4JI4C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji4C02
5LMUC 2HHHC 1N2FA 4LFCC 4DV7C 4DV2C 4JI1C 1ZB8A 4BSZA 4DR6C 4B3SC 2ATWA 3J7AD 1VLAA 1IBLC 4DCTA 2PT7G 4JI6C 4JI5C 2E8FA 1N32C 4NXMC 4DV5C 1WH9A 4DR4C 4GKJC 4LF5C 3OTOC 1J5EC 4XX2A 2UUCC 1MKYA 1QWIA 4NXNC 2VQFC 4DV1C 4DV0C 3LUSA 4DR5C 1LQLA 4LF4C 4MH4A 3CJEA 1FJGC 3J81D 2BJOA 4LF6C 4LFAC 4JI7C 1NYEA 3EERA 2ASBA 4K0KC 2EGTA 4LFBC 3IEUA 4DCSA 4JYAC 1HNWC 3AF5A 2UU9C 4DUZC 4AQYC 5IT9D 4JI2C 4KHPC 4DR1C 4DR3C 4JV5C 1N36C 4X66C 4DR2C 4DV3C 5FLXD 1K0RA 3R9XA 1JOSA 5BR8C 3AF6A 2ONFA 2UUAC 2UXDC 1HNXC 3I07A 2DYJA 1ZB9A 5LMNC 1USPA 3T1HC 2E5LC 2KZFA 1IBMC 4X65C 2UUBC 4DCVA 1N34C 2CY1A 4OX9C 2XR1A 2HJGA 3T1YC 4LF7C 4JI3C 4DV4C 1WF3A 1XMOC 2YCBA 1XMQC 4GKKC 2QL8A 1UKKA 1XNQC 4B3TC 2F4VC 3IEVA 4MTNA 1HH2P 2JMPA 4X64C 2CXCA 4JI8C 1HNZC 4DUYC 1PA4A 1KKGA 3JAMD 2UXCC 1USPB 4YHHC 1L2FA 2D7VA 4B3MC 2E8CA 4X62C 2ZM6C 2VQEC 4NOZA 1HR0C 4YY3C 4JI0C 1I94C 2PN2A 3R9WA 4LF9C 2OPLB 4DCUA 4DR7C 2OPLA 1IBKC 1XNRC 2E7GA 2UXBC 3GKUA 5A2QD 5IWAC 1ML8A 4DV6C 4JI4C 1EGAA 3J80D 4LF8C 4B3RC 1N33C 2E8EA
chains in the Genus database with same CATH superfamily
2HHHC 1N2FA 2MM9A 4JM1A 4JI1C 2ZTBA 4DR6C 3VNQA 2VZEA 1ULTA 4D4IA 3UOWA 4JI6C 2PT7G 5ADZA 2E8FA 4NXMC 4GKJC 3LAXA 3OTOC 1J5EC 3A9VA 3LGXA 4G37A 2OBVA 3CJEA 4HPVA 2BJOA 4OXIA 2Z51A 4JI7C 2QVYX 4R1MA 4JYAC 4AQYC 5CZVA 1XS3A 5IT9D 2YX1A 4G1IA 1P4EA 2QVZX 1PG4A 1JOSA 1MXCA 4D57A 2UUAC 2UXDC 1M6XA 3I07A 1MDBA 5LMNC 1QM4A 5BSMA 1IBMC 4DCVA 4RLFA 4BC9A 4L7IA 2DPLA 4OX9C 4PUIA 3DHVA 3EQ6A 4DV4C 1V26A 1XMOC 4L4QA 3IPLA 4EATA 4GKKC 2YWCA 1XNQC 3FCCA 4R1LA 3IEVA 1HH2P 2P2QA 1V60A 2UXCC 1USPB 1L2FA 1IB8A 2AYAA 2ZM6C 3TR3A 3LNOA 3TDEA 2UXBC 4NDNA 4RVNA 3ETCA 5E7QA 3J80D 1EGAA 4LF8C 1RG9A 1P7LA 3N2QA 1MXBA 2MCQA 5KYTA 2VSQA 4BSZA 4B3SC 3KXWA 3J7AD 1FUGA 1IBLC 1O90A 4DCTA 3TUFA 2NCLA 2YWBA 2D1TA 3NPDA 4BCAA 3R44A 2P20A 2VQFC 2WP0C 4DV0C 1FLOA 5GTDA 1LQLA 4MH4A 2D1QA 2P02A 3EERA 4ISBA 3O2EA 1UWDA 3IEUA 4DUZC 4DR1C 4JV5C 1N36C 2P2JA 4OYCA 4WS9A 1NY8A 1K0RA 5BR8C 1O92A 2ONFA 3NYRA 2DYJA 4X65C 3UX3A 2UUBC 1PU1A 3PBKA 2PG1E 2HJGA 5K8FA 5AE3A 2YCBA 2P2FA 5IFIA 4BBYA 4MTNA 1XHJA 2CXCA 4JI8C 1PA4A 1MD9A 2P2MA 4G36A 4YHHC 4K0BA 4LE5A 3IMLA 2VQEC 5KYVA 3L95X 4YY3C 3R9WA 3GR0A 4FUTA 4LF9C 3B7WA 2D28C 2E7GA 3UEBA 3GR1A 3PESA 2QVXX 3E7WA 1N33C 2KZ0A 1O9TA 1YGTA 4PZPA 3UZ0A 4LFCC 1ZB8A 4ODJA 2Y4NA 2V7BA 1VLAA 4JI5C 2JNVA 3ETOA 3VNSA 4DV5C 1WH9A 2PROA 2KDNA 4LF5C 4PHTA 4R0MA 4XX2A 1P4EC 1MKYA 1QWIA 3CQ3A 3C5EA 4GXQA 1LCIA 3I08A 3J81D 4RM3A 1VEHA 4LF6C 4LFAC 1NYEA 2ASBA 2EGTA 4DCSA 2UU9C 4JI2C 4KHPC 1MDFA 3CW9A 2M5HA 2Y4OA 3RV2A 4DV3C 1TH5A 5A19A 5AE2A 3R9XA 3AF6A 3NYQA 5BSUA 2CU6A 1ZB9A 3T1HC 1XRBA 5T8TA 1N34C 2CY1A 2XR1A 2M5OA 4BC7A 3FCEA 4LF7C 3CQ2A 4JI3C 1XMQC 2ZZMA 5A1GA 1UKKA 1T5HX 2F4VC 4RM2A 3PROC 2JMPA 2E0GA 1KKGA 5BURA 5JRHA 3CQ1A 4IZ6A 3N54B 3SO4A 4IR7A 5T8SA 2E8CA 1XRAA 1T5DX 4NOZA 3A9UA 4GXRA 5DV9A 2PN2A 2DHMA 2OPLB 4DCUA 5BUQA 4DR7C 1GPMA 4I9FA 1O93A 4RLQA 3GKUA 5A2QD 1MXAA 3E7XA 5IWAC 1PG3A 1ML8A 4DV6C 4JI4C 4I9GA 5A1IA 1V25A 2E8EA 5LMUC 2BH1X 3L8CA 2MMAB 5CZXA 4DV7C 4DV2C 1M6XC 4PUHA 2ATWA 4D56A 3GPCA 5BSRA 2ZZNA 1N32C 4DR4C 1XDXA 5K85A 4PUGA 2UUCC 4TPSB 4NXNC 4DV1C 4D4GA 2D1RA 3AY0A 3LUSA 4DR5C 4LF4C 3CW8X 1FJGC 1WCJA 3LNVA 1RY2A 4K0KC 5H9UA 4LFBC 4DG9A 1HNWC 3AF5A 3DLPX 4L2ZA 5AE1A 3K6RA 4DR3C 4X66C 4DR2C 4DG8A 5FLXD 2P2BA 3A25A 1HNXC 3RG2A 1USPA 4WV3A 4PROC 4FUQA 3S82A 2E5LC 2KZFA 1BA3A 4RMNA 1YJ7A 3H2TA 3T1YC 5LCIA 2D1SA 1WF3A 3NI2A 5BSVA 5BSTA 4FTFA 3A26A 5KEIA 2QW0X 2QL8A 3A4IA 4B3TC 4ZLPA 3G7SA 4X64C 2Y27A 1HNZC 2OO4A 4DUYC 4RVOA 3JAMD 2D7VA 3DAYA 4B3MC 4U5YD 3VNRA 4X62C 1AMUA 3FM7A 1HR0C 4JI0C 3UX2A 1I94C 5BSWA 2WD9A 2OPLA 1IBKC 1XNRC 1XRCA 4GS5A 4KTVA 4KTTA 4ZJZA 2D27A 4B3RC 3TQIA 5BUSA
chains in the Genus database with same CATH topology
2HHHC 1N2FA 4JM1A 4JI1C 4DR6C 3VNQA 2VZEA 1ULTA 4D4IA 3UOWA 4JI6C 2PT7G 5ADZA 2E8FA 4NXMC 4GKJC 3LAXA 3OTOC 1J5EC 3A9VA 3LGXA 4G37A 2OBVA 3CJEA 4HPVA 2BJOA 4OXIA 4JI7C 2QVYX 4R1MA 4JYAC 4AQYC 5CZVA 5IT9D 4G1IA 2QVZX 1PG4A 1JOSA 1MXCA 4D57A 2UUAC 2UXDC 3I07A 1MDBA 5LMNC 1QM4A 5BSMA 1IBMC 4DCVA 4RLFA 4BC9A 4L7IA 2DPLA 4OX9C 3DHVA 3EQ6A 4DV4C 1V26A 1XMOC 4L4QA 3IPLA 4EATA 4GKKC 2YWCA 1XNQC 3FCCA 4R1LA 3IEVA 1HH2P 2P2QA 2UXCC 1USPB 1L2FA 2AYAA 2ZM6C 3TDEA 2UXBC 4NDNA 4RVNA 3ETCA 5E7QA 1EGAA 3J80D 4LF8C 1RG9A 1P7LA 3N2QA 1MXBA 5KYTA 2VSQA 4BSZA 4B3SC 3KXWA 3J7AD 1FUGA 1IBLC 1O90A 4DCTA 3TUFA 2YWBA 2D1TA 3NPDA 4BCAA 3R44A 2P20A 2VQFC 2WP0C 4DV0C 5GTDA 1LQLA 4MH4A 2D1QA 2P02A 3EERA 4ISBA 3IEUA 4DUZC 4DR1C 4JV5C 1N36C 2P2JA 4OYCA 4WS9A 1K0RA 5BR8C 1O92A 2ONFA 3NYRA 2DYJA 4X65C 2UUBC 3PBKA 2HJGA 5K8FA 5AE3A 2YCBA 2P2FA 5IFIA 4BBYA 4MTNA 2CXCA 4JI8C 1PA4A 1MD9A 2P2MA 4G36A 4YHHC 4K0BA 4LE5A 3IMLA 2VQEC 5KYVA 3L95X 4YY3C 3R9WA 3GR0A 4FUTA 4LF9C 3B7WA 2D28C 2E7GA 3GR1A 3PESA 2QVXX 3E7WA 1N33C 1O9TA 4PZPA 3UZ0A 4LFCC 1ZB8A 4ODJA 2Y4NA 2V7BA 1VLAA 4JI5C 3ETOA 3VNSA 4DV5C 1WH9A 2PROA 4LF5C 4PHTA 4R0MA 4XX2A 1MKYA 1QWIA 3C5EA 4GXQA 1LCIA 3I08A 3J81D 4RM3A 4LF6C 4LFAC 1NYEA 2ASBA 2EGTA 4DCSA 2UU9C 4JI2C 4KHPC 1MDFA 3CW9A 2Y4OA 3RV2A 4DV3C 5A19A 5AE2A 3R9XA 3AF6A 3NYQA 5BSUA 1ZB9A 3T1HC 1XRBA 5T8TA 1N34C 2CY1A 2XR1A 4BC7A 3FCEA 4LF7C 4JI3C 1XMQC 5A1GA 1UKKA 1T5HX 2F4VC 4RM2A 3PROC 2JMPA 2E0GA 1KKGA 5BURA 5JRHA 4IZ6A 3N54B 3SO4A 4IR7A 5T8SA 2E8CA 1XRAA 1T5DX 4NOZA 3A9UA 4GXRA 5DV9A 2PN2A 2OPLB 4DCUA 5BUQA 4DR7C 1GPMA 4I9FA 1O93A 4RLQA 3GKUA 5A2QD 1MXAA 3E7XA 5IWAC 1PG3A 1ML8A 4DV6C 4JI4C 4I9GA 5A1IA 1V25A 2E8EA 5LMUC 2BH1X 3L8CA 5CZXA 4DV7C 4DV2C 2ATWA 4D56A 3GPCA 5BSRA 1N32C 4DR4C 5K85A 2UUCC 4TPSB 4NXNC 4DV1C 4D4GA 2D1RA 3LUSA 4DR5C 4LF4C 3CW8X 1FJGC 3LNVA 1RY2A 4K0KC 5H9UA 4LFBC 4DG9A 1HNWC 3AF5A 3DLPX 4L2ZA 5AE1A 4DR3C 4X66C 4DR2C 4DG8A 5FLXD 2P2BA 1HNXC 3RG2A 1USPA 4WV3A 4PROC 4FUQA 3S82A 2E5LC 2KZFA 1BA3A 4RMNA 1YJ7A 3H2TA 3T1YC 2D1SA 1WF3A 3NI2A 5BSVA 5BSTA 4FTFA 5KEIA 2QW0X 2QL8A 3A4IA 4B3TC 4ZLPA 3G7SA 4X64C 2Y27A 1HNZC 2OO4A 4DUYC 4RVOA 3JAMD 2D7VA 3DAYA 4B3MC 4U5YD 3VNRA 4X62C 1AMUA 1HR0C 4JI0C 1I94C 5BSWA 2WD9A 2OPLA 1IBKC 1XNRC 1XRCA 4GS5A 4KTVA 4KTTA 4ZJZA 2D27A 4B3RC 3TQIA 5BUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU C;  2HHH C;  1N2F A;  4LFC C;  4DV7 C;  4DV2 C;  4JI1 C;  1ZB8 A;  4BSZ A;  4DR6 C;  4B3S C;  2ATW A;  3J7A D;  1VLA A;  1IBL C;  4DCT A;  2PT7 G;  4JI6 C;  4JI5 C;  2E8F A;  1N32 C;  4NXM C;  4DV5 C;  1WH9 A;  4DR4 C;  4GKJ C;  4LF5 C;  3OTO C;  1J5E C;  4XX2 A;  2UUC C;  1MKY A;  1QWI A;  4NXN C;  2VQF C;  4DV1 C;  4DV0 C;  3LUS A;  4DR5 C;  1LQL A;  4LF4 C;  4MH4 A;  3CJE A;  1FJG C;  3J81 D;  2BJO A;  4LF6 C;  4LFA C;  4JI7 C;  1NYE A;  3EER A;  2ASB A;  4K0K C;  2EGT A;  4LFB C;  3IEU A;  4DCS A;  4JYA C;  1HNW C;  3AF5 A;  2UU9 C;  4DUZ C;  4AQY C;  5IT9 D;  4JI2 C;  4KHP C;  4DR1 C;  4DR3 C;  4JV5 C;  1N36 C;  4X66 C;  4DR2 C;  4DV3 C;  5FLX D;  1K0R A;  3R9X A;  1JOS A;  5BR8 C;  3AF6 A;  2ONF A;  2UUA C;  2UXD C;  1HNX C;  3I07 A;  2DYJ A;  1ZB9 A;  5LMN C;  1USP A;  3T1H C;  2E5L C;  2KZF A;  1IBM C;  4X65 C;  2UUB C;  4DCV A;  1N34 C;  2CY1 A;  4OX9 C;  2XR1 A;  2HJG A;  3T1Y C;  4LF7 C;  4JI3 C;  4DV4 C;  1WF3 A;  1XMO C;  2YCB A;  1XMQ C;  4GKK C;  2QL8 A;  1UKK A;  1XNQ C;  4B3T C;  2F4V C;  3IEV A;  4MTN A;  1HH2 P;  2JMP A;  4X64 C;  2CXC A;  4JI8 C;  1HNZ C;  4DUY C;  1PA4 A;  1KKG A;  3JAM D;  2UXC C;  1USP B;  4YHH C;  1L2F A;  2D7V A;  4B3M C;  2E8C A;  4X62 C;  2ZM6 C;  2VQE C;  4NOZ A;  1HR0 C;  4YY3 C;  4JI0 C;  1I94 C;  2PN2 A;  3R9W A;  4LF9 C;  2OPL B;  4DCU A;  4DR7 C;  2OPL A;  1IBK C;  1XNR C;  2E7G A;  2UXB C;  3GKU A;  5A2Q D;  5IWA C;  1ML8 A;  4DV6 C;  4JI4 C;  1EGA A;  3J80 D;  4LF8 C;  4B3R C;  1N33 C;  2E8E A; 
#chains in the Genus database with same CATH topology
 2HHH C;  1N2F A;  2MM9 A;  4JM1 A;  4JI1 C;  2ZTB A;  4DR6 C;  3VNQ A;  2VZE A;  1ULT A;  4D4I A;  3UOW A;  4JI6 C;  2PT7 G;  5ADZ A;  2E8F A;  4NXM C;  4GKJ C;  3LAX A;  3OTO C;  1J5E C;  3A9V A;  3LGX A;  4G37 A;  2OBV A;  3CJE A;  4HPV A;  2BJO A;  4OXI A;  2Z51 A;  4JI7 C;  2QVY X;  4R1M A;  4JYA C;  4AQY C;  5CZV A;  1XS3 A;  5IT9 D;  2YX1 A;  4G1I A;  1P4E A;  2QVZ X;  1PG4 A;  1JOS A;  1MXC A;  4D57 A;  2UUA C;  2UXD C;  1M6X A;  3I07 A;  1MDB A;  5LMN C;  1QM4 A;  5BSM A;  1IBM C;  4DCV A;  4RLF A;  4BC9 A;  4L7I A;  2DPL A;  4OX9 C;  4PUI A;  3DHV A;  3EQ6 A;  4DV4 C;  1V26 A;  1XMO C;  4L4Q A;  3IPL A;  4EAT A;  4GKK C;  2YWC A;  1XNQ C;  3FCC A;  4R1L A;  3IEV A;  1HH2 P;  2P2Q A;  1V60 A;  2UXC C;  1USP B;  1L2F A;  1IB8 A;  2AYA A;  2ZM6 C;  3TR3 A;  3LNO A;  3TDE A;  2UXB C;  4NDN A;  4RVN A;  3ETC A;  5E7Q A;  3J80 D;  1EGA A;  4LF8 C;  1RG9 A;  1P7L A;  3N2Q A;  1MXB A;  2MCQ A;  5KYT A;  2VSQ A;  4BSZ A;  4B3S C;  3KXW A;  3J7A D;  1FUG A;  1IBL C;  1O90 A;  4DCT A;  3TUF A;  2NCL A;  2YWB A;  2D1T A;  3NPD A;  4BCA A;  3R44 A;  2P20 A;  2VQF C;  2WP0 C;  4DV0 C;  1FLO A;  5GTD A;  1LQL A;  4MH4 A;  2D1Q A;  2P02 A;  3EER A;  4ISB A;  3O2E A;  1UWD A;  3IEU A;  4DUZ C;  4DR1 C;  4JV5 C;  1N36 C;  2P2J A;  4OYC A;  4WS9 A;  1NY8 A;  1K0R A;  5BR8 C;  1O92 A;  2ONF A;  3NYR A;  2DYJ A;  4X65 C;  3UX3 A;  2UUB C;  1PU1 A;  3PBK A;  2PG1 E;  2HJG A;  5K8F A;  5AE3 A;  2YCB A;  2P2F A;  5IFI A;  4BBY A;  4MTN A;  1XHJ A;  2CXC A;  4JI8 C;  1PA4 A;  1MD9 A;  2P2M A;  4G36 A;  4YHH C;  4K0B A;  4LE5 A;  3IML A;  2VQE C;  5KYV A;  3L95 X;  4YY3 C;  3R9W A;  3GR0 A;  4FUT A;  4LF9 C;  3B7W A;  2D28 C;  2E7G A;  3UEB A;  3GR1 A;  3PES A;  2QVX X;  3E7W A;  1N33 C;  2KZ0 A;  1O9T A;  1YGT A;  4PZP A;  3UZ0 A;  4LFC C;  1ZB8 A;  4ODJ A;  2Y4N A;  2V7B A;  1VLA A;  4JI5 C;  2JNV A;  3ETO A;  3VNS A;  4DV5 C;  1WH9 A;  2PRO A;  2KDN A;  4LF5 C;  4PHT A;  4R0M A;  4XX2 A;  1P4E C;  1MKY A;  1QWI A;  3CQ3 A;  3C5E A;  4GXQ A;  1LCI A;  3I08 A;  3J81 D;  4RM3 A;  1VEH A;  4LF6 C;  4LFA C;  1NYE A;  2ASB A;  2EGT A;  4DCS A;  2UU9 C;  4JI2 C;  4KHP C;  1MDF A;  3CW9 A;  2M5H A;  2Y4O A;  3RV2 A;  4DV3 C;  1TH5 A;  5A19 A;  5AE2 A;  3R9X A;  3AF6 A;  3NYQ A;  5BSU A;  2CU6 A;  1ZB9 A;  3T1H C;  1XRB A;  5T8T A;  1N34 C;  2CY1 A;  2XR1 A;  2M5O A;  4BC7 A;  3FCE A;  4LF7 C;  3CQ2 A;  4JI3 C;  1XMQ C;  2ZZM A;  5A1G A;  1UKK A;  1T5H X;  2F4V C;  4RM2 A;  3PRO C;  2JMP A;  2E0G A;  1KKG A;  5BUR A;  5JRH A;  3CQ1 A;  4IZ6 A;  3N54 B;  3SO4 A;  4IR7 A;  5T8S A;  2E8C A;  1XRA A;  1T5D X;  4NOZ A;  3A9U A;  4GXR A;  5DV9 A;  2PN2 A;  2DHM A;  2OPL B;  4DCU A;  5BUQ A;  4DR7 C;  1GPM A;  4I9F A;  1O93 A;  4RLQ A;  3GKU A;  5A2Q D;  1MXA A;  3E7X A;  5IWA C;  1PG3 A;  1ML8 A;  4DV6 C;  4JI4 C;  4I9G A;  5A1I A;  1V25 A;  2E8E A;  5LMU C;  2BH1 X;  3L8C A;  2MMA B;  5CZX A;  4DV7 C;  4DV2 C;  1M6X C;  4PUH A;  2ATW A;  4D56 A;  3GPC A;  5BSR A;  2ZZN A;  1N32 C;  4DR4 C;  1XDX A;  5K85 A;  4PUG A;  2UUC C;  4TPS B;  4NXN C;  4DV1 C;  4D4G A;  2D1R A;  3AY0 A;  3LUS A;  4DR5 C;  4LF4 C;  3CW8 X;  1FJG C;  1WCJ A;  3LNV A;  1RY2 A;  4K0K C;  5H9U A;  4LFB C;  4DG9 A;  1HNW C;  3AF5 A;  3DLP X;  4L2Z A;  5AE1 A;  3K6R A;  4DR3 C;  4X66 C;  4DR2 C;  4DG8 A;  5FLX D;  2P2B A;  3A25 A;  1HNX C;  3RG2 A;  1USP A;  4WV3 A;  4PRO C;  4FUQ A;  3S82 A;  2E5L C;  2KZF A;  1BA3 A;  4RMN A;  1YJ7 A;  3H2T A;  3T1Y C;  5LCI A;  2D1S A;  1WF3 A;  3NI2 A;  5BSV A;  5BST A;  4FTF A;  3A26 A;  5KEI A;  2QW0 X;  2QL8 A;  3A4I A;  4B3T C;  4ZLP A;  3G7S A;  4X64 C;  2Y27 A;  1HNZ C;  2OO4 A;  4DUY C;  4RVO A;  3JAM D;  2D7V A;  3DAY A;  4B3M C;  4U5Y D;  3VNR A;  4X62 C;  1AMU A;  3FM7 A;  1HR0 C;  4JI0 C;  3UX2 A;  1I94 C;  5BSW A;  2WD9 A;  2OPL A;  1IBK C;  1XNR C;  1XRC A;  4GS5 A;  4KTV A;  4KTT A;  4ZJZ A;  2D27 A;  4B3R C;  3TQI A;  5BUS A; 
#chains in the Genus database with same CATH homology
 2HHH C;  1N2F A;  4JM1 A;  4JI1 C;  4DR6 C;  3VNQ A;  2VZE A;  1ULT A;  4D4I A;  3UOW A;  4JI6 C;  2PT7 G;  5ADZ A;  2E8F A;  4NXM C;  4GKJ C;  3LAX A;  3OTO C;  1J5E C;  3A9V A;  3LGX A;  4G37 A;  2OBV A;  3CJE A;  4HPV A;  2BJO A;  4OXI A;  4JI7 C;  2QVY X;  4R1M A;  4JYA C;  4AQY C;  5CZV A;  5IT9 D;  4G1I A;  2QVZ X;  1PG4 A;  1JOS A;  1MXC A;  4D57 A;  2UUA C;  2UXD C;  3I07 A;  1MDB A;  5LMN C;  1QM4 A;  5BSM A;  1IBM C;  4DCV A;  4RLF A;  4BC9 A;  4L7I A;  2DPL A;  4OX9 C;  3DHV A;  3EQ6 A;  4DV4 C;  1V26 A;  1XMO C;  4L4Q A;  3IPL A;  4EAT A;  4GKK C;  2YWC A;  1XNQ C;  3FCC A;  4R1L A;  3IEV A;  1HH2 P;  2P2Q A;  2UXC C;  1USP B;  1L2F A;  2AYA A;  2ZM6 C;  3TDE A;  2UXB C;  4NDN A;  4RVN A;  3ETC A;  5E7Q A;  1EGA A;  3J80 D;  4LF8 C;  1RG9 A;  1P7L A;  3N2Q A;  1MXB A;  5KYT A;  2VSQ A;  4BSZ A;  4B3S C;  3KXW A;  3J7A D;  1FUG A;  1IBL C;  1O90 A;  4DCT A;  3TUF A;  2YWB A;  2D1T A;  3NPD A;  4BCA A;  3R44 A;  2P20 A;  2VQF C;  2WP0 C;  4DV0 C;  5GTD A;  1LQL A;  4MH4 A;  2D1Q A;  2P02 A;  3EER A;  4ISB A;  3IEU A;  4DUZ C;  4DR1 C;  4JV5 C;  1N36 C;  2P2J A;  4OYC A;  4WS9 A;  1K0R A;  5BR8 C;  1O92 A;  2ONF A;  3NYR A;  2DYJ A;  4X65 C;  2UUB C;  3PBK A;  2HJG A;  5K8F A;  5AE3 A;  2YCB A;  2P2F A;  5IFI A;  4BBY A;  4MTN A;  2CXC A;  4JI8 C;  1PA4 A;  1MD9 A;  2P2M A;  4G36 A;  4YHH C;  4K0B A;  4LE5 A;  3IML A;  2VQE C;  5KYV A;  3L95 X;  4YY3 C;  3R9W A;  3GR0 A;  4FUT A;  4LF9 C;  3B7W A;  2D28 C;  2E7G A;  3GR1 A;  3PES A;  2QVX X;  3E7W A;  1N33 C;  1O9T A;  4PZP A;  3UZ0 A;  4LFC C;  1ZB8 A;  4ODJ A;  2Y4N A;  2V7B A;  1VLA A;  4JI5 C;  3ETO A;  3VNS A;  4DV5 C;  1WH9 A;  2PRO A;  4LF5 C;  4PHT A;  4R0M A;  4XX2 A;  1MKY A;  1QWI A;  3C5E A;  4GXQ A;  1LCI A;  3I08 A;  3J81 D;  4RM3 A;  4LF6 C;  4LFA C;  1NYE A;  2ASB A;  2EGT A;  4DCS A;  2UU9 C;  4JI2 C;  4KHP C;  1MDF A;  3CW9 A;  2Y4O A;  3RV2 A;  4DV3 C;  5A19 A;  5AE2 A;  3R9X A;  3AF6 A;  3NYQ A;  5BSU A;  1ZB9 A;  3T1H C;  1XRB A;  5T8T A;  1N34 C;  2CY1 A;  2XR1 A;  4BC7 A;  3FCE A;  4LF7 C;  4JI3 C;  1XMQ C;  5A1G A;  1UKK A;  1T5H X;  2F4V C;  4RM2 A;  3PRO C;  2JMP A;  2E0G A;  1KKG A;  5BUR A;  5JRH A;  4IZ6 A;  3N54 B;  3SO4 A;  4IR7 A;  5T8S A;  2E8C A;  1XRA A;  1T5D X;  4NOZ A;  3A9U A;  4GXR A;  5DV9 A;  2PN2 A;  2OPL B;  4DCU A;  5BUQ A;  4DR7 C;  1GPM A;  4I9F A;  1O93 A;  4RLQ A;  3GKU A;  5A2Q D;  1MXA A;  3E7X A;  5IWA C;  1PG3 A;  1ML8 A;  4DV6 C;  4JI4 C;  4I9G A;  5A1I A;  1V25 A;  2E8E A;  5LMU C;  2BH1 X;  3L8C A;  5CZX A;  4DV7 C;  4DV2 C;  2ATW A;  4D56 A;  3GPC A;  5BSR A;  1N32 C;  4DR4 C;  5K85 A;  2UUC C;  4TPS B;  4NXN C;  4DV1 C;  4D4G A;  2D1R A;  3LUS A;  4DR5 C;  4LF4 C;  3CW8 X;  1FJG C;  3LNV A;  1RY2 A;  4K0K C;  5H9U A;  4LFB C;  4DG9 A;  1HNW C;  3AF5 A;  3DLP X;  4L2Z A;  5AE1 A;  4DR3 C;  4X66 C;  4DR2 C;  4DG8 A;  5FLX D;  2P2B A;  1HNX C;  3RG2 A;  1USP A;  4WV3 A;  4PRO C;  4FUQ A;  3S82 A;  2E5L C;  2KZF A;  1BA3 A;  4RMN A;  1YJ7 A;  3H2T A;  3T1Y C;  2D1S A;  1WF3 A;  3NI2 A;  5BSV A;  5BST A;  4FTF A;  5KEI A;  2QW0 X;  2QL8 A;  3A4I A;  4B3T C;  4ZLP A;  3G7S A;  4X64 C;  2Y27 A;  1HNZ C;  2OO4 A;  4DUY C;  4RVO A;  3JAM D;  2D7V A;  3DAY A;  4B3M C;  4U5Y D;  3VNR A;  4X62 C;  1AMU A;  1HR0 C;  4JI0 C;  1I94 C;  5BSW A;  2WD9 A;  2OPL A;  1IBK C;  1XNR C;  1XRC A;  4GS5 A;  4KTV A;  4KTT A;  4ZJZ A;  2D27 A;  4B3R C;  3TQI A;  5BUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...