C 1QWIA 4KHPC 3DLPX 4MTNA 3JAMD 4R0MA 4JI6C 5LMUC 2HJGA 3PBKA 2QL8A 5CZVA 2QW0X 3L95X 3PESA 2UXBC 5DV9A 4DR4C 2VQEC 4NXMC 1JOSA 4R1LA 4DV1C 4D56A 2D7VA 3IPLA 4EATA 2Y4NA 3NPDA 1N36C 2E8EA 4TPSB 2ZM6C 3J81D 4DV4C 3ETCA 1PG3A 2D1QA 4DCVA 1VLAA 1L2FA 5ADZA 2PROA 3AF6A 3TQIA 3LGXA 5T8TA 2UXDC 3I08A 4JI8C 3SO4A 1T5DX 4JV5C 4AQYC 1P7LA 4DG9A 4BSZA 3IEVA 4GKKC 3J80D 1GPMA 4KTTA 4X65C 4IZ6A 3B7WA 3CW9A 1HNWC 2E8CA 2XR1A 4DCTA 4XX2A 2HHHC 5CZXA 4D4IA 2WP0C 1LQLA 2KZFA 1XRCA 4DV7C 5AE3A 4YHHC 4GS5A 4RM2A 3T1YC 3OTOC 1K0RA 4JI7C 2P2MA 5H9UA 1PA4A 5AE1A 1WF3A 4DR5C 2OBVA 4NOZA 4OYCA 1YJ7A 1XNRC 4LE5A 5JRHA 2YCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  2BJO A;  4DCS A;  1NYE A;  4DV5 C;  4X66 C;  4B3S C;  1N32 C;  1XMQ C;  2OPL B;  5A2Q D;  4B3T C;  4JI5 C;  1J5E C;  4DR6 C;  4DV6 C;  4DV0 C;  2QL8 A;  2ATW A;  4LF4 C;  1HNX C;  4DUZ C;  4LF7 C;  4X64 C;  2UXB C;  4B3R C;  1EGA A;  1WH9 A;  3CJE A;  4DR4 C;  2VQE C;  2OPL A;  1JOS A;  4NXM C;  1HNZ C;  1N2F A;  4DV1 C;  5BR8 C;  4JI2 C;  4LFB C;  2VQF C;  5IWA C;  4DUY C;  1HR0 C;  4DR2 C;  2D7V A;  2ONF A;  1I94 C;  1XMO C;  2UUA C;  4JI1 C;  1N36 C;  4GKJ C;  2E8E A;  4LF5 C;  2ASB A;  2ZM6 C;  3J81 D;  4DV4 C;  5FLX D;  4DV2 C;  2UXC C;  1USP A;  3I07 A;  4DCV A;  2E7G A;  1VLA A;  2CY1 A;  1L2F A;  1IBK C;  4MH4 A;  3AF6 A;  2UUB C;  2UXD C;  4LFA C;  2UUC C;  4JI8 C;  4JV5 C;  3R9W A;  5LMN C;  1N34 C;  4AQY C;  2F4V C;  4K0K C;  1KKG A;  4BSZ A;  3IEV A;  4GKK C;  3J80 D;  3LUS A;  1HH2 P;  1UKK A;  4DV3 C;  2CXC A;  2PT7 G;  5IT9 D;  4X65 C;  3GKU A;  4JI4 C;  4NXN C;  1FJG C;  2PN2 A;  1HNW C;  1ZB8 A;  1MKY A;  4YY3 C;  2E8C A;  2XR1 A;  1N33 C;  2E5L C;  1XNQ C;  4DCT A;  1IBL C;  4XX2 A;  2HHH C;  3EER A;  4JI3 C;  2JMP A;  4DCU A;  3T1H C;  1ML8 A;  2DYJ A;  2E8F A;  1LQL A;  2KZF A;  4DR7 C;  3J7A D;  4LF8 C;  4DR1 C;  4DV7 C;  4JI0 C;  1ZB9 A;  4LF9 C;  3IEU A;  4YHH C;  3T1Y C;  2UU9 C;  3OTO C;  1K0R A;  4LFC C;  1QWI A;  4JI7 C;  4X62 C;  4KHP C;  4MTN A;  4JYA C;  1PA4 A;  3JAM D;  1IBM C;  1WF3 A;  4DR5 C;  4OX9 C;  4NOZ A;  4JI6 C;  4LF6 C;  1XNR C;  1USP B;  2EGT A;  4DR3 C;  5LMU C;  4B3M C;  2YCB A;  3AF5 A;  3R9X A; 
#chains in the Genus database with same CATH topology
 5A19 A;  1NYE A;  4B3S C;  4GXQ A;  1N32 C;  3S82 A;  4D57 A;  1MXA A;  4DR6 C;  4LF4 C;  3ETO A;  2Y27 A;  1HNX C;  1NY8 A;  3CQ2 A;  5LCI A;  3CJE A;  5BSW A;  5BUS A;  2OPL A;  1V26 A;  4JI2 C;  4LFB C;  4L4Q A;  2VQF C;  4DUY C;  1P4E C;  1HR0 C;  3GR0 A;  2M5H A;  3VNR A;  2V7B A;  4JI1 C;  3KXW A;  2CU6 A;  2ASB A;  2QVZ X;  5E7Q A;  1XRB A;  2VZE A;  5FLX D;  2BH1 X;  2KDN A;  3N2Q A;  4G36 A;  1IB8 A;  1IBK C;  2D1T A;  2UUC C;  3NI2 A;  2P2Q A;  3A4I A;  1N34 C;  2F4V C;  4K0K C;  4PUG A;  4KTV A;  4BC7 A;  1O90 A;  5K85 A;  3LUS A;  5BSM A;  3A26 A;  2CXC A;  4DG8 A;  2ZZN A;  4JI4 C;  2P2F A;  1FJG C;  2PN2 A;  1O9T A;  2YX1 A;  4YY3 C;  4BC9 A;  1QM4 A;  1N33 C;  4I9F A;  5GTD A;  1IBL C;  4RVN A;  2PG1 E;  3EER A;  2JMP A;  3VNQ A;  3E7W A;  1XDX A;  3CW8 X;  2OO4 A;  1ML8 A;  2E8F A;  4DR7 C;  3J7A D;  3FCC A;  4ISB A;  4DR1 C;  1ZB9 A;  3VNS A;  3IEU A;  5K8F A;  4FUT A;  5IFI A;  2QVY X;  2NCL A;  4K0B A;  3E7X A;  4JYA C;  3UX2 A;  1IBM C;  4OX9 C;  3TDE A;  2AYA A;  4LF6 C;  3RV2 A;  3R9X A;  2BJO A;  3GR1 A;  1YGT A;  5KYT A;  4PRO C;  1FUG A;  2OPL B;  1XMQ C;  2Y4O A;  4JI5 C;  2P20 A;  4DV6 C;  3IML A;  4DV0 C;  4RVO A;  3RG2 A;  3UZ0 A;  2D28 C;  4HPV A;  5A1G A;  4DUZ C;  4LF7 C;  4X64 C;  4B3R C;  1EGA A;  1WH9 A;  2WD9 A;  1O92 A;  2D27 A;  2E0G A;  1BA3 A;  3LNV A;  4RLF A;  1N2F A;  2D1S A;  5BR8 C;  5IWA C;  4DR2 C;  1I94 C;  1XMO C;  4WV3 A;  2YWB A;  1RG9 A;  3H2T A;  1P4E A;  4RM3 A;  2E7G A;  2CY1 A;  3DHV A;  4G37 A;  2UUB C;  5AE2 A;  2MMA B;  4NDN A;  2YWC A;  4OXI A;  4ODJ A;  4L7I A;  2P2B A;  1HH2 P;  1UKK A;  3UEB A;  5KEI A;  5A1I A;  5IT9 D;  2P02 A;  3DAY A;  4WS9 A;  4NXN C;  3EQ6 A;  1ZB8 A;  3NYQ A;  3GPC A;  1LCI A;  4GXR A;  2Z51 A;  4JI3 C;  2KZ0 A;  3LAX A;  4DCU A;  3T1H C;  2DYJ A;  2VSQ A;  4RMN A;  5BSU A;  3CQ1 A;  4LFC C;  4ZLP A;  4X62 C;  5KYV A;  3C5E A;  4I9G A;  1O93 A;  2P2J A;  1USP B;  2DHM A;  2EGT A;  4DR3 C;  4B3M C;  4BBY A;  3AF5 A;  4DCS A;  4FUQ A;  4DV5 C;  4X66 C;  5BSR A;  2MM9 A;  2QVX X;  5A2Q D;  4B3T C;  1J5E C;  2ATW A;  1T5H X;  5BST A;  1WCJ A;  3TUF A;  4G1I A;  3O2E A;  1HNZ C;  1MDB A;  1AMU A;  3AY0 A;  5BUQ A;  3CQ3 A;  4JM1 A;  4IR7 A;  2ONF A;  3R44 A;  4PHT A;  3A9V A;  2UUA C;  1PG4 A;  4GKJ C;  4LF5 C;  4DV2 C;  3NYR A;  1USP A;  2UXC C;  3I07 A;  2ZZM A;  3PRO C;  1MXB A;  4MH4 A;  4LFA C;  3R9W A;  5LMN C;  1TH5 A;  5T8S A;  1MXC A;  4L2Z A;  4D4G A;  1KKG A;  5BUR A;  2DPL A;  1RY2 A;  3L8C A;  4U5Y D;  5BSV A;  4RLQ A;  3A9U A;  3G7S A;  4FTF A;  3FCE A;  2D1R A;  4DV3 C;  1MDF A;  2PT7 G;  1VEH A;  1V25 A;  1XRA A;  3GKU A;  1XS3 A;  4R1M A;  1M6X C;  1ULT A;  1MKY A;  3UOW A;  4ZJZ A;  2E5L C;  1XNQ C;  3FM7 A;  1MD9 A;  4BCA A;  2JNV A;  4LF8 C;  4JI0 C;  3N54 B;  4LF9 C;  4PZP A;  2UU9 C;  1QWI A;  1XHJ A;  4KHP C;  1FLO A;  3DLP X;  4MTN A;  3JAM D;  4R0M A;  4JI6 C;  5LMU C;  2HJG A;  3PBK A;  2QL8 A;  5CZV A;  2QW0 X;  3L95 X;  3PES A;  4PUH A;  2UXB C;  3LNO A;  5DV9 A;  3K6R A;  4DR4 C;  2VQE C;  4NXM C;  1JOS A;  4R1L A;  4DV1 C;  2M5O A;  4D56 A;  1PU1 A;  2D7V A;  3IPL A;  4EAT A;  2Y4N A;  3NPD A;  3TR3 A;  1N36 C;  2E8E A;  2MCQ A;  4TPS B;  2ZM6 C;  3J81 D;  4DV4 C;  3ETC A;  1PG3 A;  2D1Q A;  4DCV A;  1VLA A;  1L2F A;  5ADZ A;  2PRO A;  3AF6 A;  3TQI A;  3LGX A;  5T8T A;  2UXD C;  3I08 A;  4JI8 C;  3SO4 A;  1T5D X;  4JV5 C;  4PUI A;  4AQY C;  1P7L A;  4DG9 A;  4BSZ A;  3IEV A;  2ZTB A;  4GKK C;  3J80 D;  1GPM A;  4KTT A;  4X65 C;  4IZ6 A;  3B7W A;  3CW9 A;  1HNW C;  2E8C A;  2XR1 A;  4DCT A;  4XX2 A;  2HHH C;  5CZX A;  1M6X A;  4D4I A;  2WP0 C;  1LQL A;  2KZF A;  1V60 A;  1XRC A;  3A25 A;  4DV7 C;  5AE3 A;  1UWD A;  4YHH C;  4GS5 A;  4RM2 A;  3T1Y C;  3OTO C;  1K0R A;  4JI7 C;  2P2M A;  5H9U A;  1PA4 A;  5AE1 A;  1WF3 A;  4DR5 C;  2OBV A;  4NOZ A;  4OYC A;  1YJ7 A;  1XNR C;  4LE5 A;  5JRH A;  2YCB A;  3UX3 A; 
#chains in the Genus database with same CATH homology
 5A19 A;  1NYE A;  4B3S C;  4GXQ A;  1N32 C;  3S82 A;  4D57 A;  1MXA A;  4DR6 C;  4LF4 C;  3ETO A;  2Y27 A;  1HNX C;  3CJE A;  5BSW A;  5BUS A;  2OPL A;  1V26 A;  4JI2 C;  4LFB C;  4L4Q A;  2VQF C;  4DUY C;  1HR0 C;  3GR0 A;  3VNR A;  2V7B A;  4JI1 C;  3KXW A;  2ASB A;  2QVZ X;  5E7Q A;  1XRB A;  2VZE A;  5FLX D;  2BH1 X;  3N2Q A;  4G36 A;  1IBK C;  2D1T A;  2UUC C;  3NI2 A;  2P2Q A;  3A4I A;  1N34 C;  2F4V C;  4K0K C;  4KTV A;  1O90 A;  5K85 A;  3LUS A;  4BC7 A;  5BSM A;  2CXC A;  4DG8 A;  4JI4 C;  2P2F A;  1FJG C;  2PN2 A;  1O9T A;  4YY3 C;  4BC9 A;  1QM4 A;  1N33 C;  4I9F A;  5GTD A;  1IBL C;  4RVN A;  3EER A;  2JMP A;  3VNQ A;  3E7W A;  3CW8 X;  2OO4 A;  1ML8 A;  2E8F A;  4DR7 C;  3J7A D;  3FCC A;  4ISB A;  4DR1 C;  1ZB9 A;  3VNS A;  3IEU A;  5K8F A;  4FUT A;  5IFI A;  2QVY X;  4K0B A;  3E7X A;  4JYA C;  1IBM C;  4OX9 C;  3TDE A;  2AYA A;  4LF6 C;  3RV2 A;  3R9X A;  2BJO A;  3GR1 A;  5KYT A;  4PRO C;  1FUG A;  2OPL B;  1XMQ C;  2Y4O A;  4JI5 C;  2P20 A;  4DV6 C;  3IML A;  4DV0 C;  4RVO A;  3RG2 A;  3UZ0 A;  2D28 C;  4HPV A;  5A1G A;  4DUZ C;  4LF7 C;  4X64 C;  4B3R C;  1EGA A;  1WH9 A;  2WD9 A;  1O92 A;  2D27 A;  2E0G A;  1BA3 A;  3LNV A;  4RLF A;  1N2F A;  2D1S A;  5BR8 C;  5IWA C;  4DR2 C;  1I94 C;  1XMO C;  4WV3 A;  2YWB A;  1RG9 A;  3H2T A;  4RM3 A;  2E7G A;  2CY1 A;  3DHV A;  4G37 A;  2UUB C;  5AE2 A;  4NDN A;  2YWC A;  4OXI A;  4ODJ A;  4L7I A;  2P2B A;  1HH2 P;  1UKK A;  5KEI A;  5A1I A;  5IT9 D;  2P02 A;  3DAY A;  4WS9 A;  4NXN C;  3EQ6 A;  1ZB8 A;  3NYQ A;  3GPC A;  1LCI A;  4GXR A;  4JI3 C;  3LAX A;  4DCU A;  3T1H C;  2DYJ A;  2VSQ A;  4RMN A;  5BSU A;  4LFC C;  4ZLP A;  4X62 C;  5KYV A;  3C5E A;  4I9G A;  1O93 A;  2P2J A;  1USP B;  2EGT A;  4DR3 C;  4B3M C;  4BBY A;  3AF5 A;  4DCS A;  4FUQ A;  4DV5 C;  4X66 C;  5BSR A;  2QVX X;  5A2Q D;  4B3T C;  1J5E C;  2ATW A;  1T5H X;  5BST A;  3TUF A;  4G1I A;  1HNZ C;  1MDB A;  1AMU A;  5BUQ A;  4JM1 A;  4IR7 A;  2ONF A;  3R44 A;  4PHT A;  3A9V A;  2UUA C;  1PG4 A;  4GKJ C;  4LF5 C;  4DV2 C;  3NYR A;  1USP A;  2UXC C;  3I07 A;  3PRO C;  1MXB A;  4MH4 A;  4LFA C;  3R9W A;  5LMN C;  5T8S A;  1MXC A;  4L2Z A;  4D4G A;  1KKG A;  5BUR A;  2DPL A;  1RY2 A;  3L8C A;  4U5Y D;  5BSV A;  4RLQ A;  3A9U A;  3G7S A;  4FTF A;  4DV3 C;  3FCE A;  2D1R A;  1MDF A;  2PT7 G;  1V25 A;  1XRA A;  3GKU A;  4R1M A;  1ULT A;  1MKY A;  3UOW A;  4ZJZ A;  2E5L C;  1XNQ C;  1MD9 A;  4BCA A;  4LF8 C;  4JI0 C;  3N54 B;  4LF9 C;  4PZP A;  2UU9 C;  1QWI A;  4KHP C;  3DLP X;  4MTN A;  3JAM D;  4R0M A;  4JI6 C;  5LMU C;  2HJG A;  3PBK A;  2QL8 A;  5CZV A;  2QW0 X;  3L95 X;  3PES A;  2UXB C;  5DV9 A;  4DR4 C;  2VQE C;  4NXM C;  1JOS A;  4R1L A;  4DV1 C;  4D56 A;  2D7V A;  3IPL A;  4EAT A;  2Y4N A;  3NPD A;  1N36 C;  2E8E A;  4TPS B;  2ZM6 C;  3J81 D;  4DV4 C;  3ETC A;  1PG3 A;  2D1Q A;  4DCV A;  1VLA A;  1L2F A;  5ADZ A;  2PRO A;  3AF6 A;  3TQI A;  3LGX A;  5T8T A;  2UXD C;  3I08 A;  4JI8 C;  3SO4 A;  1T5D X;  4JV5 C;  4AQY C;  1P7L A;  4DG9 A;  4BSZ A;  3IEV A;  4GKK C;  3J80 D;  1GPM A;  4KTT A;  4X65 C;  4IZ6 A;  3B7W A;  3CW9 A;  1HNW C;  2E8C A;  2XR1 A;  4DCT A;  4XX2 A;  2HHH C;  5CZX A;  4D4I A;  2WP0 C;  1LQL A;  2KZF A;  1XRC A;  4DV7 C;  5AE3 A;  4YHH C;  4GS5 A;  4RM2 A;  3T1Y C;  3OTO C;  1K0R A;  4JI7 C;  2P2M A;  5H9U A;  1PA4 A;  5AE1 A;  1WF3 A;  4DR5 C;  2OBV A;  4NOZ A;  4OYC A;  1YJ7 A;  1XNR C;  4LE5 A;  5JRH A;  2YCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...