1N33C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n33C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n33C02
3J81D 2ATWA 2BJOA 4JI1C 4YHHC 4DR1C 4DV7C 4JI6C 2PT7G 4DCTA 3I07A 4JI0C 3OTOC 4JYAC 4DV3C 3CJEA 1XNQC 2VQFC 4JV5C 4KHPC 2HJGA 3IEVA 2OPLA 4JI2C 2E8EA 2ZM6C 1IBLC 3J80D 1HR0C 2UU9C 4B3MC 1LQLA 3R9XA 2E8FA 3EERA 5BR8C 2KZFA 1I94C 1JOSA 3R9WA 1WF3A 2VQEC 1KKGA 2JMPA 1HH2P 4DV2C 4DR6C 2ONFA 2OPLB 2CY1A 2UXCC 4LFCC 4DV1C 4GKKC 4JI7C 3T1HC 4DV4C 1UKKA 1J5EC 4B3TC 1ZB9A 3AF5A 5IT9D 2E8CA 4DCUA 1HNZC 4MTNA 5FLXD 2YCBA 4X62C 4DV6C 4LFAC 3IEUA 3GKUA 5IWAC 1FJGC 2UXBC 4NXMC 1N33C 4X66C 4DCVA 4JI3C 2E5LC 1MKYA 1XNRC 2XR1A 1N32C 4DCSA 4BSZA 4X65C 2HHHC 4LF9C 4LF5C 4NXNC 2ASBA 1N2FA 1N34C 1IBKC 4OX9C 4XX2A 4JI5C 2D7VA 4YY3C 4JI8C 5LMUC 4LF8C 3T1YC 4DR3C 4B3RC 2PN2A 4LFBC 1ZB8A 2UUAC 4DR7C 4DR2C 4LF6C 2CXCA 4NOZA 4X64C 4DR4C 1HNWC 1USPA 3LUSA 1HNXC 1VLAA 1IBMC 2F4VC 4JI4C 2EGTA 5LMNC 1PA4A 2QL8A 3JAMD 4DV0C 4DV5C 5A2QD 2UUCC 1NYEA 4DUZC 4LF4C 2UXDC 1XMOC 1ML8A 1WH9A 2E7GA 1L2FA 3J7AD 3AF6A 1USPB 4MH4A 2UUBC 4DR5C 2DYJA 1K0RA 4B3SC 4K0KC 1N36C 1XMQC 4GKJC 4AQYC 4LF7C 1QWIA 4DUYC 1EGAA
chains in the Genus database with same CATH superfamily
4ISBA 3KXWA 2BJOA 3GR1A 5A1IA 4DV7C 5BSUA 3L95X 4JI0C 4DV3C 3NI2A 3IEVA 3GR0A 4BC9A 1LCIA 3O2EA 3J80D 1RG9A 2ZTBA 4B3MC 1T5HX 3R9WA 1WF3A 2JMPA 2Y4OA 2D1TA 4DV1C 1M6XC 1BA3A 1P7LA 3B7WA 4ODJA 3T1HC 1QM4A 1M6XA 4MTNA 1O93A 1V25A 3UZ0A 1P4EC 2NCLA 4NXMC 4X66C 2E5LC 3C5EA 4KTTA 3FCEA 2XR1A 4DCSA 4X65C 4PHTA 3CW8X 4JM1A 1FLOA 2ASBA 2E0GA 1IBKC 4OX9C 4JI5C 4JI8C 4RM2A 4B3RC 3H2TA 3PESA 3UOWA 4DR7C 2CXCA 2Y4NA 4X64C 1USPA 3LUSA 1MDFA 1HNXC 2D27A 4R0MA 5AE2A 3JAMD 4DUZC 2QVXX 2E7GA 1L2FA 3A4IA 3AF6A 5CZVA 2DPLA 4MH4A 4DR5C 4HPVA 5E7QA 4D57A 3A9VA 4LF7C 3E7WA 4DUYC 2VZEA 2WP0C 3J81D 3SO4A 3NYRA 3DHVA 5BSRA 4JI1C 4DR1C 5BSWA 1AMUA 4JI6C 3I07A 2AYAA 2VQFC 4JV5C 4KHPC 2VSQA 3FM7A 4LE5A 3A25A 5LCIA 4OYCA 3EQ6A 2D1QA 2E8FA 3EERA 1I94C 1O9TA 4I9FA 3VNRA 2UXCC 4PROC 2ZZMA 3NPDA 3UEBA 3UX3A 4DV4C 4RMNA 4FUTA 4K0BA 2P2JA 2YCBA 4DV6C 4LFAC 3GKUA 5BSTA 1FUGA 2V7BA 4DCVA 3LAXA 2M5HA 4G37A 1V26A 3PBKA 3PROC 4BC7A 2HHHC 3IPLA 4LF5C 4LF9C 5BUQA 1N2FA 4D4IA 5LMUC 4LF8C 2JNVA 4DR3C 4LFBC 3ETCA 3K6RA 3IMLA 1MDBA 2PROA 4NOZA 3R44A 4U5YD 4JI4C 5LMNC 3AY0A 2UUCC 5KYTA 4R1LA 2UXDC 4G36A 5BUSA 4ZJZA 2QVYX 2DYJA 3CQ1A 1PU1A 4K0KC 4PUIA 3GPCA 2MCQA 4GXRA 5T8SA 2ATWA 1MXBA 1XRCA 4YHHC 3DLPX 3UX2A 3NYQA 4DCTA 5BSMA 3CJEA 1XNQC 5K85A 2HJGA 2KZ0A 1PG4A 2YWBA 5DV9A 2P20A 1ULTA 4JI2C 5JRHA 4TPSB 4RVOA 2E8EA 2ZM6C 4IZ6A 3CQ3A 2UU9C 4IR7A 4RM3A 3R9XA 4L4QA 2ZZNA 3N54B 1HH2P 5AE1A 4DV2C 4DR6C 2ONFA 2OPLB 2CY1A 3I08A 4LFCC 3TDEA 4GKKC 5ADZA 4PZPA 1J5EC 4B3TC 3AF5A 4DCUA 3TR3A 4NDNA 1HNZC 3G7SA 5FLXD 2P2MA 4X62C 3IEUA 3LGXA 1FJGC 2UXBC 3L8CA 2PG1E 3TUFA 1MD9A 1XNRC 1GPMA 3CW9A 3N2QA 5IFIA 1N32C 4FTFA 1XRAA 4NXNC 1N34C 1XRBA 5KEIA 2D7VA 5A1GA 1ZB8A 2M5OA 2UUAC 4EATA 4LF6C 2P2BA 4FUQA 1WCJA 3A9UA 2D1RA 2YWCA 1VLAA 1IBMC 2F4VC 2EGTA 4DG8A 2BH1X 2QL8A 2Y27A 5BSVA 4DV5C 5A2QD 4BCAA 4LF4C 3DAYA 4WS9A 5GTDA 5T8TA 4BBYA 4RLFA 2D28C 4PUGA 5CZXA 2UUBC 4RLQA 1N36C 4G1IA 1T5DX 2Z51A 1VEHA 4R1MA 1EGAA 1XHJA 4GXQA 4D56A 4I9GA 5H9UA 2OO4A 3E7XA 2PT7G 4PUHA 3OTOC 4D4GA 4JYAC 4OXIA 3S82A 2OPLA 3LNOA 2P2FA 1PG3A 1V60A 4DG9A 5BURA 1IBLC 1HR0C 4GS5A 1XS3A 2YX1A 1LQLA 5KYVA 5BR8C 2KZFA 1MXAA 1O92A 1JOSA 1KKGA 2VQEC 4L2ZA 1P4EA 1UWDA 2D1SA 1RY2A 4JI7C 1UKKA 5AE3A 1IB8A 2MM9A 1ZB9A 5IT9D 2QVZX 2E8CA 4L7IA 3RG2A 1XDXA 1MXCA 3TQIA 5IWAC 1YJ7A 1N33C 4JI3C 1MKYA 3VNQA 2P2QA 3A26A 4KTVA 3ETOA 2QW0X 4BSZA 1YGTA 4XX2A 3CQ2A 3VNSA 4YY3C 5A19A 4RVNA 3T1YC 2PN2A 4DR2C 4DR4C 1HNWC 1TH5A 4WV3A 2P02A 3LNVA 3RV2A 3FCCA 4ZLPA 1PA4A 4DV0C 1NYEA 1XMOC 1ML8A 1NY8A 1WH9A 2CU6A 5K8FA 3J7AD 1O90A 2WD9A 1USPB 2OBVA 1K0RA 2KDNA 4B3SC 2MMAB 1XMQC 4GKJC 2DHMA 4AQYC 1QWIA
chains in the Genus database with same CATH topology
4ISBA 3KXWA 2BJOA 3GR1A 5A1IA 4DV7C 5BSUA 3L95X 4JI0C 4DV3C 3NI2A 3IEVA 3GR0A 4BC9A 1LCIA 3J80D 1RG9A 4B3MC 1T5HX 3R9WA 1WF3A 2JMPA 2Y4OA 2D1TA 4DV1C 1BA3A 1P7LA 3B7WA 4ODJA 3T1HC 1QM4A 4MTNA 1O93A 1V25A 3UZ0A 4NXMC 4X66C 2E5LC 3C5EA 4KTTA 3FCEA 2XR1A 4DCSA 4X65C 4PHTA 3CW8X 4JM1A 2ASBA 2E0GA 1IBKC 4OX9C 4JI5C 4JI8C 4RM2A 4B3RC 3H2TA 3PESA 3UOWA 4DR7C 2CXCA 2Y4NA 4X64C 1USPA 3LUSA 1MDFA 1HNXC 2D27A 4R0MA 5AE2A 3JAMD 4DUZC 2QVXX 2E7GA 1L2FA 3A4IA 3AF6A 5CZVA 2DPLA 4MH4A 4DR5C 4HPVA 5E7QA 4D57A 3A9VA 4LF7C 4DUYC 3E7WA 2VZEA 2WP0C 3J81D 3SO4A 3NYRA 3DHVA 5BSRA 4JI1C 4DR1C 5BSWA 1AMUA 4JI6C 3I07A 2AYAA 2VQFC 4JV5C 4KHPC 2VSQA 4LE5A 4OYCA 3EQ6A 2D1QA 2E8FA 3EERA 1I94C 1O9TA 4I9FA 3VNRA 2UXCC 4PROC 3NPDA 4DV4C 4RMNA 4FUTA 4K0BA 2P2JA 2YCBA 4DV6C 4LFAC 3GKUA 5BSTA 1FUGA 2V7BA 4DCVA 3LAXA 4G37A 1V26A 3PBKA 3PROC 4BC7A 2HHHC 3IPLA 4LF5C 4LF9C 5BUQA 1N2FA 4D4IA 5LMUC 4LF8C 4DR3C 4LFBC 3ETCA 3IMLA 1MDBA 2PROA 4NOZA 3R44A 4U5YD 4JI4C 5LMNC 2UUCC 5KYTA 4R1LA 2UXDC 4G36A 5BUSA 4ZJZA 2QVYX 2DYJA 4K0KC 3GPCA 4GXRA 5T8SA 2ATWA 1MXBA 1XRCA 4YHHC 3DLPX 3NYQA 4DCTA 5BSMA 3CJEA 1XNQC 5K85A 2HJGA 1PG4A 2YWBA 5DV9A 2P20A 1ULTA 4JI2C 5JRHA 4TPSB 4RVOA 2E8EA 2ZM6C 4IZ6A 2UU9C 4IR7A 4RM3A 3R9XA 4L4QA 3N54B 1HH2P 5AE1A 4DV2C 4DR6C 2ONFA 2OPLB 2CY1A 3I08A 4LFCC 3TDEA 4GKKC 5ADZA 4PZPA 1J5EC 4B3TC 3AF5A 4DCUA 1HNZC 4NDNA 3G7SA 5FLXD 2P2MA 4X62C 3IEUA 3LGXA 1FJGC 2UXBC 3L8CA 3TUFA 1MD9A 1XNRC 1GPMA 3CW9A 3N2QA 5IFIA 1N32C 4FTFA 1XRAA 4NXNC 1N34C 1XRBA 5KEIA 2D7VA 5A1GA 1ZB8A 2UUAC 4EATA 4LF6C 2P2BA 4FUQA 3A9UA 2D1RA 2YWCA 1VLAA 1IBMC 2F4VC 2EGTA 4DG8A 2BH1X 2QL8A 2Y27A 5BSVA 4DV5C 5A2QD 4BCAA 4LF4C 3DAYA 4WS9A 5GTDA 5T8TA 4BBYA 4RLFA 2D28C 5CZXA 2UUBC 4RLQA 1N36C 4G1IA 1T5DX 4R1MA 1EGAA 4GXQA 4D56A 4I9GA 5H9UA 2OO4A 3E7XA 2PT7G 3OTOC 4D4GA 4JYAC 4OXIA 3S82A 2OPLA 2P2FA 1PG3A 4DG9A 5BURA 1IBLC 1HR0C 4GS5A 1LQLA 5KYVA 5BR8C 2KZFA 1MXAA 1O92A 1JOSA 1KKGA 2VQEC 4L2ZA 2D1SA 1RY2A 4JI7C 1UKKA 5AE3A 1ZB9A 5IT9D 2QVZX 2E8CA 4L7IA 3RG2A 1MXCA 3TQIA 5IWAC 1YJ7A 1N33C 4JI3C 1MKYA 3VNQA 2P2QA 4KTVA 3ETOA 2QW0X 4BSZA 4XX2A 3VNSA 4YY3C 5A19A 4RVNA 3T1YC 2PN2A 4DR2C 4DR4C 1HNWC 4WV3A 2P02A 3LNVA 3RV2A 3FCCA 4ZLPA 1PA4A 4DV0C 1NYEA 1XMOC 1ML8A 1WH9A 5K8FA 3J7AD 1O90A 2WD9A 1USPB 2OBVA 1K0RA 4B3SC 1XMQC 4GKJC 4AQYC 1QWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 D;  2ATW A;  2BJO A;  4JI1 C;  4YHH C;  4DR1 C;  4DV7 C;  4JI6 C;  2PT7 G;  4DCT A;  3I07 A;  4JI0 C;  3OTO C;  4JYA C;  4DV3 C;  3CJE A;  1XNQ C;  2VQF C;  4JV5 C;  4KHP C;  2HJG A;  3IEV A;  2OPL A;  4JI2 C;  2E8E A;  2ZM6 C;  1IBL C;  3J80 D;  1HR0 C;  2UU9 C;  4B3M C;  1LQL A;  3R9X A;  2E8F A;  3EER A;  5BR8 C;  2KZF A;  1I94 C;  1JOS A;  3R9W A;  1WF3 A;  2VQE C;  1KKG A;  2JMP A;  1HH2 P;  4DV2 C;  4DR6 C;  2ONF A;  2OPL B;  2CY1 A;  2UXC C;  4LFC C;  4DV1 C;  4GKK C;  4JI7 C;  3T1H C;  4DV4 C;  1UKK A;  1J5E C;  4B3T C;  1ZB9 A;  3AF5 A;  5IT9 D;  2E8C A;  4DCU A;  1HNZ C;  4MTN A;  5FLX D;  2YCB A;  4X62 C;  4DV6 C;  4LFA C;  3IEU A;  3GKU A;  5IWA C;  1FJG C;  2UXB C;  4NXM C;  1N33 C;  4X66 C;  4DCV A;  4JI3 C;  2E5L C;  1MKY A;  1XNR C;  2XR1 A;  1N32 C;  4DCS A;  4BSZ A;  4X65 C;  2HHH C;  4LF9 C;  4LF5 C;  4NXN C;  2ASB A;  1N2F A;  1N34 C;  1IBK C;  4OX9 C;  4XX2 A;  4JI5 C;  2D7V A;  4YY3 C;  4JI8 C;  5LMU C;  4LF8 C;  3T1Y C;  4DR3 C;  4B3R C;  2PN2 A;  4LFB C;  1ZB8 A;  2UUA C;  4DR7 C;  4DR2 C;  4LF6 C;  2CXC A;  4NOZ A;  4X64 C;  4DR4 C;  1HNW C;  1USP A;  3LUS A;  1HNX C;  1VLA A;  1IBM C;  2F4V C;  4JI4 C;  2EGT A;  5LMN C;  1PA4 A;  2QL8 A;  3JAM D;  4DV0 C;  4DV5 C;  5A2Q D;  2UUC C;  1NYE A;  4DUZ C;  4LF4 C;  2UXD C;  1XMO C;  1ML8 A;  1WH9 A;  2E7G A;  1L2F A;  3J7A D;  3AF6 A;  1USP B;  4MH4 A;  2UUB C;  4DR5 C;  2DYJ A;  1K0R A;  4B3S C;  4K0K C;  1N36 C;  1XMQ C;  4GKJ C;  4AQY C;  4LF7 C;  1QWI A;  4DUY C;  1EGA A; 
#chains in the Genus database with same CATH topology
 4ISB A;  3KXW A;  2BJO A;  3GR1 A;  5A1I A;  4DV7 C;  5BSU A;  3L95 X;  4JI0 C;  4DV3 C;  3NI2 A;  3IEV A;  3GR0 A;  4BC9 A;  1LCI A;  3O2E A;  3J80 D;  1RG9 A;  2ZTB A;  4B3M C;  1T5H X;  3R9W A;  1WF3 A;  2JMP A;  2Y4O A;  2D1T A;  4DV1 C;  1M6X C;  1BA3 A;  1P7L A;  3B7W A;  4ODJ A;  3T1H C;  1QM4 A;  1M6X A;  4MTN A;  1O93 A;  1V25 A;  3UZ0 A;  1P4E C;  2NCL A;  4NXM C;  4X66 C;  2E5L C;  3C5E A;  4KTT A;  3FCE A;  2XR1 A;  4DCS A;  4X65 C;  4PHT A;  3CW8 X;  4JM1 A;  1FLO A;  2ASB A;  2E0G A;  1IBK C;  4OX9 C;  4JI5 C;  4JI8 C;  4RM2 A;  4B3R C;  3H2T A;  3PES A;  3UOW A;  4DR7 C;  2CXC A;  2Y4N A;  4X64 C;  1USP A;  3LUS A;  1MDF A;  1HNX C;  2D27 A;  4R0M A;  5AE2 A;  3JAM D;  4DUZ C;  2QVX X;  2E7G A;  1L2F A;  3A4I A;  3AF6 A;  5CZV A;  2DPL A;  4MH4 A;  4DR5 C;  4HPV A;  5E7Q A;  4D57 A;  3A9V A;  4LF7 C;  3E7W A;  4DUY C;  2VZE A;  2WP0 C;  3J81 D;  3SO4 A;  3NYR A;  3DHV A;  5BSR A;  4JI1 C;  4DR1 C;  5BSW A;  1AMU A;  4JI6 C;  3I07 A;  2AYA A;  2VQF C;  4JV5 C;  4KHP C;  2VSQ A;  3FM7 A;  4LE5 A;  3A25 A;  5LCI A;  4OYC A;  3EQ6 A;  2D1Q A;  2E8F A;  3EER A;  1I94 C;  1O9T A;  4I9F A;  3VNR A;  2UXC C;  4PRO C;  2ZZM A;  3NPD A;  3UEB A;  3UX3 A;  4DV4 C;  4RMN A;  4FUT A;  4K0B A;  2P2J A;  2YCB A;  4DV6 C;  4LFA C;  3GKU A;  5BST A;  1FUG A;  2V7B A;  4DCV A;  3LAX A;  2M5H A;  4G37 A;  1V26 A;  3PBK A;  3PRO C;  4BC7 A;  2HHH C;  3IPL A;  4LF5 C;  4LF9 C;  5BUQ A;  1N2F A;  4D4I A;  5LMU C;  4LF8 C;  2JNV A;  4DR3 C;  4LFB C;  3ETC A;  3K6R A;  3IML A;  1MDB A;  2PRO A;  4NOZ A;  3R44 A;  4U5Y D;  4JI4 C;  5LMN C;  3AY0 A;  2UUC C;  5KYT A;  4R1L A;  2UXD C;  4G36 A;  5BUS A;  4ZJZ A;  2QVY X;  2DYJ A;  3CQ1 A;  1PU1 A;  4K0K C;  4PUI A;  3GPC A;  2MCQ A;  4GXR A;  5T8S A;  2ATW A;  1MXB A;  1XRC A;  4YHH C;  3DLP X;  3UX2 A;  3NYQ A;  4DCT A;  5BSM A;  3CJE A;  1XNQ C;  5K85 A;  2HJG A;  2KZ0 A;  1PG4 A;  2YWB A;  5DV9 A;  2P20 A;  1ULT A;  4JI2 C;  5JRH A;  4TPS B;  4RVO A;  2E8E A;  2ZM6 C;  4IZ6 A;  3CQ3 A;  2UU9 C;  4IR7 A;  4RM3 A;  3R9X A;  4L4Q A;  2ZZN A;  3N54 B;  1HH2 P;  5AE1 A;  4DV2 C;  4DR6 C;  2ONF A;  2OPL B;  2CY1 A;  3I08 A;  4LFC C;  3TDE A;  4GKK C;  5ADZ A;  4PZP A;  1J5E C;  4B3T C;  3AF5 A;  4DCU A;  3TR3 A;  4NDN A;  1HNZ C;  3G7S A;  5FLX D;  2P2M A;  4X62 C;  3IEU A;  3LGX A;  1FJG C;  2UXB C;  3L8C A;  2PG1 E;  3TUF A;  1MD9 A;  1XNR C;  1GPM A;  3CW9 A;  3N2Q A;  5IFI A;  1N32 C;  4FTF A;  1XRA A;  4NXN C;  1N34 C;  1XRB A;  5KEI A;  2D7V A;  5A1G A;  1ZB8 A;  2M5O A;  2UUA C;  4EAT A;  4LF6 C;  2P2B A;  4FUQ A;  1WCJ A;  3A9U A;  2D1R A;  2YWC A;  1VLA A;  1IBM C;  2F4V C;  2EGT A;  4DG8 A;  2BH1 X;  2QL8 A;  2Y27 A;  5BSV A;  4DV5 C;  5A2Q D;  4BCA A;  4LF4 C;  3DAY A;  4WS9 A;  5GTD A;  5T8T A;  4BBY A;  4RLF A;  2D28 C;  4PUG A;  5CZX A;  2UUB C;  4RLQ A;  1N36 C;  4G1I A;  1T5D X;  2Z51 A;  1VEH A;  4R1M A;  1EGA A;  1XHJ A;  4GXQ A;  4D56 A;  4I9G A;  5H9U A;  2OO4 A;  3E7X A;  2PT7 G;  4PUH A;  3OTO C;  4D4G A;  4JYA C;  4OXI A;  3S82 A;  2OPL A;  3LNO A;  2P2F A;  1PG3 A;  1V60 A;  4DG9 A;  5BUR A;  1IBL C;  1HR0 C;  4GS5 A;  1XS3 A;  2YX1 A;  1LQL A;  5KYV A;  5BR8 C;  2KZF A;  1MXA A;  1O92 A;  1JOS A;  1KKG A;  2VQE C;  4L2Z A;  1P4E A;  1UWD A;  2D1S A;  1RY2 A;  4JI7 C;  1UKK A;  5AE3 A;  1IB8 A;  2MM9 A;  1ZB9 A;  5IT9 D;  2QVZ X;  2E8C A;  4L7I A;  3RG2 A;  1XDX A;  1MXC A;  3TQI A;  5IWA C;  1YJ7 A;  1N33 C;  4JI3 C;  1MKY A;  3VNQ A;  2P2Q A;  3A26 A;  4KTV A;  3ETO A;  2QW0 X;  4BSZ A;  1YGT A;  4XX2 A;  3CQ2 A;  3VNS A;  4YY3 C;  5A19 A;  4RVN A;  3T1Y C;  2PN2 A;  4DR2 C;  4DR4 C;  1HNW C;  1TH5 A;  4WV3 A;  2P02 A;  3LNV A;  3RV2 A;  3FCC A;  4ZLP A;  1PA4 A;  4DV0 C;  1NYE A;  1XMO C;  1ML8 A;  1NY8 A;  1WH9 A;  2CU6 A;  5K8F A;  3J7A D;  1O90 A;  2WD9 A;  1USP B;  2OBV A;  1K0R A;  2KDN A;  4B3S C;  2MMA B;  1XMQ C;  4GKJ C;  2DHM A;  4AQY C;  1QWI A; 
#chains in the Genus database with same CATH homology
 4ISB A;  3KXW A;  2BJO A;  3GR1 A;  5A1I A;  4DV7 C;  5BSU A;  3L95 X;  4JI0 C;  4DV3 C;  3NI2 A;  3IEV A;  3GR0 A;  4BC9 A;  1LCI A;  3J80 D;  1RG9 A;  4B3M C;  1T5H X;  3R9W A;  1WF3 A;  2JMP A;  2Y4O A;  2D1T A;  4DV1 C;  1BA3 A;  1P7L A;  3B7W A;  4ODJ A;  3T1H C;  1QM4 A;  4MTN A;  1O93 A;  1V25 A;  3UZ0 A;  4NXM C;  4X66 C;  2E5L C;  3C5E A;  4KTT A;  3FCE A;  2XR1 A;  4DCS A;  4X65 C;  4PHT A;  3CW8 X;  4JM1 A;  2ASB A;  2E0G A;  1IBK C;  4OX9 C;  4JI5 C;  4JI8 C;  4RM2 A;  4B3R C;  3H2T A;  3PES A;  3UOW A;  4DR7 C;  2CXC A;  2Y4N A;  4X64 C;  1USP A;  3LUS A;  1MDF A;  1HNX C;  2D27 A;  4R0M A;  5AE2 A;  3JAM D;  4DUZ C;  2QVX X;  2E7G A;  1L2F A;  3A4I A;  3AF6 A;  5CZV A;  2DPL A;  4MH4 A;  4DR5 C;  4HPV A;  5E7Q A;  4D57 A;  3A9V A;  4LF7 C;  4DUY C;  3E7W A;  2VZE A;  2WP0 C;  3J81 D;  3SO4 A;  3NYR A;  3DHV A;  5BSR A;  4JI1 C;  4DR1 C;  5BSW A;  1AMU A;  4JI6 C;  3I07 A;  2AYA A;  2VQF C;  4JV5 C;  4KHP C;  2VSQ A;  4LE5 A;  4OYC A;  3EQ6 A;  2D1Q A;  2E8F A;  3EER A;  1I94 C;  1O9T A;  4I9F A;  3VNR A;  2UXC C;  4PRO C;  3NPD A;  4DV4 C;  4RMN A;  4FUT A;  4K0B A;  2P2J A;  2YCB A;  4DV6 C;  4LFA C;  3GKU A;  5BST A;  1FUG A;  2V7B A;  4DCV A;  3LAX A;  4G37 A;  1V26 A;  3PBK A;  3PRO C;  4BC7 A;  2HHH C;  3IPL A;  4LF5 C;  4LF9 C;  5BUQ A;  1N2F A;  4D4I A;  5LMU C;  4LF8 C;  4DR3 C;  4LFB C;  3ETC A;  3IML A;  1MDB A;  2PRO A;  4NOZ A;  3R44 A;  4U5Y D;  4JI4 C;  5LMN C;  2UUC C;  5KYT A;  4R1L A;  2UXD C;  4G36 A;  5BUS A;  4ZJZ A;  2QVY X;  2DYJ A;  4K0K C;  3GPC A;  4GXR A;  5T8S A;  2ATW A;  1MXB A;  1XRC A;  4YHH C;  3DLP X;  3NYQ A;  4DCT A;  5BSM A;  3CJE A;  1XNQ C;  5K85 A;  2HJG A;  1PG4 A;  2YWB A;  5DV9 A;  2P20 A;  1ULT A;  4JI2 C;  5JRH A;  4TPS B;  4RVO A;  2E8E A;  2ZM6 C;  4IZ6 A;  2UU9 C;  4IR7 A;  4RM3 A;  3R9X A;  4L4Q A;  3N54 B;  1HH2 P;  5AE1 A;  4DV2 C;  4DR6 C;  2ONF A;  2OPL B;  2CY1 A;  3I08 A;  4LFC C;  3TDE A;  4GKK C;  5ADZ A;  4PZP A;  1J5E C;  4B3T C;  3AF5 A;  4DCU A;  1HNZ C;  4NDN A;  3G7S A;  5FLX D;  2P2M A;  4X62 C;  3IEU A;  3LGX A;  1FJG C;  2UXB C;  3L8C A;  3TUF A;  1MD9 A;  1XNR C;  1GPM A;  3CW9 A;  3N2Q A;  5IFI A;  1N32 C;  4FTF A;  1XRA A;  4NXN C;  1N34 C;  1XRB A;  5KEI A;  2D7V A;  5A1G A;  1ZB8 A;  2UUA C;  4EAT A;  4LF6 C;  2P2B A;  4FUQ A;  3A9U A;  2D1R A;  2YWC A;  1VLA A;  1IBM C;  2F4V C;  2EGT A;  4DG8 A;  2BH1 X;  2QL8 A;  2Y27 A;  5BSV A;  4DV5 C;  5A2Q D;  4BCA A;  4LF4 C;  3DAY A;  4WS9 A;  5GTD A;  5T8T A;  4BBY A;  4RLF A;  2D28 C;  5CZX A;  2UUB C;  4RLQ A;  1N36 C;  4G1I A;  1T5D X;  4R1M A;  1EGA A;  4GXQ A;  4D56 A;  4I9G A;  5H9U A;  2OO4 A;  3E7X A;  2PT7 G;  3OTO C;  4D4G A;  4JYA C;  4OXI A;  3S82 A;  2OPL A;  2P2F A;  1PG3 A;  4DG9 A;  5BUR A;  1IBL C;  1HR0 C;  4GS5 A;  1LQL A;  5KYV A;  5BR8 C;  2KZF A;  1MXA A;  1O92 A;  1JOS A;  1KKG A;  2VQE C;  4L2Z A;  2D1S A;  1RY2 A;  4JI7 C;  1UKK A;  5AE3 A;  1ZB9 A;  5IT9 D;  2QVZ X;  2E8C A;  4L7I A;  3RG2 A;  1MXC A;  3TQI A;  5IWA C;  1YJ7 A;  1N33 C;  4JI3 C;  1MKY A;  3VNQ A;  2P2Q A;  4KTV A;  3ETO A;  2QW0 X;  4BSZ A;  4XX2 A;  3VNS A;  4YY3 C;  5A19 A;  4RVN A;  3T1Y C;  2PN2 A;  4DR2 C;  4DR4 C;  1HNW C;  4WV3 A;  2P02 A;  3LNV A;  3RV2 A;  3FCC A;  4ZLP A;  1PA4 A;  4DV0 C;  1NYE A;  1XMO C;  1ML8 A;  1WH9 A;  5K8F A;  3J7A D;  1O90 A;  2WD9 A;  1USP B;  2OBV A;  1K0R A;  4B3S C;  1XMQ C;  4GKJ C;  4AQY C;  1QWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...