1N33C

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1n33C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1n33C02
2EGTA 3R9WA 1FJGC 4JI0C 3IEUA 4B3TC 1I94C 5IT9D 3R9XA 1N36C 1J5EC 2BJOA 4LF8C 5IWAC 1HNXC 1HH2P 4DR5C 2ZM6C 2VQFC 2PN2A 2UUAC 1PA4A 4JV5C 1N2FA 2VQEC 1ZB8A 4DV0C 1XMQC 4DR6C 1USPB 4BSZA 2E5LC 4DV7C 4XX2A 2OPLA 1KKGA 4JI4C 1XNRC 4MTNA 2HJGA 4K0KC 4GKJC 4X66C 4NXNC 4DCTA 2DYJA 4DR7C 4NXMC 4DV1C 5LMNC 2OPLB 4GKKC 3T1HC 4DR2C 4B3SC 4LFBC 4JI8C 1EGAA 1VLAA 4JI3C 4JI2C 1N33C 3LUSA 1IBMC 5FLXD 2UUBC 3EERA 1MKYA 4LF5C 4KHPC 3J81D 4DR4C 1K0RA 1QWIA 2UUCC 3IEVA 1L2FA 4DV4C 2CY1A 4DV5C 1JOSA 1HR0C 4LF9C 1UKKA 4MH4A 1WF3A 4DR3C 4JI6C 4YHHC 1ZB9A 2KZFA 4NOZA 4JYAC 1N34C 2E8EA 4X65C 2YCBA 3GKUA 4DV2C 4DV6C 4AQYC 2HHHC 3I07A 4B3RC 4JI7C 3OTOC 4LFCC 1N32C 4LFAC 3J7AD 1XNQC 4B3MC 3J80D 1HNWC 2PT7G 2E8FA 4X62C 4YY3C 1IBLC 2JMPA 5A2QD 5BR8C 1XMOC 2ASBA 4LF6C 4DV3C 4X64C 1ML8A 4DUZC 3CJEA 4OX9C 4DCVA 1HNZC 3AF5A 1USPA 2CXCA 4JI1C 3JAMD 2ONFA 4JI5C 4DR1C 2E7GA 2XR1A 1WH9A 2F4VC 2E8CA 4DCUA 2UU9C 1NYEA 3T1YC 2UXCC 3AF6A 4DUYC 4LF4C 2UXBC 2QL8A 2UXDC 1IBKC 2ATWA 5LMUC 2D7VA 4LF7C 1LQLA 4DCSA
chains in the Genus database with same CATH superfamily
2EGTA 3R9WA 4B3TC 4L7IA 3R9XA 3CQ2A 4DG8A 1YGTA 1J5EC 1YJ7A 3IPLA 1HH2P 5BSVA 4DR5C 1RG9A 4K0BA 4GXRA 3LGXA 2DPLA 2ZZMA 3VNSA 1TH5A 4JV5C 2VQEC 3EQ6A 1V60A 2Y27A 4DV7C 3R44A 2Y4OA 4GKJC 4DCTA 1VEHA 3CQ1A 3T1HC 2P20A 1V25A 1N33C 4PUIA 1PG4A 3EERA 3RG2A 1MD9A 1QWIA 2UUCC 2KDNA 2AYAA 3A26A 4BC9A 1XRBA 4EATA 3DAYA 2PG1E 4DV5C 1JOSA 1LCIA 5CZXA 1WF3A 4DR3C 4JI6C 5JRHA 2P2MA 4D4GA 5CZVA 1XHJA 4B3RC 1N32C 1XS3A 3J7AD 2P2QA 2VSQA 5A1IA 3G7SA 3VNRA 2KZ0A 1ML8A 2MCQA 5AE3A 2QVYX 1HNZC 1T5HX 3E7WA 4JM1A 2CXCA 3NI2A 2MM9A 4JI5C 2F4VC 2E8CA 4DCUA 3PESA 4LF4C 3CW8X 4RM2A 2D7VA 1LQLA 1T5DX 4DCSA 4PZPA 3IEUA 1ULTA 2QW0X 3VNQA 5IWAC 3I08A 1MXBA 3DHVA 2ZM6C 4I9FA 2JNVA 4G37A 1PA4A 3O2EA 2E5LC 4XX2A 2D1QA 2D1SA 1O92A 2HJGA 4D4IA 2D1RA 1M6XC 3FCEA 4PHTA 4NXMC 4DV1C 2YX1A 5LMNC 3A9UA 4PROC 4RLQA 3GR1A 4DR2C 1VLAA 1WCJA 4RM3A 5E7QA 1IBMC 4TPSB 4U5YD 2UUBC 4LF5C 4KHPC 1MXAA 3IEVA 4DV4C 5AE1A 5BUSA 4L4QA 3KXWA 3UOWA 5H9UA 1P4EC 1ZB9A 1O90A 4PUGA 4NOZA 2MMAB 3B7WA 4D57A 4X65C 2YCBA 5BSWA 3DLPX 2M5HA 4ODJA 4DV6C 3UZ0A 4FTFA 5KEIA 2HHHC 3TUFA 4JI7C 3OTOC 3GR0A 3PROC 2PT7G 4YY3C 2ASBA 2M5OA 1MDFA 4DUZC 3CJEA 4BCAA 4FUTA 4OX9C 3AF5A 1USPA 3SO4A 1BA3A 3AY0A 4IR7A 2ONFA 3ETCA 2ZTBA 4BBYA 5T8SA 5KYVA 3UX3A 4WS9A 2UU9C 2OO4A 3AF6A 4DUYC 2UXBC 2ATWA 5A19A 1N36C 2V7BA 2E0GA 4I9GA 5LCIA 5BSUA 3IMLA 3N2QA 3CW9A 4LF8C 4FUQA 4D56A 2VQFC 3E7XA 1N2FA 4DV0C 1XMQC 4DR6C 4BSZA 4R1MA 4RVOA 2OPLA 1MDBA 3K6RA 2D27A 1XNRC 4MTNA 1P4EA 4NXNC 1XDXA 2DYJA 2OPLB 1O93A 3LNVA 2DHMA 3LAXA 3ETOA 4LFBC 4DG9A 4JI8C 1IB8A 3NYRA 5BSRA 4JI3C 3LUSA 2P2BA 2YWCA 1MKYA 3J81D 1K0RA 4WV3A 5GTDA 1L2FA 3FCCA 3L95X 4BC7A 5BURA 3N54B 4LE5A 4G1IA 5BSTA 4YHHC 4IZ6A 4RVNA 1N34C 2D1TA 2E8EA 1MXCA 4AQYC 3I07A 4LFCC 3GPCA 3NPDA 4LFAC 1XNQC 4B3MC 1HNWC 2E8FA 4X62C 3CQ3A 4OXIA 2CU6A 2P02A 4LF6C 2QVXX 4R0MA 3H2TA 1FLOA 1GPMA 2WP0C 1RY2A 2NCLA 5K8FA 2OBVA 2PROA 3JAMD 3A25A 5A1GA 2YWBA 4ZLPA 4RMNA 2Z51A 4L2ZA 5ADZA 2E7GA 5T8TA 2UXCC 2QL8A 5LMUC 4LF7C 1FJGC 4JI0C 1PU1A 1I94C 1FUGA 5IT9D 3PBKA 2D28C 5AE2A 3NYQA 2BJOA 1XRCA 1HNXC 3UX2A 2Y4NA 4KTVA 4HPVA 4GXQA 2PN2A 2UUAC 1ZB8A 1USPB 1KKGA 4JI4C 1UWDA 1M6XA 4K0KC 1O9TA 2VZEA 1AMUA 4X66C 4DR7C 1V26A 4GKKC 5DV9A 2QVZX 4B3SC 4NDNA 5BSMA 1EGAA 2P2FA 4JI2C 3UEBA 4R1LA 5FLXD 3FM7A 3TQIA 4DR4C 1P7LA 2P2JA 3TDEA 4PUHA 2CY1A 3L8CA 3S82A 5K85A 5IFIA 1HR0C 3LNOA 1UKKA 4MH4A 4LF9C 2KZFA 2ZZNA 4JYAC 3TR3A 5KYTA 3GKUA 4GS5A 4DV2C 4ZJZA 3J80D 1IBLC 3A4IA 2JMPA 4G36A 5BUQA 1NY8A 5A2QD 2BH1X 5BR8C 1XMOC 3C5EA 1QM4A 4DV3C 4X64C 3RV2A 4DCVA 3A9VA 1PG3A 4JI1C 4ISBA 4DR1C 2XR1A 1WH9A 2WD9A 4KTTA 1NYEA 3T1YC 2UXDC 1IBKC 4OYCA 1XRAA 4RLFA
chains in the Genus database with same CATH topology
2EGTA 3R9WA 4B3TC 4L7IA 3R9XA 4DG8A 1J5EC 1YJ7A 3IPLA 1HH2P 5BSVA 4DR5C 1RG9A 4K0BA 4GXRA 3LGXA 2DPLA 3VNSA 4JV5C 2VQEC 3EQ6A 2Y27A 4DV7C 3R44A 2Y4OA 4GKJC 4DCTA 3T1HC 2P20A 1V25A 1N33C 1PG4A 3EERA 3RG2A 1MD9A 1QWIA 2UUCC 2AYAA 4BC9A 1XRBA 4EATA 3DAYA 4DV5C 1JOSA 1LCIA 5CZXA 1WF3A 4DR3C 4JI6C 5JRHA 2P2MA 4D4GA 5CZVA 4B3RC 1N32C 3J7AD 2P2QA 2VSQA 5A1IA 3G7SA 3VNRA 1ML8A 5AE3A 2QVYX 1HNZC 1T5HX 3E7WA 4JM1A 2CXCA 3NI2A 4JI5C 2F4VC 2E8CA 4DCUA 3PESA 4LF4C 3CW8X 4RM2A 2D7VA 1LQLA 1T5DX 4DCSA 4PZPA 3IEUA 1ULTA 2QW0X 3VNQA 5IWAC 3I08A 1MXBA 3DHVA 2ZM6C 4I9FA 4G37A 1PA4A 2E5LC 4XX2A 2D1QA 2D1SA 1O92A 2HJGA 4D4IA 2D1RA 3FCEA 4PHTA 4NXMC 4DV1C 5LMNC 3A9UA 4PROC 4RLQA 3GR1A 4DR2C 1VLAA 4RM3A 5E7QA 1IBMC 4TPSB 4U5YD 2UUBC 4LF5C 4KHPC 1MXAA 3IEVA 4DV4C 5AE1A 5BUSA 4L4QA 3KXWA 3UOWA 5H9UA 1ZB9A 1O90A 4NOZA 3B7WA 4D57A 4X65C 2YCBA 5BSWA 3DLPX 4ODJA 4DV6C 3UZ0A 4FTFA 5KEIA 2HHHC 3TUFA 4JI7C 3OTOC 3GR0A 3PROC 2PT7G 4YY3C 2ASBA 1MDFA 4DUZC 3CJEA 4BCAA 4FUTA 4OX9C 3AF5A 1USPA 3SO4A 1BA3A 4IR7A 2ONFA 3ETCA 4BBYA 5T8SA 5KYVA 4WS9A 2UU9C 2OO4A 3AF6A 4DUYC 2UXBC 2ATWA 5A19A 1N36C 2V7BA 2E0GA 4I9GA 5BSUA 3IMLA 3N2QA 3CW9A 4LF8C 4FUQA 4D56A 2VQFC 3E7XA 1N2FA 4DV0C 1XMQC 4DR6C 4BSZA 4R1MA 4RVOA 2OPLA 1MDBA 2D27A 1XNRC 4MTNA 4NXNC 2DYJA 2OPLB 1O93A 3LNVA 3LAXA 3ETOA 4LFBC 4DG9A 4JI8C 3NYRA 5BSRA 4JI3C 3LUSA 2P2BA 2YWCA 1MKYA 3J81D 1K0RA 4WV3A 5GTDA 1L2FA 3FCCA 3L95X 4BC7A 5BURA 3N54B 4LE5A 4G1IA 5BSTA 4YHHC 4IZ6A 4RVNA 1N34C 2D1TA 2E8EA 1MXCA 4AQYC 3I07A 4LFCC 3GPCA 3NPDA 4LFAC 1XNQC 4B3MC 1HNWC 2E8FA 4X62C 4OXIA 2P02A 4LF6C 2QVXX 4R0MA 3H2TA 1GPMA 2WP0C 1RY2A 5K8FA 2OBVA 2PROA 3JAMD 2YWBA 5A1GA 4ZLPA 4RMNA 4L2ZA 5ADZA 2E7GA 5T8TA 2UXCC 2QL8A 5LMUC 4LF7C 1FJGC 4JI0C 1I94C 1FUGA 5IT9D 3PBKA 2D28C 5AE2A 3NYQA 2BJOA 1XRCA 1HNXC 2Y4NA 4KTVA 4HPVA 4GXQA 2PN2A 2UUAC 1ZB8A 1USPB 1KKGA 4JI4C 4K0KC 1O9TA 2VZEA 1AMUA 4X66C 4DR7C 1V26A 4GKKC 5DV9A 2QVZX 4B3SC 4NDNA 5BSMA 1EGAA 2P2FA 4JI2C 4R1LA 5FLXD 3TQIA 4DR4C 1P7LA 2P2JA 3TDEA 2CY1A 3L8CA 3S82A 5K85A 5IFIA 1HR0C 4LF9C 1UKKA 4MH4A 2KZFA 4JYAC 5KYTA 3GKUA 4GS5A 4DV2C 4ZJZA 3J80D 1IBLC 3A4IA 2JMPA 4G36A 5BUQA 5A2QD 2BH1X 5BR8C 1XMOC 3C5EA 1QM4A 4DV3C 4X64C 3RV2A 4DCVA 3A9VA 1PG3A 4JI1C 4ISBA 4DR1C 2XR1A 1WH9A 2WD9A 4KTTA 1NYEA 3T1YC 2UXDC 1IBKC 4OYCA 1XRAA 4RLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGT A;  3R9W A;  1FJG C;  4JI0 C;  3IEU A;  4B3T C;  1I94 C;  5IT9 D;  3R9X A;  1N36 C;  1J5E C;  2BJO A;  4LF8 C;  5IWA C;  1HNX C;  1HH2 P;  4DR5 C;  2ZM6 C;  2VQF C;  2PN2 A;  2UUA C;  1PA4 A;  4JV5 C;  1N2F A;  2VQE C;  1ZB8 A;  4DV0 C;  1XMQ C;  4DR6 C;  1USP B;  4BSZ A;  2E5L C;  4DV7 C;  4XX2 A;  2OPL A;  1KKG A;  4JI4 C;  1XNR C;  4MTN A;  2HJG A;  4K0K C;  4GKJ C;  4X66 C;  4NXN C;  4DCT A;  2DYJ A;  4DR7 C;  4NXM C;  4DV1 C;  5LMN C;  2OPL B;  4GKK C;  3T1H C;  4DR2 C;  4B3S C;  4LFB C;  4JI8 C;  1EGA A;  1VLA A;  4JI3 C;  4JI2 C;  1N33 C;  3LUS A;  1IBM C;  5FLX D;  2UUB C;  3EER A;  1MKY A;  4LF5 C;  4KHP C;  3J81 D;  4DR4 C;  1K0R A;  1QWI A;  2UUC C;  3IEV A;  1L2F A;  4DV4 C;  2CY1 A;  4DV5 C;  1JOS A;  1HR0 C;  4LF9 C;  1UKK A;  4MH4 A;  1WF3 A;  4DR3 C;  4JI6 C;  4YHH C;  1ZB9 A;  2KZF A;  4NOZ A;  4JYA C;  1N34 C;  2E8E A;  4X65 C;  2YCB A;  3GKU A;  4DV2 C;  4DV6 C;  4AQY C;  2HHH C;  3I07 A;  4B3R C;  4JI7 C;  3OTO C;  4LFC C;  1N32 C;  4LFA C;  3J7A D;  1XNQ C;  4B3M C;  3J80 D;  1HNW C;  2PT7 G;  2E8F A;  4X62 C;  4YY3 C;  1IBL C;  2JMP A;  5A2Q D;  5BR8 C;  1XMO C;  2ASB A;  4LF6 C;  4DV3 C;  4X64 C;  1ML8 A;  4DUZ C;  3CJE A;  4OX9 C;  4DCV A;  1HNZ C;  3AF5 A;  1USP A;  2CXC A;  4JI1 C;  3JAM D;  2ONF A;  4JI5 C;  4DR1 C;  2E7G A;  2XR1 A;  1WH9 A;  2F4V C;  2E8C A;  4DCU A;  2UU9 C;  1NYE A;  3T1Y C;  2UXC C;  3AF6 A;  4DUY C;  4LF4 C;  2UXB C;  2QL8 A;  2UXD C;  1IBK C;  2ATW A;  5LMU C;  2D7V A;  4LF7 C;  1LQL A;  4DCS A; 
#chains in the Genus database with same CATH topology
 2EGT A;  3R9W A;  4B3T C;  4L7I A;  3R9X A;  3CQ2 A;  4DG8 A;  1YGT A;  1J5E C;  1YJ7 A;  3IPL A;  1HH2 P;  5BSV A;  4DR5 C;  1RG9 A;  4K0B A;  4GXR A;  3LGX A;  2DPL A;  2ZZM A;  3VNS A;  1TH5 A;  4JV5 C;  2VQE C;  3EQ6 A;  1V60 A;  2Y27 A;  4DV7 C;  3R44 A;  2Y4O A;  4GKJ C;  4DCT A;  1VEH A;  3CQ1 A;  3T1H C;  2P20 A;  1V25 A;  1N33 C;  4PUI A;  1PG4 A;  3EER A;  3RG2 A;  1MD9 A;  1QWI A;  2UUC C;  2KDN A;  2AYA A;  3A26 A;  4BC9 A;  1XRB A;  4EAT A;  3DAY A;  2PG1 E;  4DV5 C;  1JOS A;  1LCI A;  5CZX A;  1WF3 A;  4DR3 C;  4JI6 C;  5JRH A;  2P2M A;  4D4G A;  5CZV A;  1XHJ A;  4B3R C;  1N32 C;  1XS3 A;  3J7A D;  2P2Q A;  2VSQ A;  5A1I A;  3G7S A;  3VNR A;  2KZ0 A;  1ML8 A;  2MCQ A;  5AE3 A;  2QVY X;  1HNZ C;  1T5H X;  3E7W A;  4JM1 A;  2CXC A;  3NI2 A;  2MM9 A;  4JI5 C;  2F4V C;  2E8C A;  4DCU A;  3PES A;  4LF4 C;  3CW8 X;  4RM2 A;  2D7V A;  1LQL A;  1T5D X;  4DCS A;  4PZP A;  3IEU A;  1ULT A;  2QW0 X;  3VNQ A;  5IWA C;  3I08 A;  1MXB A;  3DHV A;  2ZM6 C;  4I9F A;  2JNV A;  4G37 A;  1PA4 A;  3O2E A;  2E5L C;  4XX2 A;  2D1Q A;  2D1S A;  1O92 A;  2HJG A;  4D4I A;  2D1R A;  1M6X C;  3FCE A;  4PHT A;  4NXM C;  4DV1 C;  2YX1 A;  5LMN C;  3A9U A;  4PRO C;  4RLQ A;  3GR1 A;  4DR2 C;  1VLA A;  1WCJ A;  4RM3 A;  5E7Q A;  1IBM C;  4TPS B;  4U5Y D;  2UUB C;  4LF5 C;  4KHP C;  1MXA A;  3IEV A;  4DV4 C;  5AE1 A;  5BUS A;  4L4Q A;  3KXW A;  3UOW A;  5H9U A;  1P4E C;  1ZB9 A;  1O90 A;  4PUG A;  4NOZ A;  2MMA B;  3B7W A;  4D57 A;  4X65 C;  2YCB A;  5BSW A;  3DLP X;  2M5H A;  4ODJ A;  4DV6 C;  3UZ0 A;  4FTF A;  5KEI A;  2HHH C;  3TUF A;  4JI7 C;  3OTO C;  3GR0 A;  3PRO C;  2PT7 G;  4YY3 C;  2ASB A;  2M5O A;  1MDF A;  4DUZ C;  3CJE A;  4BCA A;  4FUT A;  4OX9 C;  3AF5 A;  1USP A;  3SO4 A;  1BA3 A;  3AY0 A;  4IR7 A;  2ONF A;  3ETC A;  2ZTB A;  4BBY A;  5T8S A;  5KYV A;  3UX3 A;  4WS9 A;  2UU9 C;  2OO4 A;  3AF6 A;  4DUY C;  2UXB C;  2ATW A;  5A19 A;  1N36 C;  2V7B A;  2E0G A;  4I9G A;  5LCI A;  5BSU A;  3IML A;  3N2Q A;  3CW9 A;  4LF8 C;  4FUQ A;  4D56 A;  2VQF C;  3E7X A;  1N2F A;  4DV0 C;  1XMQ C;  4DR6 C;  4BSZ A;  4R1M A;  4RVO A;  2OPL A;  1MDB A;  3K6R A;  2D27 A;  1XNR C;  4MTN A;  1P4E A;  4NXN C;  1XDX A;  2DYJ A;  2OPL B;  1O93 A;  3LNV A;  2DHM A;  3LAX A;  3ETO A;  4LFB C;  4DG9 A;  4JI8 C;  1IB8 A;  3NYR A;  5BSR A;  4JI3 C;  3LUS A;  2P2B A;  2YWC A;  1MKY A;  3J81 D;  1K0R A;  4WV3 A;  5GTD A;  1L2F A;  3FCC A;  3L95 X;  4BC7 A;  5BUR A;  3N54 B;  4LE5 A;  4G1I A;  5BST A;  4YHH C;  4IZ6 A;  4RVN A;  1N34 C;  2D1T A;  2E8E A;  1MXC A;  4AQY C;  3I07 A;  4LFC C;  3GPC A;  3NPD A;  4LFA C;  1XNQ C;  4B3M C;  1HNW C;  2E8F A;  4X62 C;  3CQ3 A;  4OXI A;  2CU6 A;  2P02 A;  4LF6 C;  2QVX X;  4R0M A;  3H2T A;  1FLO A;  1GPM A;  2WP0 C;  1RY2 A;  2NCL A;  5K8F A;  2OBV A;  2PRO A;  3JAM D;  3A25 A;  5A1G A;  2YWB A;  4ZLP A;  4RMN A;  2Z51 A;  4L2Z A;  5ADZ A;  2E7G A;  5T8T A;  2UXC C;  2QL8 A;  5LMU C;  4LF7 C;  1FJG C;  4JI0 C;  1PU1 A;  1I94 C;  1FUG A;  5IT9 D;  3PBK A;  2D28 C;  5AE2 A;  3NYQ A;  2BJO A;  1XRC A;  1HNX C;  3UX2 A;  2Y4N A;  4KTV A;  4HPV A;  4GXQ A;  2PN2 A;  2UUA C;  1ZB8 A;  1USP B;  1KKG A;  4JI4 C;  1UWD A;  1M6X A;  4K0K C;  1O9T A;  2VZE A;  1AMU A;  4X66 C;  4DR7 C;  1V26 A;  4GKK C;  5DV9 A;  2QVZ X;  4B3S C;  4NDN A;  5BSM A;  1EGA A;  2P2F A;  4JI2 C;  3UEB A;  4R1L A;  5FLX D;  3FM7 A;  3TQI A;  4DR4 C;  1P7L A;  2P2J A;  3TDE A;  4PUH A;  2CY1 A;  3L8C A;  3S82 A;  5K85 A;  5IFI A;  1HR0 C;  3LNO A;  1UKK A;  4MH4 A;  4LF9 C;  2KZF A;  2ZZN A;  4JYA C;  3TR3 A;  5KYT A;  3GKU A;  4GS5 A;  4DV2 C;  4ZJZ A;  3J80 D;  1IBL C;  3A4I A;  2JMP A;  4G36 A;  5BUQ A;  1NY8 A;  5A2Q D;  2BH1 X;  5BR8 C;  1XMO C;  3C5E A;  1QM4 A;  4DV3 C;  4X64 C;  3RV2 A;  4DCV A;  3A9V A;  1PG3 A;  4JI1 C;  4ISB A;  4DR1 C;  2XR1 A;  1WH9 A;  2WD9 A;  4KTT A;  1NYE A;  3T1Y C;  2UXD C;  1IBK C;  4OYC A;  1XRA A;  4RLF A; 
#chains in the Genus database with same CATH homology
 2EGT A;  3R9W A;  4B3T C;  4L7I A;  3R9X A;  4DG8 A;  1J5E C;  1YJ7 A;  3IPL A;  1HH2 P;  5BSV A;  4DR5 C;  1RG9 A;  4K0B A;  4GXR A;  3LGX A;  2DPL A;  3VNS A;  4JV5 C;  2VQE C;  3EQ6 A;  2Y27 A;  4DV7 C;  3R44 A;  2Y4O A;  4GKJ C;  4DCT A;  3T1H C;  2P20 A;  1V25 A;  1N33 C;  1PG4 A;  3EER A;  3RG2 A;  1MD9 A;  1QWI A;  2UUC C;  2AYA A;  4BC9 A;  1XRB A;  4EAT A;  3DAY A;  4DV5 C;  1JOS A;  1LCI A;  5CZX A;  1WF3 A;  4DR3 C;  4JI6 C;  5JRH A;  2P2M A;  4D4G A;  5CZV A;  4B3R C;  1N32 C;  3J7A D;  2P2Q A;  2VSQ A;  5A1I A;  3G7S A;  3VNR A;  1ML8 A;  5AE3 A;  2QVY X;  1HNZ C;  1T5H X;  3E7W A;  4JM1 A;  2CXC A;  3NI2 A;  4JI5 C;  2F4V C;  2E8C A;  4DCU A;  3PES A;  4LF4 C;  3CW8 X;  4RM2 A;  2D7V A;  1LQL A;  1T5D X;  4DCS A;  4PZP A;  3IEU A;  1ULT A;  2QW0 X;  3VNQ A;  5IWA C;  3I08 A;  1MXB A;  3DHV A;  2ZM6 C;  4I9F A;  4G37 A;  1PA4 A;  2E5L C;  4XX2 A;  2D1Q A;  2D1S A;  1O92 A;  2HJG A;  4D4I A;  2D1R A;  3FCE A;  4PHT A;  4NXM C;  4DV1 C;  5LMN C;  3A9U A;  4PRO C;  4RLQ A;  3GR1 A;  4DR2 C;  1VLA A;  4RM3 A;  5E7Q A;  1IBM C;  4TPS B;  4U5Y D;  2UUB C;  4LF5 C;  4KHP C;  1MXA A;  3IEV A;  4DV4 C;  5AE1 A;  5BUS A;  4L4Q A;  3KXW A;  3UOW A;  5H9U A;  1ZB9 A;  1O90 A;  4NOZ A;  3B7W A;  4D57 A;  4X65 C;  2YCB A;  5BSW A;  3DLP X;  4ODJ A;  4DV6 C;  3UZ0 A;  4FTF A;  5KEI A;  2HHH C;  3TUF A;  4JI7 C;  3OTO C;  3GR0 A;  3PRO C;  2PT7 G;  4YY3 C;  2ASB A;  1MDF A;  4DUZ C;  3CJE A;  4BCA A;  4FUT A;  4OX9 C;  3AF5 A;  1USP A;  3SO4 A;  1BA3 A;  4IR7 A;  2ONF A;  3ETC A;  4BBY A;  5T8S A;  5KYV A;  4WS9 A;  2UU9 C;  2OO4 A;  3AF6 A;  4DUY C;  2UXB C;  2ATW A;  5A19 A;  1N36 C;  2V7B A;  2E0G A;  4I9G A;  5BSU A;  3IML A;  3N2Q A;  3CW9 A;  4LF8 C;  4FUQ A;  4D56 A;  2VQF C;  3E7X A;  1N2F A;  4DV0 C;  1XMQ C;  4DR6 C;  4BSZ A;  4R1M A;  4RVO A;  2OPL A;  1MDB A;  2D27 A;  1XNR C;  4MTN A;  4NXN C;  2DYJ A;  2OPL B;  1O93 A;  3LNV A;  3LAX A;  3ETO A;  4LFB C;  4DG9 A;  4JI8 C;  3NYR A;  5BSR A;  4JI3 C;  3LUS A;  2P2B A;  2YWC A;  1MKY A;  3J81 D;  1K0R A;  4WV3 A;  5GTD A;  1L2F A;  3FCC A;  3L95 X;  4BC7 A;  5BUR A;  3N54 B;  4LE5 A;  4G1I A;  5BST A;  4YHH C;  4IZ6 A;  4RVN A;  1N34 C;  2D1T A;  2E8E A;  1MXC A;  4AQY C;  3I07 A;  4LFC C;  3GPC A;  3NPD A;  4LFA C;  1XNQ C;  4B3M C;  1HNW C;  2E8F A;  4X62 C;  4OXI A;  2P02 A;  4LF6 C;  2QVX X;  4R0M A;  3H2T A;  1GPM A;  2WP0 C;  1RY2 A;  5K8F A;  2OBV A;  2PRO A;  3JAM D;  2YWB A;  5A1G A;  4ZLP A;  4RMN A;  4L2Z A;  5ADZ A;  2E7G A;  5T8T A;  2UXC C;  2QL8 A;  5LMU C;  4LF7 C;  1FJG C;  4JI0 C;  1I94 C;  1FUG A;  5IT9 D;  3PBK A;  2D28 C;  5AE2 A;  3NYQ A;  2BJO A;  1XRC A;  1HNX C;  2Y4N A;  4KTV A;  4HPV A;  4GXQ A;  2PN2 A;  2UUA C;  1ZB8 A;  1USP B;  1KKG A;  4JI4 C;  4K0K C;  1O9T A;  2VZE A;  1AMU A;  4X66 C;  4DR7 C;  1V26 A;  4GKK C;  5DV9 A;  2QVZ X;  4B3S C;  4NDN A;  5BSM A;  1EGA A;  2P2F A;  4JI2 C;  4R1L A;  5FLX D;  3TQI A;  4DR4 C;  1P7L A;  2P2J A;  3TDE A;  2CY1 A;  3L8C A;  3S82 A;  5K85 A;  5IFI A;  1HR0 C;  4LF9 C;  1UKK A;  4MH4 A;  2KZF A;  4JYA C;  5KYT A;  3GKU A;  4GS5 A;  4DV2 C;  4ZJZ A;  3J80 D;  1IBL C;  3A4I A;  2JMP A;  4G36 A;  5BUQ A;  5A2Q D;  2BH1 X;  5BR8 C;  1XMO C;  3C5E A;  1QM4 A;  4DV3 C;  4X64 C;  3RV2 A;  4DCV A;  3A9V A;  1PG3 A;  4JI1 C;  4ISB A;  4DR1 C;  2XR1 A;  1WH9 A;  2WD9 A;  4KTT A;  1NYE A;  3T1Y C;  2UXD C;  1IBK C;  4OYC A;  1XRA A;  4RLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...