1XNRC

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnrC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnrC02
2E7GA 2ASBA 2UXDC 4JI4C 5A2QD 4DR4C 4LFBC 1J5EC 5IT9D 1N34C 3GKUA 4X66C 2OPLA 1USPA 2KZFA 4DV7C 4JI6C 4DR7C 4DV4C 4DR5C 3CJEA 1HNXC 1VLAA 2VQEC 2HHHC 3AF6A 2EGTA 4DV1C 1ZB8A 2E8CA 2PN2A 1ML8A 1PA4A 4NXMC 2UUAC 4DR2C 4X62C 3T1YC 1LQLA 1N33C 3I07A 1IBMC 1K0RA 4X64C 5LMNC 1HR0C 4DUZC 4JI5C 4DCVA 1L2FA 5BR8C 2UXCC 1MKYA 2UUBC 4LFAC 4JV5C 2HJGA 2UXBC 4BSZA 4DCTA 2D7VA 1EGAA 1JOSA 1N32C 1IBLC 2XR1A 4XX2A 4LF5C 3OTOC 4DCUA 2VQFC 4LF6C 4LFCC 2JMPA 1FJGC 4DUYC 2PT7G 2CY1A 1WH9A 4JI1C 4NOZA 4DR6C 4YHHC 1WF3A 4AQYC 1XNQC 2QL8A 4DR1C 1XNRC 2ATWA 2ONFA 4JYAC 1HH2P 1IBKC 2CXCA 2F4VC 1QWIA 4JI3C 3IEUA 3LUSA 4DCSA 4GKJC 4MTNA 1N36C 4JI7C 2E8EA 4LF4C 4DR3C 4KHPC 3JAMD 2OPLB 3EERA 1USPB 3J80D 4LF8C 3T1HC 3IEVA 2UU9C 5IWAC 4DV6C 2DYJA 1UKKA 3R9XA 3AF5A 4X65C 4B3RC 5LMUC 4JI2C 2ZM6C 5FLXD 4OX9C 4DV3C 1HNWC 4B3TC 4JI8C 4NXNC 4DV2C 2BJOA 1I94C 4JI0C 1XMQC 4K0KC 3J81D 3J7AD 4MH4A 1NYEA 1N2FA 4YY3C 4DV5C 2E5LC 4GKKC 1HNZC 4B3MC 4LF9C 3R9WA 2YCBA 1XMOC 4LF7C 4DV0C 2UUCC 1ZB9A 1KKGA 2E8FA 4B3SC
chains in the Genus database with same CATH superfamily
2E7GA 2ASBA 3NPDA 4JM1A 3UEBA 4WV3A 4JI4C 4DR4C 4G36A 1P4EA 1N34C 4L2ZA 2OPLA 4D4IA 4DV7C 5BSUA 1FLOA 3CW8X 2HHHC 3AF6A 1ZB8A 2UUAC 1PA4A 4DR2C 3LGXA 4PZPA 1LQLA 3L95X 1IBMC 3C5EA 3H2TA 3I08A 1XRAA 1RY2A 5LMNC 4DUZC 2UUBC 1JOSA 4D57A 1XS3A 4HPVA 4PUGA 4XX2A 5BSVA 3OTOC 2VQFC 4LFCC 4GS5A 5BSMA 4DUYC 4WS9A 1WH9A 2M5OA 4AQYC 4R1LA 3FCCA 3K6RA 1GPMA 3E7XA 2ATWA 1IBKC 3ETOA 5AE2A 1QWIA 4DCSA 3LUSA 4JI7C 5AE3A 2OPLB 4KTTA 3IEVA 4DV6C 1UKKA 3IMLA 4R1MA 2DPLA 2D1SA 3NYQA 5KEIA 4B3RC 5LMUC 1PU1A 3LNVA 1T5DX 1V60A 4DV2C 5KYVA 3A4IA 5ADZA 1XMQC 4K0KC 3J81D 2P2QA 4OXIA 2OO4A 2YCBA 4RM2A 1XMOC 4DV0C 2MMAB 3S82A 1KKGA 2E8FA 3RV2A 1O9TA 2CU6A 5A2QD 4RLQA 3CQ1A 3L8CA 4X66C 1UWDA 2KZFA 4JI6C 4DR7C 2KZ0A 5BSTA 3CW9A 2P2BA 5K85A 4FUQA 2MCQA 5JRHA 1FUGA 2PG1E 4IR7A 3UZ0A 1HR0C 4DCVA 4PUIA 1MDBA 1M6XC 1PG4A 3A25A 2HJGA 3PROC 2UXBC 1N32C 1EGAA 1IBLC 2XR1A 2QW0X 4DCUA 2Z51A 1XRBA 1O92A 4RM3A 1T5HX 2CY1A 3DLPX 1TH5A 1WCJA 3DAYA 2QL8A 4DR1C 4RLFA 2ZZNA 1HH2P 4RMNA 4MTNA 1N36C 2E8EA 4LF4C 4FTFA 4KHPC 5BSRA 3JAMD 4ZLPA 4R0MA 3J80D 4LF8C 4DG8A 3IPLA 4PHTA 2QVXX 4BC7A 4GXQA 4IZ6A 4EATA 5KYTA 5A1IA 4JI2C 2ZM6C 5AE1A 1P7LA 4G1IA 4BCAA 5A19A 4OX9C 5BUQA 3ETCA 2BJOA 4I9FA 2Y4NA 1NYEA 2VZEA 4DV5C 2AYAA 1HNZC 4LF9C 3R9WA 4LF7C 4ODJA 5BURA 2NCLA 3RG2A 2P2JA 5GTDA 4LFBC 2QVYX 3N2QA 3LNOA 3A9VA 4TPSB 4DV4C 3A26A 1PG3A 3LAXA 4DR5C 2Y4OA 1VLAA 2VQEC 1BA3A 4NXMC 4X62C 2ZTBA 3I07A 5BSWA 3CQ3A 5E7QA 3A9UA 2UXCC 1MKYA 3GPCA 5DV9A 4JV5C 4DCTA 2D7VA 4G37A 3EQ6A 2YWBA 4LF5C 2V7BA 3NI2A 3PBKA 3FCEA 2PT7G 4JI1C 1LCIA 1AMUA 3DHVA 4DR6C 4D4GA 1MDFA 1XNQC 3PESA 3O2EA 4JI3C 2D27A 3CQ2A 3EERA 1P4EC 3T1HC 1VEHA 2UU9C 3E7WA 1M6XA 4K0BA 2WD9A 5IWAC 2DYJA 4I9GA 3AF5A 4RVOA 3VNQA 4X65C 4BBYA 1MD9A 1RG9A 4FUTA 3VNSA 4L7IA 4RVNA 4DV3C 4D56A 4NXNC 2OBVA 1IB8A 2YX1A 3TUFA 4JI0C 3J7AD 4MH4A 1N2FA 1XHJA 4YY3C 1O90A 1ULTA 2E5LC 5IFIA 3NYRA 2UUCC 1ZB9A 2Y27A 4B3SC 4KTVA 3R44A 2QVZX 2UXDC 1MXBA 2D1QA 5CZVA 1J5EC 3UOWA 4PROC 2PROA 5IT9D 3GKUA 1O93A 2E0GA 2MM9A 1USPA 4LE5A 2P20A 3CJEA 5BUSA 1V25A 1HNXC 3B7WA 2EGTA 4DV1C 2E8CA 2PN2A 1ML8A 5H9UA 2M5HA 2D28C 3T1YC 1N33C 5K8FA 1K0RA 2P2MA 4X64C 5A1GA 4JI5C 1L2FA 5BR8C 4NDNA 5T8TA 4LFAC 4GXRA 2KDNA 3TDEA 4BSZA 1NY8A 4PUHA 1XRCA 2JNVA 3FM7A 4LF6C 2JMPA 1FJGC 2D1TA 4NOZA 4OYCA 4YHHC 1WF3A 1XNRC 4JYAC 2ONFA 2CXCA 3KXWA 2F4VC 2D1RA 4GKJC 3IEUA 4BC9A 4L4QA 2WP0C 4DR3C 3N54B 2P2FA 3G7SA 2DHMA 1USPB 3UX3A 1QM4A 1V26A 5T8SA 3R9XA 1MXCA 3GR1A 5LCIA 4ZJZA 3GR0A 5FLXD 1MXAA 4ISBA 1HNWC 2P02A 4B3TC 4JI8C 3UX2A 1YGTA 1I94C 3AY0A 1XDXA 4U5YD 3TR3A 4GKKC 2YWCA 4B3MC 2BH1X 2ZZMA 4DG9A 3SO4A 1YJ7A 2VSQA 5CZXA 3VNRA 3TQIA
chains in the Genus database with same CATH topology
2E7GA 2ASBA 3NPDA 4JM1A 4WV3A 4JI4C 4DR4C 4G36A 1N34C 4L2ZA 2OPLA 4D4IA 4DV7C 5BSUA 3CW8X 2HHHC 3AF6A 1ZB8A 2UUAC 1PA4A 4DR2C 3LGXA 4PZPA 1LQLA 3L95X 1IBMC 3C5EA 3H2TA 3I08A 1XRAA 1RY2A 5LMNC 4DUZC 2UUBC 1JOSA 4D57A 4HPVA 4XX2A 5BSVA 3OTOC 2VQFC 4LFCC 4GS5A 5BSMA 4DUYC 4WS9A 1WH9A 4AQYC 4R1LA 3FCCA 1GPMA 3E7XA 2ATWA 1IBKC 3ETOA 5AE2A 1QWIA 4DCSA 3LUSA 4JI7C 5AE3A 2OPLB 4KTTA 3IEVA 4DV6C 1UKKA 3IMLA 4R1MA 2DPLA 2D1SA 3NYQA 5KEIA 4B3RC 5LMUC 3LNVA 1T5DX 4DV2C 5KYVA 3A4IA 5ADZA 1XMQC 4K0KC 3J81D 2P2QA 4OXIA 2OO4A 2YCBA 4RM2A 1XMOC 4DV0C 1KKGA 3S82A 2E8FA 3RV2A 1O9TA 5A2QD 4RLQA 3L8CA 4X66C 2KZFA 4JI6C 4DR7C 5BSTA 3CW9A 2P2BA 5K85A 4FUQA 5JRHA 1FUGA 4IR7A 3UZ0A 1HR0C 4DCVA 1MDBA 1PG4A 2HJGA 3PROC 2UXBC 1N32C 1EGAA 1IBLC 2XR1A 2QW0X 4DCUA 1XRBA 1O92A 4RM3A 1T5HX 2CY1A 3DLPX 3DAYA 2QL8A 4DR1C 4RLFA 1HH2P 4RMNA 4MTNA 1N36C 2E8EA 4LF4C 4FTFA 4KHPC 5BSRA 3JAMD 4ZLPA 4R0MA 3J80D 4LF8C 4DG8A 3IPLA 4PHTA 2QVXX 4BC7A 4GXQA 4IZ6A 4EATA 5KYTA 5A1IA 4JI2C 2ZM6C 5AE1A 1P7LA 4G1IA 4BCAA 5A19A 4OX9C 5BUQA 3ETCA 2BJOA 4I9FA 2Y4NA 1NYEA 2VZEA 4DV5C 2AYAA 1HNZC 4LF9C 3R9WA 4LF7C 4ODJA 5BURA 3RG2A 2P2JA 5GTDA 4LFBC 2QVYX 3N2QA 3A9VA 4TPSB 4DV4C 3LAXA 1PG3A 4DR5C 2Y4OA 1VLAA 2VQEC 1BA3A 4NXMC 4X62C 3I07A 5BSWA 5E7QA 3A9UA 2UXCC 1MKYA 3GPCA 5DV9A 4JV5C 4DCTA 2D7VA 4G37A 3EQ6A 2YWBA 4LF5C 2V7BA 3NI2A 3PBKA 3FCEA 2PT7G 4JI1C 1LCIA 1AMUA 3DHVA 4DR6C 4D4GA 1MDFA 1XNQC 3PESA 4JI3C 2D27A 3EERA 3T1HC 2UU9C 3E7WA 4K0BA 2WD9A 5IWAC 2DYJA 4I9GA 3AF5A 4RVOA 3VNQA 4X65C 4BBYA 1MD9A 1RG9A 4FUTA 3VNSA 4L7IA 4RVNA 4DV3C 4D56A 4NXNC 2OBVA 3TUFA 4JI0C 3J7AD 4MH4A 1N2FA 4YY3C 1O90A 1ULTA 2E5LC 5IFIA 3NYRA 2UUCC 1ZB9A 2Y27A 4B3SC 4KTVA 3R44A 2QVZX 2UXDC 1MXBA 2D1QA 5CZVA 1J5EC 3UOWA 4PROC 2PROA 5IT9D 3GKUA 1O93A 2E0GA 1USPA 4LE5A 2P20A 3CJEA 5BUSA 1V25A 1HNXC 3B7WA 2EGTA 4DV1C 2E8CA 2PN2A 1ML8A 5H9UA 2D28C 3T1YC 1N33C 5K8FA 1K0RA 2P2MA 4X64C 5A1GA 4JI5C 1L2FA 5BR8C 4NDNA 5T8TA 4LFAC 4GXRA 3TDEA 4BSZA 1XRCA 4LF6C 2JMPA 1FJGC 2D1TA 4NOZA 4OYCA 4YHHC 1WF3A 1XNRC 4JYAC 2ONFA 2CXCA 3KXWA 2F4VC 2D1RA 4GKJC 3IEUA 4BC9A 4L4QA 2WP0C 4DR3C 3N54B 2P2FA 3G7SA 1USPB 1QM4A 1V26A 5T8SA 3R9XA 1MXCA 3GR1A 4ZJZA 3GR0A 5FLXD 1MXAA 4ISBA 1HNWC 2P02A 4B3TC 4JI8C 1I94C 4U5YD 4GKKC 2YWCA 4B3MC 2BH1X 4DG9A 3SO4A 1YJ7A 2VSQA 5CZXA 3VNRA 3TQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7G A;  2ASB A;  2UXD C;  4JI4 C;  5A2Q D;  4DR4 C;  4LFB C;  1J5E C;  5IT9 D;  1N34 C;  3GKU A;  4X66 C;  2OPL A;  1USP A;  2KZF A;  4DV7 C;  4JI6 C;  4DR7 C;  4DV4 C;  4DR5 C;  3CJE A;  1HNX C;  1VLA A;  2VQE C;  2HHH C;  3AF6 A;  2EGT A;  4DV1 C;  1ZB8 A;  2E8C A;  2PN2 A;  1ML8 A;  1PA4 A;  4NXM C;  2UUA C;  4DR2 C;  4X62 C;  3T1Y C;  1LQL A;  1N33 C;  3I07 A;  1IBM C;  1K0R A;  4X64 C;  5LMN C;  1HR0 C;  4DUZ C;  4JI5 C;  4DCV A;  1L2F A;  5BR8 C;  2UXC C;  1MKY A;  2UUB C;  4LFA C;  4JV5 C;  2HJG A;  2UXB C;  4BSZ A;  4DCT A;  2D7V A;  1EGA A;  1JOS A;  1N32 C;  1IBL C;  2XR1 A;  4XX2 A;  4LF5 C;  3OTO C;  4DCU A;  2VQF C;  4LF6 C;  4LFC C;  2JMP A;  1FJG C;  4DUY C;  2PT7 G;  2CY1 A;  1WH9 A;  4JI1 C;  4NOZ A;  4DR6 C;  4YHH C;  1WF3 A;  4AQY C;  1XNQ C;  2QL8 A;  4DR1 C;  1XNR C;  2ATW A;  2ONF A;  4JYA C;  1HH2 P;  1IBK C;  2CXC A;  2F4V C;  1QWI A;  4JI3 C;  3IEU A;  3LUS A;  4DCS A;  4GKJ C;  4MTN A;  1N36 C;  4JI7 C;  2E8E A;  4LF4 C;  4DR3 C;  4KHP C;  3JAM D;  2OPL B;  3EER A;  1USP B;  3J80 D;  4LF8 C;  3T1H C;  3IEV A;  2UU9 C;  5IWA C;  4DV6 C;  2DYJ A;  1UKK A;  3R9X A;  3AF5 A;  4X65 C;  4B3R C;  5LMU C;  4JI2 C;  2ZM6 C;  5FLX D;  4OX9 C;  4DV3 C;  1HNW C;  4B3T C;  4JI8 C;  4NXN C;  4DV2 C;  2BJO A;  1I94 C;  4JI0 C;  1XMQ C;  4K0K C;  3J81 D;  3J7A D;  4MH4 A;  1NYE A;  1N2F A;  4YY3 C;  4DV5 C;  2E5L C;  4GKK C;  1HNZ C;  4B3M C;  4LF9 C;  3R9W A;  2YCB A;  1XMO C;  4LF7 C;  4DV0 C;  2UUC C;  1ZB9 A;  1KKG A;  2E8F A;  4B3S C; 
#chains in the Genus database with same CATH topology
 2E7G A;  2ASB A;  3NPD A;  4JM1 A;  3UEB A;  4WV3 A;  4JI4 C;  4DR4 C;  4G36 A;  1P4E A;  1N34 C;  4L2Z A;  2OPL A;  4D4I A;  4DV7 C;  5BSU A;  1FLO A;  3CW8 X;  2HHH C;  3AF6 A;  1ZB8 A;  2UUA C;  1PA4 A;  4DR2 C;  3LGX A;  4PZP A;  1LQL A;  3L95 X;  1IBM C;  3C5E A;  3H2T A;  3I08 A;  1XRA A;  1RY2 A;  5LMN C;  4DUZ C;  2UUB C;  1JOS A;  4D57 A;  1XS3 A;  4HPV A;  4PUG A;  4XX2 A;  5BSV A;  3OTO C;  2VQF C;  4LFC C;  4GS5 A;  5BSM A;  4DUY C;  4WS9 A;  1WH9 A;  2M5O A;  4AQY C;  4R1L A;  3FCC A;  3K6R A;  1GPM A;  3E7X A;  2ATW A;  1IBK C;  3ETO A;  5AE2 A;  1QWI A;  4DCS A;  3LUS A;  4JI7 C;  5AE3 A;  2OPL B;  4KTT A;  3IEV A;  4DV6 C;  1UKK A;  3IML A;  4R1M A;  2DPL A;  2D1S A;  3NYQ A;  5KEI A;  4B3R C;  5LMU C;  1PU1 A;  3LNV A;  1T5D X;  1V60 A;  4DV2 C;  5KYV A;  3A4I A;  5ADZ A;  1XMQ C;  4K0K C;  3J81 D;  2P2Q A;  4OXI A;  2OO4 A;  2YCB A;  4RM2 A;  1XMO C;  4DV0 C;  2MMA B;  3S82 A;  1KKG A;  2E8F A;  3RV2 A;  1O9T A;  2CU6 A;  5A2Q D;  4RLQ A;  3CQ1 A;  3L8C A;  4X66 C;  1UWD A;  2KZF A;  4JI6 C;  4DR7 C;  2KZ0 A;  5BST A;  3CW9 A;  2P2B A;  5K85 A;  4FUQ A;  2MCQ A;  5JRH A;  1FUG A;  2PG1 E;  4IR7 A;  3UZ0 A;  1HR0 C;  4DCV A;  4PUI A;  1MDB A;  1M6X C;  1PG4 A;  3A25 A;  2HJG A;  3PRO C;  2UXB C;  1N32 C;  1EGA A;  1IBL C;  2XR1 A;  2QW0 X;  4DCU A;  2Z51 A;  1XRB A;  1O92 A;  4RM3 A;  1T5H X;  2CY1 A;  3DLP X;  1TH5 A;  1WCJ A;  3DAY A;  2QL8 A;  4DR1 C;  4RLF A;  2ZZN A;  1HH2 P;  4RMN A;  4MTN A;  1N36 C;  2E8E A;  4LF4 C;  4FTF A;  4KHP C;  5BSR A;  3JAM D;  4ZLP A;  4R0M A;  3J80 D;  4LF8 C;  4DG8 A;  3IPL A;  4PHT A;  2QVX X;  4BC7 A;  4GXQ A;  4IZ6 A;  4EAT A;  5KYT A;  5A1I A;  4JI2 C;  2ZM6 C;  5AE1 A;  1P7L A;  4G1I A;  4BCA A;  5A19 A;  4OX9 C;  5BUQ A;  3ETC A;  2BJO A;  4I9F A;  2Y4N A;  1NYE A;  2VZE A;  4DV5 C;  2AYA A;  1HNZ C;  4LF9 C;  3R9W A;  4LF7 C;  4ODJ A;  5BUR A;  2NCL A;  3RG2 A;  2P2J A;  5GTD A;  4LFB C;  2QVY X;  3N2Q A;  3LNO A;  3A9V A;  4TPS B;  4DV4 C;  3A26 A;  1PG3 A;  3LAX A;  4DR5 C;  2Y4O A;  1VLA A;  2VQE C;  1BA3 A;  4NXM C;  4X62 C;  2ZTB A;  3I07 A;  5BSW A;  3CQ3 A;  5E7Q A;  3A9U A;  2UXC C;  1MKY A;  3GPC A;  5DV9 A;  4JV5 C;  4DCT A;  2D7V A;  4G37 A;  3EQ6 A;  2YWB A;  4LF5 C;  2V7B A;  3NI2 A;  3PBK A;  3FCE A;  2PT7 G;  4JI1 C;  1LCI A;  1AMU A;  3DHV A;  4DR6 C;  4D4G A;  1MDF A;  1XNQ C;  3PES A;  3O2E A;  4JI3 C;  2D27 A;  3CQ2 A;  3EER A;  1P4E C;  3T1H C;  1VEH A;  2UU9 C;  3E7W A;  1M6X A;  4K0B A;  2WD9 A;  5IWA C;  2DYJ A;  4I9G A;  3AF5 A;  4RVO A;  3VNQ A;  4X65 C;  4BBY A;  1MD9 A;  1RG9 A;  4FUT A;  3VNS A;  4L7I A;  4RVN A;  4DV3 C;  4D56 A;  4NXN C;  2OBV A;  1IB8 A;  2YX1 A;  3TUF A;  4JI0 C;  3J7A D;  4MH4 A;  1N2F A;  1XHJ A;  4YY3 C;  1O90 A;  1ULT A;  2E5L C;  5IFI A;  3NYR A;  2UUC C;  1ZB9 A;  2Y27 A;  4B3S C;  4KTV A;  3R44 A;  2QVZ X;  2UXD C;  1MXB A;  2D1Q A;  5CZV A;  1J5E C;  3UOW A;  4PRO C;  2PRO A;  5IT9 D;  3GKU A;  1O93 A;  2E0G A;  2MM9 A;  1USP A;  4LE5 A;  2P20 A;  3CJE A;  5BUS A;  1V25 A;  1HNX C;  3B7W A;  2EGT A;  4DV1 C;  2E8C A;  2PN2 A;  1ML8 A;  5H9U A;  2M5H A;  2D28 C;  3T1Y C;  1N33 C;  5K8F A;  1K0R A;  2P2M A;  4X64 C;  5A1G A;  4JI5 C;  1L2F A;  5BR8 C;  4NDN A;  5T8T A;  4LFA C;  4GXR A;  2KDN A;  3TDE A;  4BSZ A;  1NY8 A;  4PUH A;  1XRC A;  2JNV A;  3FM7 A;  4LF6 C;  2JMP A;  1FJG C;  2D1T A;  4NOZ A;  4OYC A;  4YHH C;  1WF3 A;  1XNR C;  4JYA C;  2ONF A;  2CXC A;  3KXW A;  2F4V C;  2D1R A;  4GKJ C;  3IEU A;  4BC9 A;  4L4Q A;  2WP0 C;  4DR3 C;  3N54 B;  2P2F A;  3G7S A;  2DHM A;  1USP B;  3UX3 A;  1QM4 A;  1V26 A;  5T8S A;  3R9X A;  1MXC A;  3GR1 A;  5LCI A;  4ZJZ A;  3GR0 A;  5FLX D;  1MXA A;  4ISB A;  1HNW C;  2P02 A;  4B3T C;  4JI8 C;  3UX2 A;  1YGT A;  1I94 C;  3AY0 A;  1XDX A;  4U5Y D;  3TR3 A;  4GKK C;  2YWC A;  4B3M C;  2BH1 X;  2ZZM A;  4DG9 A;  3SO4 A;  1YJ7 A;  2VSQ A;  5CZX A;  3VNR A;  3TQI A; 
#chains in the Genus database with same CATH homology
 2E7G A;  2ASB A;  3NPD A;  4JM1 A;  4WV3 A;  4JI4 C;  4DR4 C;  4G36 A;  1N34 C;  4L2Z A;  2OPL A;  4D4I A;  4DV7 C;  5BSU A;  3CW8 X;  2HHH C;  3AF6 A;  1ZB8 A;  2UUA C;  1PA4 A;  4DR2 C;  3LGX A;  4PZP A;  1LQL A;  3L95 X;  1IBM C;  3C5E A;  3H2T A;  3I08 A;  1XRA A;  1RY2 A;  5LMN C;  4DUZ C;  2UUB C;  1JOS A;  4D57 A;  4HPV A;  4XX2 A;  5BSV A;  3OTO C;  2VQF C;  4LFC C;  4GS5 A;  5BSM A;  4DUY C;  4WS9 A;  1WH9 A;  4AQY C;  4R1L A;  3FCC A;  1GPM A;  3E7X A;  2ATW A;  1IBK C;  3ETO A;  5AE2 A;  1QWI A;  4DCS A;  3LUS A;  4JI7 C;  5AE3 A;  2OPL B;  4KTT A;  3IEV A;  4DV6 C;  1UKK A;  3IML A;  4R1M A;  2DPL A;  2D1S A;  3NYQ A;  5KEI A;  4B3R C;  5LMU C;  3LNV A;  1T5D X;  4DV2 C;  5KYV A;  3A4I A;  5ADZ A;  1XMQ C;  4K0K C;  3J81 D;  2P2Q A;  4OXI A;  2OO4 A;  2YCB A;  4RM2 A;  1XMO C;  4DV0 C;  1KKG A;  3S82 A;  2E8F A;  3RV2 A;  1O9T A;  5A2Q D;  4RLQ A;  3L8C A;  4X66 C;  2KZF A;  4JI6 C;  4DR7 C;  5BST A;  3CW9 A;  2P2B A;  5K85 A;  4FUQ A;  5JRH A;  1FUG A;  4IR7 A;  3UZ0 A;  1HR0 C;  4DCV A;  1MDB A;  1PG4 A;  2HJG A;  3PRO C;  2UXB C;  1N32 C;  1EGA A;  1IBL C;  2XR1 A;  2QW0 X;  4DCU A;  1XRB A;  1O92 A;  4RM3 A;  1T5H X;  2CY1 A;  3DLP X;  3DAY A;  2QL8 A;  4DR1 C;  4RLF A;  1HH2 P;  4RMN A;  4MTN A;  1N36 C;  2E8E A;  4LF4 C;  4FTF A;  4KHP C;  5BSR A;  3JAM D;  4ZLP A;  4R0M A;  3J80 D;  4LF8 C;  4DG8 A;  3IPL A;  4PHT A;  2QVX X;  4BC7 A;  4GXQ A;  4IZ6 A;  4EAT A;  5KYT A;  5A1I A;  4JI2 C;  2ZM6 C;  5AE1 A;  1P7L A;  4G1I A;  4BCA A;  5A19 A;  4OX9 C;  5BUQ A;  3ETC A;  2BJO A;  4I9F A;  2Y4N A;  1NYE A;  2VZE A;  4DV5 C;  2AYA A;  1HNZ C;  4LF9 C;  3R9W A;  4LF7 C;  4ODJ A;  5BUR A;  3RG2 A;  2P2J A;  5GTD A;  4LFB C;  2QVY X;  3N2Q A;  3A9V A;  4TPS B;  4DV4 C;  3LAX A;  1PG3 A;  4DR5 C;  2Y4O A;  1VLA A;  2VQE C;  1BA3 A;  4NXM C;  4X62 C;  3I07 A;  5BSW A;  5E7Q A;  3A9U A;  2UXC C;  1MKY A;  3GPC A;  5DV9 A;  4JV5 C;  4DCT A;  2D7V A;  4G37 A;  3EQ6 A;  2YWB A;  4LF5 C;  2V7B A;  3NI2 A;  3PBK A;  3FCE A;  2PT7 G;  4JI1 C;  1LCI A;  1AMU A;  3DHV A;  4DR6 C;  4D4G A;  1MDF A;  1XNQ C;  3PES A;  4JI3 C;  2D27 A;  3EER A;  3T1H C;  2UU9 C;  3E7W A;  4K0B A;  2WD9 A;  5IWA C;  2DYJ A;  4I9G A;  3AF5 A;  4RVO A;  3VNQ A;  4X65 C;  4BBY A;  1MD9 A;  1RG9 A;  4FUT A;  3VNS A;  4L7I A;  4RVN A;  4DV3 C;  4D56 A;  4NXN C;  2OBV A;  3TUF A;  4JI0 C;  3J7A D;  4MH4 A;  1N2F A;  4YY3 C;  1O90 A;  1ULT A;  2E5L C;  5IFI A;  3NYR A;  2UUC C;  1ZB9 A;  2Y27 A;  4B3S C;  4KTV A;  3R44 A;  2QVZ X;  2UXD C;  1MXB A;  2D1Q A;  5CZV A;  1J5E C;  3UOW A;  4PRO C;  2PRO A;  5IT9 D;  3GKU A;  1O93 A;  2E0G A;  1USP A;  4LE5 A;  2P20 A;  3CJE A;  5BUS A;  1V25 A;  1HNX C;  3B7W A;  2EGT A;  4DV1 C;  2E8C A;  2PN2 A;  1ML8 A;  5H9U A;  2D28 C;  3T1Y C;  1N33 C;  5K8F A;  1K0R A;  2P2M A;  4X64 C;  5A1G A;  4JI5 C;  1L2F A;  5BR8 C;  4NDN A;  5T8T A;  4LFA C;  4GXR A;  3TDE A;  4BSZ A;  1XRC A;  4LF6 C;  2JMP A;  1FJG C;  2D1T A;  4NOZ A;  4OYC A;  4YHH C;  1WF3 A;  1XNR C;  4JYA C;  2ONF A;  2CXC A;  3KXW A;  2F4V C;  2D1R A;  4GKJ C;  3IEU A;  4BC9 A;  4L4Q A;  2WP0 C;  4DR3 C;  3N54 B;  2P2F A;  3G7S A;  1USP B;  1QM4 A;  1V26 A;  5T8S A;  3R9X A;  1MXC A;  3GR1 A;  4ZJZ A;  3GR0 A;  5FLX D;  1MXA A;  4ISB A;  1HNW C;  2P02 A;  4B3T C;  4JI8 C;  1I94 C;  4U5Y D;  4GKK C;  2YWC A;  4B3M C;  2BH1 X;  4DG9 A;  3SO4 A;  1YJ7 A;  2VSQ A;  5CZX A;  3VNR A;  3TQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...