4JI4C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji4C02
1L2FA 3R9XA 4DV3C 2QL8A 1XMQC 3CJEA 4LFBC 5LMUC 3J81D 4XX2A 2EGTA 4DV1C 1IBLC 2E8EA 4MH4A 1HNWC 2F4VC 4OX9C 1IBMC 1LQLA 2HJGA 2XR1A 4YY3C 1N2FA 2KZFA 1ML8A 2ONFA 3T1YC 3GKUA 2E5LC 2HHHC 2UXDC 4LF9C 1WF3A 1HH2P 2E8FA 2JMPA 1J5EC 2ASBA 1USPB 1QWIA 1JOSA 4DV2C 4DV5C 4LF8C 4DR5C 4LF5C 4B3RC 4DUYC 4MTNA 4X64C 1XMOC 4BSZA 4DR7C 2CXCA 4JI3C 2OPLB 4DCVA 3OTOC 2DYJA 4GKKC 1KKGA 2UUCC 1WH9A 5IWAC 4JI2C 5BR8C 4K0KC 4NOZA 1XNQC 1VLAA 5FLXD 1ZB8A 4NXMC 1N32C 2UUAC 1IBKC 2E8CA 2PN2A 2VQEC 4JI1C 2ZM6C 4GKJC 1N33C 3AF6A 5LMNC 2D7VA 3AF5A 3JAMD 4X62C 4LFCC 1HR0C 1PA4A 3IEVA 3J7AD 2E7GA 4X65C 4LF4C 2UXBC 1K0RA 4DV0C 4DR2C 3LUSA 1HNXC 4X66C 4JI7C 1XNRC 4JI4C 2CY1A 4DR4C 4DCTA 4B3SC 2UU9C 4LF6C 4DCUA 1MKYA 4DV4C 1I94C 3T1HC 1HNZC 4JI5C 2ATWA 5A2QD 4JI6C 3EERA 1NYEA 4B3MC 4DV6C 4YHHC 4B3TC 2YCBA 3IEUA 4DCSA 2VQFC 4DR6C 4KHPC 1USPA 3J80D 1UKKA 4LF7C 2BJOA 4DR3C 4JV5C 1N36C 3R9WA 4LFAC 1ZB9A 4DUZC 2UUBC 4DV7C 2PT7G 1FJGC 4AQYC 2UXCC 4JI8C 4NXNC 1EGAA 2OPLA 3I07A 4JYAC 4JI0C 5IT9D 1N34C 4DR1C
chains in the Genus database with same CATH superfamily
1L2FA 1T5HX 5BURA 4LFBC 5LMUC 2E8EA 1HNWC 3E7XA 2MCQA 5BSWA 4YY3C 2Y27A 3AY0A 3LNVA 5BSRA 2UXDC 1WF3A 1WCJA 4ISBA 1JOSA 5A1IA 3CQ3A 3NYRA 2P2BA 5CZVA 2V7BA 2E0GA 4OYCA 4X64C 1XMOC 1XHJA 4G37A 2CXCA 5IFIA 4R1MA 1KKGA 1V26A 2PROA 1WH9A 3N54B 2YX1A 5IWAC 4K0KC 3R44A 1ZB8A 2D27A 1NY8A 1MXAA 4D56A 5DV9A 2E8CA 4DG8A 1O9TA 3GPCA 2Y4NA 4LFCC 1PA4A 3J7AD 2QVXX 5AE2A 3A25A 4RLQA 4DV0C 3LUSA 4DR4C 1M6XA 3KXWA 4BC9A 1I94C 3ETOA 2ATWA 2DHMA 3DAYA 1BA3A 4JI6C 3EERA 2D1QA 4DV6C 1USPA 2KZ0A 1UKKA 4LF7C 4DR3C 4JV5C 1N36C 5BSVA 2UUBC 5BSUA 4JI8C 1PG4A 1O90A 3SO4A 3I07A 1PG3A 3GR1A 4RM3A 4PUIA 1N34C 1V25A 2P20A 1AMUA 4R1LA 2D1SA 2YWBA 1QM4A 4RVOA 3GR0A 4FUTA 3J81D 2D28C 4MH4A 5LCIA 3TUFA 2F4VC 3C5EA 1LQLA 4RLFA 3A9UA 2KZFA 1ML8A 2HHHC 2AYAA 4GS5A 3VNRA 4LE5A 2M5HA 2JMPA 2ASBA 3LAXA 2P2MA 1QWIA 4DV2C 5BSMA 4R0MA 1MDFA 4DUYC 3UX3A 3IMLA 4BSZA 2WD9A 2YWCA 4JI3C 4GXRA 4DCVA 5A1GA 2DYJA 3CQ1A 1MXCA 3H2TA 1VLAA 5AE3A 4L7IA 3K6RA 1N32C 3CW8X 3UX2A 1IBKC 4NDNA 1MDBA 4GKJC 3L8CA 4L2ZA 5LMNC 2D7VA 3AF5A 3IEVA 1VEHA 1P4EC 4LF4C 2P2FA 1HNXC 1XNRC 2NCLA 4JI4C 1XDXA 5CZXA 4LF6C 2QVZX 4D4IA 5A2QD 3IPLA 4D57A 1NYEA 4YHHC 4B3TC 2VQFC 1LCIA 1YJ7A 3VNQA 4PZPA 3J80D 2BH1X 3N2QA 4ODJA 3R9WA 4LFAC 1FJGC 2PT7G 1XRCA 1MXBA 4JYAC 5IT9D 5ADZA 4DV3C 3UOWA 2QL8A 4DG9A 1XMQC 3CJEA 1O93A 2P2JA 3NPDA 4D4GA 2ZTBA 3LNOA 3TDEA 4OX9C 4TPSB 1IBMC 2XR1A 4BC7A 1GPMA 1O92A 4RM2A 3E7WA 3GKUA 4RMNA 2E5LC 4LF9C 3UZ0A 3B7WA 1PU1A 1RG9A 4GXQA 4DR5C 3S82A 4LF5C 4MTNA 5A19A 4DR7C 3RV2A 2OPLB 4ZLPA 4GKKC 2UUCC 4KTVA 1FUGA 4KTTA 5K85A 5AE1A 4JI2C 5BUSA 1XNQC 5FLXD 3DLPX 3NYQA 2PN2A 2VQEC 4JI1C 3CQ2A 3FM7A 3AF6A 3NI2A 3JAMD 4X62C 1HR0C 2E7GA 4X65C 1YGTA 2ZZMA 2UXBC 4ZJZA 2OO4A 1XS3A 3PESA 4DCUA 1ULTA 2DPLA 5E7QA 3T1HC 1P4EA 3DHVA 2CU6A 3A4IA 3IEUA 4DR6C 4BBYA 3A26A 3VNSA 2QW0X 2BJOA 4WS9A 3UEBA 5H9UA 4DUZC 2MMAB 2OBVA 4AQYC 2UXCC 4FUQA 4NXNC 5T8TA 1EGAA 2P2QA 1XRBA 3EQ6A 2P02A 4EATA 3CW9A 1IB8A 5KYTA 2D1TA 1P7LA 3R9XA 3LGXA 4JM1A 4PROC 1IBLC 4XX2A 2EGTA 4DV1C 5BUQA 3TQIA 3TR3A 1XRAA 2Z51A 2D1RA 2PG1E 2HJGA 3PROC 2M5OA 2VSQA 4G36A 1N2FA 3FCEA 1V60A 2ONFA 3T1YC 5KEIA 1HH2P 2E8FA 1J5EC 4I9FA 1USPB 2VZEA 4DV5C 4LF8C 4B3RC 3ETCA 5JRHA 1MD9A 4G1IA 1UWDA 3PBKA 3FCCA 3OTOC 3I08A 2KDNA 4PHTA 5BR8C 2QVYX 4NOZA 4NXMC 3G7SA 2UUAC 5BSTA 3RG2A 2ZM6C 4I9GA 1M6XC 1N33C 4OXIA 1RY2A 4IR7A 4PUGA 4RVNA 2Y4OA 3L95X 1K0RA 4BCAA 4DR2C 4PUHA 4JI7C 4X66C 5GTDA 2CY1A 4L4QA 4DCTA 4B3SC 2UU9C 4HPVA 1MKYA 4DV4C 4IZ6A 2WP0C 1HNZC 4WV3A 1T5DX 4JI5C 2JNVA 1TH5A 4B3MC 5T8SA 2YCBA 4DCSA 2ZZNA 4U5YD 4KHPC 2MM9A 1FLOA 3O2EA 1ZB9A 5K8FA 4DV7C 4FTFA 5KYVA 2OPLA 3A9VA 4JI0C 4DR1C 4K0BA
chains in the Genus database with same CATH topology
1L2FA 1T5HX 5BURA 4LFBC 5LMUC 2E8EA 1HNWC 3E7XA 5BSWA 4YY3C 2Y27A 3LNVA 5BSRA 2UXDC 1WF3A 4ISBA 1JOSA 5A1IA 3NYRA 2P2BA 5CZVA 2V7BA 2E0GA 4OYCA 4X64C 1XMOC 4G37A 2CXCA 5IFIA 4R1MA 1KKGA 1V26A 2PROA 1WH9A 3N54B 5IWAC 4K0KC 3R44A 1ZB8A 2D27A 1MXAA 4D56A 5DV9A 2E8CA 4DG8A 1O9TA 3GPCA 2Y4NA 4LFCC 1PA4A 3J7AD 2QVXX 5AE2A 4RLQA 4DV0C 3LUSA 4DR4C 3KXWA 4BC9A 1I94C 3ETOA 2ATWA 3DAYA 1BA3A 4JI6C 3EERA 2D1QA 4DV6C 1USPA 1UKKA 4LF7C 4DR3C 4JV5C 1N36C 5BSVA 2UUBC 5BSUA 4JI8C 1PG4A 1O90A 3SO4A 3I07A 1PG3A 3GR1A 4RM3A 1N34C 1V25A 2P20A 1AMUA 4R1LA 2D1SA 2YWBA 1QM4A 4RVOA 3GR0A 4FUTA 3J81D 2D28C 4MH4A 3TUFA 2F4VC 3C5EA 1LQLA 4RLFA 3A9UA 2KZFA 1ML8A 2HHHC 2AYAA 4GS5A 3VNRA 4LE5A 2JMPA 2ASBA 3LAXA 2P2MA 1QWIA 4DV2C 5BSMA 4R0MA 1MDFA 4DUYC 3IMLA 4BSZA 2WD9A 2YWCA 4JI3C 4GXRA 4DCVA 5A1GA 2DYJA 1MXCA 3H2TA 1VLAA 5AE3A 4L7IA 1N32C 3CW8X 1IBKC 4NDNA 1MDBA 4GKJC 3L8CA 4L2ZA 5LMNC 2D7VA 3AF5A 3IEVA 4LF4C 2P2FA 1HNXC 1XNRC 4JI4C 5CZXA 4LF6C 2QVZX 4D4IA 5A2QD 3IPLA 4D57A 1NYEA 4YHHC 4B3TC 2VQFC 1LCIA 1YJ7A 3VNQA 4PZPA 3J80D 2BH1X 3N2QA 4ODJA 3R9WA 4LFAC 1FJGC 2PT7G 1XRCA 1MXBA 4JYAC 5IT9D 5ADZA 4DV3C 3UOWA 2QL8A 4DG9A 1XMQC 3CJEA 1O93A 2P2JA 3NPDA 4D4GA 3TDEA 4OX9C 4TPSB 1IBMC 2XR1A 4BC7A 1GPMA 1O92A 4RM2A 3E7WA 3GKUA 4RMNA 2E5LC 4LF9C 3UZ0A 3B7WA 1RG9A 4GXQA 4DR5C 3S82A 4LF5C 4MTNA 5A19A 4DR7C 3RV2A 2OPLB 4ZLPA 4GKKC 2UUCC 4KTVA 1FUGA 4KTTA 5K85A 5AE1A 4JI2C 5BUSA 1XNQC 5FLXD 3DLPX 3NYQA 2PN2A 2VQEC 4JI1C 3AF6A 3NI2A 3JAMD 4X62C 1HR0C 2E7GA 4X65C 2UXBC 4ZJZA 2OO4A 3PESA 4DCUA 1ULTA 2DPLA 5E7QA 3T1HC 3DHVA 3A4IA 3IEUA 4DR6C 4BBYA 3VNSA 2QW0X 2BJOA 4WS9A 5H9UA 4DUZC 2OBVA 4AQYC 2UXCC 4FUQA 4NXNC 5T8TA 1EGAA 2P2QA 1XRBA 3EQ6A 2P02A 4EATA 3CW9A 5KYTA 2D1TA 1P7LA 3R9XA 3LGXA 4JM1A 4PROC 1IBLC 4XX2A 2EGTA 4DV1C 5BUQA 3TQIA 1XRAA 2D1RA 2HJGA 3PROC 2VSQA 4G36A 1N2FA 3FCEA 2ONFA 3T1YC 5KEIA 1HH2P 2E8FA 1J5EC 4I9FA 1USPB 2VZEA 4DV5C 4LF8C 4B3RC 3ETCA 5JRHA 1MD9A 4G1IA 3PBKA 3FCCA 3OTOC 3I08A 4PHTA 5BR8C 2QVYX 4NOZA 4NXMC 3G7SA 2UUAC 5BSTA 3RG2A 2ZM6C 4I9GA 1N33C 4OXIA 1RY2A 4IR7A 4RVNA 2Y4OA 3L95X 1K0RA 4BCAA 4DR2C 4JI7C 4X66C 5GTDA 2CY1A 4L4QA 4DCTA 4B3SC 2UU9C 4HPVA 1MKYA 4DV4C 4IZ6A 2WP0C 1HNZC 4WV3A 1T5DX 4JI5C 4B3MC 5T8SA 2YCBA 4DCSA 4U5YD 4KHPC 1ZB9A 5K8FA 4DV7C 4FTFA 5KYVA 2OPLA 3A9VA 4JI0C 4DR1C 4K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  3R9X A;  4DV3 C;  2QL8 A;  1XMQ C;  3CJE A;  4LFB C;  5LMU C;  3J81 D;  4XX2 A;  2EGT A;  4DV1 C;  1IBL C;  2E8E A;  4MH4 A;  1HNW C;  2F4V C;  4OX9 C;  1IBM C;  1LQL A;  2HJG A;  2XR1 A;  4YY3 C;  1N2F A;  2KZF A;  1ML8 A;  2ONF A;  3T1Y C;  3GKU A;  2E5L C;  2HHH C;  2UXD C;  4LF9 C;  1WF3 A;  1HH2 P;  2E8F A;  2JMP A;  1J5E C;  2ASB A;  1USP B;  1QWI A;  1JOS A;  4DV2 C;  4DV5 C;  4LF8 C;  4DR5 C;  4LF5 C;  4B3R C;  4DUY C;  4MTN A;  4X64 C;  1XMO C;  4BSZ A;  4DR7 C;  2CXC A;  4JI3 C;  2OPL B;  4DCV A;  3OTO C;  2DYJ A;  4GKK C;  1KKG A;  2UUC C;  1WH9 A;  5IWA C;  4JI2 C;  5BR8 C;  4K0K C;  4NOZ A;  1XNQ C;  1VLA A;  5FLX D;  1ZB8 A;  4NXM C;  1N32 C;  2UUA C;  1IBK C;  2E8C A;  2PN2 A;  2VQE C;  4JI1 C;  2ZM6 C;  4GKJ C;  1N33 C;  3AF6 A;  5LMN C;  2D7V A;  3AF5 A;  3JAM D;  4X62 C;  4LFC C;  1HR0 C;  1PA4 A;  3IEV A;  3J7A D;  2E7G A;  4X65 C;  4LF4 C;  2UXB C;  1K0R A;  4DV0 C;  4DR2 C;  3LUS A;  1HNX C;  4X66 C;  4JI7 C;  1XNR C;  4JI4 C;  2CY1 A;  4DR4 C;  4DCT A;  4B3S C;  2UU9 C;  4LF6 C;  4DCU A;  1MKY A;  4DV4 C;  1I94 C;  3T1H C;  1HNZ C;  4JI5 C;  2ATW A;  5A2Q D;  4JI6 C;  3EER A;  1NYE A;  4B3M C;  4DV6 C;  4YHH C;  4B3T C;  2YCB A;  3IEU A;  4DCS A;  2VQF C;  4DR6 C;  4KHP C;  1USP A;  3J80 D;  1UKK A;  4LF7 C;  2BJO A;  4DR3 C;  4JV5 C;  1N36 C;  3R9W A;  4LFA C;  1ZB9 A;  4DUZ C;  2UUB C;  4DV7 C;  2PT7 G;  1FJG C;  4AQY C;  2UXC C;  4JI8 C;  4NXN C;  1EGA A;  2OPL A;  3I07 A;  4JYA C;  4JI0 C;  5IT9 D;  1N34 C;  4DR1 C; 
#chains in the Genus database with same CATH topology
 1L2F A;  1T5H X;  5BUR A;  4LFB C;  5LMU C;  2E8E A;  1HNW C;  3E7X A;  2MCQ A;  5BSW A;  4YY3 C;  2Y27 A;  3AY0 A;  3LNV A;  5BSR A;  2UXD C;  1WF3 A;  1WCJ A;  4ISB A;  1JOS A;  5A1I A;  3CQ3 A;  3NYR A;  2P2B A;  5CZV A;  2V7B A;  2E0G A;  4OYC A;  4X64 C;  1XMO C;  1XHJ A;  4G37 A;  2CXC A;  5IFI A;  4R1M A;  1KKG A;  1V26 A;  2PRO A;  1WH9 A;  3N54 B;  2YX1 A;  5IWA C;  4K0K C;  3R44 A;  1ZB8 A;  2D27 A;  1NY8 A;  1MXA A;  4D56 A;  5DV9 A;  2E8C A;  4DG8 A;  1O9T A;  3GPC A;  2Y4N A;  4LFC C;  1PA4 A;  3J7A D;  2QVX X;  5AE2 A;  3A25 A;  4RLQ A;  4DV0 C;  3LUS A;  4DR4 C;  1M6X A;  3KXW A;  4BC9 A;  1I94 C;  3ETO A;  2ATW A;  2DHM A;  3DAY A;  1BA3 A;  4JI6 C;  3EER A;  2D1Q A;  4DV6 C;  1USP A;  2KZ0 A;  1UKK A;  4LF7 C;  4DR3 C;  4JV5 C;  1N36 C;  5BSV A;  2UUB C;  5BSU A;  4JI8 C;  1PG4 A;  1O90 A;  3SO4 A;  3I07 A;  1PG3 A;  3GR1 A;  4RM3 A;  4PUI A;  1N34 C;  1V25 A;  2P20 A;  1AMU A;  4R1L A;  2D1S A;  2YWB A;  1QM4 A;  4RVO A;  3GR0 A;  4FUT A;  3J81 D;  2D28 C;  4MH4 A;  5LCI A;  3TUF A;  2F4V C;  3C5E A;  1LQL A;  4RLF A;  3A9U A;  2KZF A;  1ML8 A;  2HHH C;  2AYA A;  4GS5 A;  3VNR A;  4LE5 A;  2M5H A;  2JMP A;  2ASB A;  3LAX A;  2P2M A;  1QWI A;  4DV2 C;  5BSM A;  4R0M A;  1MDF A;  4DUY C;  3UX3 A;  3IML A;  4BSZ A;  2WD9 A;  2YWC A;  4JI3 C;  4GXR A;  4DCV A;  5A1G A;  2DYJ A;  3CQ1 A;  1MXC A;  3H2T A;  1VLA A;  5AE3 A;  4L7I A;  3K6R A;  1N32 C;  3CW8 X;  3UX2 A;  1IBK C;  4NDN A;  1MDB A;  4GKJ C;  3L8C A;  4L2Z A;  5LMN C;  2D7V A;  3AF5 A;  3IEV A;  1VEH A;  1P4E C;  4LF4 C;  2P2F A;  1HNX C;  1XNR C;  2NCL A;  4JI4 C;  1XDX A;  5CZX A;  4LF6 C;  2QVZ X;  4D4I A;  5A2Q D;  3IPL A;  4D57 A;  1NYE A;  4YHH C;  4B3T C;  2VQF C;  1LCI A;  1YJ7 A;  3VNQ A;  4PZP A;  3J80 D;  2BH1 X;  3N2Q A;  4ODJ A;  3R9W A;  4LFA C;  1FJG C;  2PT7 G;  1XRC A;  1MXB A;  4JYA C;  5IT9 D;  5ADZ A;  4DV3 C;  3UOW A;  2QL8 A;  4DG9 A;  1XMQ C;  3CJE A;  1O93 A;  2P2J A;  3NPD A;  4D4G A;  2ZTB A;  3LNO A;  3TDE A;  4OX9 C;  4TPS B;  1IBM C;  2XR1 A;  4BC7 A;  1GPM A;  1O92 A;  4RM2 A;  3E7W A;  3GKU A;  4RMN A;  2E5L C;  4LF9 C;  3UZ0 A;  3B7W A;  1PU1 A;  1RG9 A;  4GXQ A;  4DR5 C;  3S82 A;  4LF5 C;  4MTN A;  5A19 A;  4DR7 C;  3RV2 A;  2OPL B;  4ZLP A;  4GKK C;  2UUC C;  4KTV A;  1FUG A;  4KTT A;  5K85 A;  5AE1 A;  4JI2 C;  5BUS A;  1XNQ C;  5FLX D;  3DLP X;  3NYQ A;  2PN2 A;  2VQE C;  4JI1 C;  3CQ2 A;  3FM7 A;  3AF6 A;  3NI2 A;  3JAM D;  4X62 C;  1HR0 C;  2E7G A;  4X65 C;  1YGT A;  2ZZM A;  2UXB C;  4ZJZ A;  2OO4 A;  1XS3 A;  3PES A;  4DCU A;  1ULT A;  2DPL A;  5E7Q A;  3T1H C;  1P4E A;  3DHV A;  2CU6 A;  3A4I A;  3IEU A;  4DR6 C;  4BBY A;  3A26 A;  3VNS A;  2QW0 X;  2BJO A;  4WS9 A;  3UEB A;  5H9U A;  4DUZ C;  2MMA B;  2OBV A;  4AQY C;  2UXC C;  4FUQ A;  4NXN C;  5T8T A;  1EGA A;  2P2Q A;  1XRB A;  3EQ6 A;  2P02 A;  4EAT A;  3CW9 A;  1IB8 A;  5KYT A;  2D1T A;  1P7L A;  3R9X A;  3LGX A;  4JM1 A;  4PRO C;  1IBL C;  4XX2 A;  2EGT A;  4DV1 C;  5BUQ A;  3TQI A;  3TR3 A;  1XRA A;  2Z51 A;  2D1R A;  2PG1 E;  2HJG A;  3PRO C;  2M5O A;  2VSQ A;  4G36 A;  1N2F A;  3FCE A;  1V60 A;  2ONF A;  3T1Y C;  5KEI A;  1HH2 P;  2E8F A;  1J5E C;  4I9F A;  1USP B;  2VZE A;  4DV5 C;  4LF8 C;  4B3R C;  3ETC A;  5JRH A;  1MD9 A;  4G1I A;  1UWD A;  3PBK A;  3FCC A;  3OTO C;  3I08 A;  2KDN A;  4PHT A;  5BR8 C;  2QVY X;  4NOZ A;  4NXM C;  3G7S A;  2UUA C;  5BST A;  3RG2 A;  2ZM6 C;  4I9G A;  1M6X C;  1N33 C;  4OXI A;  1RY2 A;  4IR7 A;  4PUG A;  4RVN A;  2Y4O A;  3L95 X;  1K0R A;  4BCA A;  4DR2 C;  4PUH A;  4JI7 C;  4X66 C;  5GTD A;  2CY1 A;  4L4Q A;  4DCT A;  4B3S C;  2UU9 C;  4HPV A;  1MKY A;  4DV4 C;  4IZ6 A;  2WP0 C;  1HNZ C;  4WV3 A;  1T5D X;  4JI5 C;  2JNV A;  1TH5 A;  4B3M C;  5T8S A;  2YCB A;  4DCS A;  2ZZN A;  4U5Y D;  4KHP C;  2MM9 A;  1FLO A;  3O2E A;  1ZB9 A;  5K8F A;  4DV7 C;  4FTF A;  5KYV A;  2OPL A;  3A9V A;  4JI0 C;  4DR1 C;  4K0B A; 
#chains in the Genus database with same CATH homology
 1L2F A;  1T5H X;  5BUR A;  4LFB C;  5LMU C;  2E8E A;  1HNW C;  3E7X A;  5BSW A;  4YY3 C;  2Y27 A;  3LNV A;  5BSR A;  2UXD C;  1WF3 A;  4ISB A;  1JOS A;  5A1I A;  3NYR A;  2P2B A;  5CZV A;  2V7B A;  2E0G A;  4OYC A;  4X64 C;  1XMO C;  4G37 A;  2CXC A;  5IFI A;  4R1M A;  1KKG A;  1V26 A;  2PRO A;  1WH9 A;  3N54 B;  5IWA C;  4K0K C;  3R44 A;  1ZB8 A;  2D27 A;  1MXA A;  4D56 A;  5DV9 A;  2E8C A;  4DG8 A;  1O9T A;  3GPC A;  2Y4N A;  4LFC C;  1PA4 A;  3J7A D;  2QVX X;  5AE2 A;  4RLQ A;  4DV0 C;  3LUS A;  4DR4 C;  3KXW A;  4BC9 A;  1I94 C;  3ETO A;  2ATW A;  3DAY A;  1BA3 A;  4JI6 C;  3EER A;  2D1Q A;  4DV6 C;  1USP A;  1UKK A;  4LF7 C;  4DR3 C;  4JV5 C;  1N36 C;  5BSV A;  2UUB C;  5BSU A;  4JI8 C;  1PG4 A;  1O90 A;  3SO4 A;  3I07 A;  1PG3 A;  3GR1 A;  4RM3 A;  1N34 C;  1V25 A;  2P20 A;  1AMU A;  4R1L A;  2D1S A;  2YWB A;  1QM4 A;  4RVO A;  3GR0 A;  4FUT A;  3J81 D;  2D28 C;  4MH4 A;  3TUF A;  2F4V C;  3C5E A;  1LQL A;  4RLF A;  3A9U A;  2KZF A;  1ML8 A;  2HHH C;  2AYA A;  4GS5 A;  3VNR A;  4LE5 A;  2JMP A;  2ASB A;  3LAX A;  2P2M A;  1QWI A;  4DV2 C;  5BSM A;  4R0M A;  1MDF A;  4DUY C;  3IML A;  4BSZ A;  2WD9 A;  2YWC A;  4JI3 C;  4GXR A;  4DCV A;  5A1G A;  2DYJ A;  1MXC A;  3H2T A;  1VLA A;  5AE3 A;  4L7I A;  1N32 C;  3CW8 X;  1IBK C;  4NDN A;  1MDB A;  4GKJ C;  3L8C A;  4L2Z A;  5LMN C;  2D7V A;  3AF5 A;  3IEV A;  4LF4 C;  2P2F A;  1HNX C;  1XNR C;  4JI4 C;  5CZX A;  4LF6 C;  2QVZ X;  4D4I A;  5A2Q D;  3IPL A;  4D57 A;  1NYE A;  4YHH C;  4B3T C;  2VQF C;  1LCI A;  1YJ7 A;  3VNQ A;  4PZP A;  3J80 D;  2BH1 X;  3N2Q A;  4ODJ A;  3R9W A;  4LFA C;  1FJG C;  2PT7 G;  1XRC A;  1MXB A;  4JYA C;  5IT9 D;  5ADZ A;  4DV3 C;  3UOW A;  2QL8 A;  4DG9 A;  1XMQ C;  3CJE A;  1O93 A;  2P2J A;  3NPD A;  4D4G A;  3TDE A;  4OX9 C;  4TPS B;  1IBM C;  2XR1 A;  4BC7 A;  1GPM A;  1O92 A;  4RM2 A;  3E7W A;  3GKU A;  4RMN A;  2E5L C;  4LF9 C;  3UZ0 A;  3B7W A;  1RG9 A;  4GXQ A;  4DR5 C;  3S82 A;  4LF5 C;  4MTN A;  5A19 A;  4DR7 C;  3RV2 A;  2OPL B;  4ZLP A;  4GKK C;  2UUC C;  4KTV A;  1FUG A;  4KTT A;  5K85 A;  5AE1 A;  4JI2 C;  5BUS A;  1XNQ C;  5FLX D;  3DLP X;  3NYQ A;  2PN2 A;  2VQE C;  4JI1 C;  3AF6 A;  3NI2 A;  3JAM D;  4X62 C;  1HR0 C;  2E7G A;  4X65 C;  2UXB C;  4ZJZ A;  2OO4 A;  3PES A;  4DCU A;  1ULT A;  2DPL A;  5E7Q A;  3T1H C;  3DHV A;  3A4I A;  3IEU A;  4DR6 C;  4BBY A;  3VNS A;  2QW0 X;  2BJO A;  4WS9 A;  5H9U A;  4DUZ C;  2OBV A;  4AQY C;  2UXC C;  4FUQ A;  4NXN C;  5T8T A;  1EGA A;  2P2Q A;  1XRB A;  3EQ6 A;  2P02 A;  4EAT A;  3CW9 A;  5KYT A;  2D1T A;  1P7L A;  3R9X A;  3LGX A;  4JM1 A;  4PRO C;  1IBL C;  4XX2 A;  2EGT A;  4DV1 C;  5BUQ A;  3TQI A;  1XRA A;  2D1R A;  2HJG A;  3PRO C;  2VSQ A;  4G36 A;  1N2F A;  3FCE A;  2ONF A;  3T1Y C;  5KEI A;  1HH2 P;  2E8F A;  1J5E C;  4I9F A;  1USP B;  2VZE A;  4DV5 C;  4LF8 C;  4B3R C;  3ETC A;  5JRH A;  1MD9 A;  4G1I A;  3PBK A;  3FCC A;  3OTO C;  3I08 A;  4PHT A;  5BR8 C;  2QVY X;  4NOZ A;  4NXM C;  3G7S A;  2UUA C;  5BST A;  3RG2 A;  2ZM6 C;  4I9G A;  1N33 C;  4OXI A;  1RY2 A;  4IR7 A;  4RVN A;  2Y4O A;  3L95 X;  1K0R A;  4BCA A;  4DR2 C;  4JI7 C;  4X66 C;  5GTD A;  2CY1 A;  4L4Q A;  4DCT A;  4B3S C;  2UU9 C;  4HPV A;  1MKY A;  4DV4 C;  4IZ6 A;  2WP0 C;  1HNZ C;  4WV3 A;  1T5D X;  4JI5 C;  4B3M C;  5T8S A;  2YCB A;  4DCS A;  4U5Y D;  4KHP C;  1ZB9 A;  5K8F A;  4DV7 C;  4FTF A;  5KYV A;  2OPL A;  3A9V A;  4JI0 C;  4DR1 C;  4K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...