1XNRC

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnrC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnrC02
2KZFA 2VQEC 5LMNC 4X66C 1PA4A 4LF9C 4JI4C 1N36C 1ZB8A 2OPLB 4DV5C 2CY1A 4DV6C 2QL8A 3IEVA 4JI0C 3R9WA 4K0KC 1FJGC 2ATWA 1QWIA 5A2QD 1HH2P 2XR1A 1XNQC 2F4VC 4KHPC 1WF3A 4JI3C 1XMQC 4DR6C 2YCBA 3EERA 1IBMC 4DR4C 4X64C 4BSZA 4OX9C 1N32C 1IBLC 5IT9D 1K0RA 4GKKC 1HNZC 2BJOA 2EGTA 2E8FA 1MKYA 2PN2A 4B3SC 4DR1C 1I94C 1USPA 4DV2C 2JMPA 5FLXD 4B3MC 4DCVA 4GKJC 4JI7C 4DV3C 1WH9A 3CJEA 4LF6C 4B3TC 2UXBC 2UXCC 1XMOC 4LF4C 1XNRC 5LMUC 4DUZC 1HNXC 4DR3C 4DR7C 4DV7C 4LFCC 2E8CA 4JI5C 1UKKA 2HHHC 3J7AD 2UXDC 4AQYC 1HNWC 2UUCC 4JI8C 4LF7C 4DV4C 4B3RC 1N33C 4DCUA 4MTNA 4LFAC 1J5EC 2DYJA 4DCSA 2UUBC 4LFBC 2E5LC 1N2FA 1LQLA 4NXMC 3OTOC 4X62C 4XX2A 2CXCA 3R9XA 3GKUA 2HJGA 1N34C 4JYAC 4LF8C 1USPB 1KKGA 4LF5C 1NYEA 2ZM6C 2E8EA 4DUYC 4DR5C 2D7VA 4JI1C 1JOSA 1IBKC 4MH4A 1ZB9A 1L2FA 5BR8C 4JV5C 4YHHC 2ONFA 2VQFC 4DV0C 1HR0C 1VLAA 3JAMD 4DCTA 3T1YC 1ML8A 4X65C 3T1HC 2PT7G 2UU9C 4JI6C 3AF5A 3I07A 3LUSA 4NOZA 4NXNC 4DV1C 4JI2C 2UUAC 5IWAC 3IEUA 1EGAA 2E7GA 4YY3C 3J81D 2OPLA 3J80D 3AF6A 4DR2C 2ASBA
chains in the Genus database with same CATH superfamily
5LMNC 4FTFA 4D57A 4JI4C 2CU6A 4D4IA 4DV6C 2WD9A 2QL8A 1O9TA 2P2MA 1V26A 3TUFA 4ISBA 1QWIA 5A2QD 4KHPC 2OO4A 3K6RA 4I9GA 4DR6C 2KDNA 3EERA 5A1GA 1BA3A 1N32C 1IBLC 5IT9D 2P2JA 2KZ0A 1PU1A 1ULTA 5FLXD 4B3MC 4DCVA 1XS3A 3DAYA 3LGXA 4JI7C 5KEIA 2MM9A 5ADZA 5E7QA 4LF6C 4WV3A 2UXBC 2UXCC 1XNRC 5LMUC 4BCAA 2P2BA 3C5EA 4HPVA 4LFCC 1XRCA 4JI5C 4AQYC 1HNWC 4B3RC 1MXCA 4DCUA 1T5HX 2D1SA 4DCSA 2V7BA 2UUBC 4LFBC 4PUHA 2Z51A 2D28C 3LNVA 3I08A 4XX2A 2CXCA 3R9XA 1MDBA 3PBKA 4PUIA 5A19A 4LF8C 4LF5C 1P7LA 2ZM6C 3GR0A 4G37A 1JOSA 2QVZX 1PG4A 4D56A 3ETOA 2P20A 1VLAA 4DCTA 4OXIA 4X65C 3VNSA 4DV1C 3TDEA 1NY8A 3A25A 1XRAA 3J81D 2AYAA 1M6XA 2ASBA 4PHTA 2VQEC 4X66C 2VZEA 3O2EA 5BUSA 4RMNA 4K0KC 2YWBA 4RM3A 2JNVA 1WF3A 3VNRA 4FUTA 2D27A 4JI3C 5K85A 3TQIA 1IBMC 3A9VA 4KTTA 3RV2A 1K0RA 5CZXA 4I9FA 3VNQA 4R1MA 2PN2A 3CQ2A 4DR1C 5BSRA 4DG9A 5T8SA 3RG2A 4FUQA 4GKJC 3NYRA 2P02A 2OBVA 3IPLA 2BH1X 2M5OA 2ZZNA 4DUZC 2DHMA 5BUQA 2E8CA 3N54B 4PROC 2UXDC 4LF7C 4DV4C 1O90A 2YX1A 2QW0X 4GS5A 5BSUA 2DYJA 4KTVA 4D4GA 2M5HA 1N2FA 1LQLA 3TR3A 5BSTA 3ETCA 5KYTA 3UX3A 1P4EA 3LNOA 2HJGA 1N34C 1KKGA 4DR5C 3NYQA 5IFIA 2D7VA 1GPMA 2PG1E 3KXWA 4IZ6A 4YHHC 2D1QA 1HR0C 3T1YC 1ML8A 2VSQA 3R44A 3AF5A 1IB8A 4NOZA 5BSWA 2NCLA 2UUAC 3IEUA 3A26A 4RVNA 4DR2C 3J80D 4RM2A 3DHVA 1FUGA 1N36C 1ZB8A 4DV5C 2CY1A 4K0BA 3G7SA 3IEVA 3DLPX 2DPLA 1HH2P 2XR1A 3CQ1A 3LAXA 2E0GA 3UOWA 5A1IA 1XDXA 4GXRA 1YJ7A 5JRHA 4DR4C 4X64C 4BSZA 4GKKC 4PUGA 3A9UA 2EGTA 1M6XC 1TH5A 3SO4A 1I94C 2JMPA 1LCIA 4L7IA 5K8FA 3FM7A 3GPCA 3L95X 5AE3A 4DV3C 1PG3A 3CJEA 4B3TC 3UZ0A 4TPSB 4G1IA 1AMUA 1HNXC 4GXQA 4DR7C 1O93A 3PESA 1MXAA 4WS9A 4JI8C 1N33C 4MTNA 3E7XA 1J5EC 5H9UA 2E5LC 4NXMC 5AE1A 5BSVA 2QVXX 4R1LA 3OTOC 2MMAB 4RVOA 3E7WA 4JYAC 1USPB 3S82A 1NYEA 1O92A 2E8EA 4JI1C 1V60A 3CQ3A 1IBKC 1XRBA 4MH4A 5DV9A 5AE2A 1ZB9A 1L2FA 4L2ZA 4JV5C 4DV0C 3FCEA 3JAMD 3A4IA 4ODJA 2P2QA 2PT7G 4JI6C 2P2FA 3I07A 1MXBA 4JI2C 1XHJA 5BSMA 5IWAC 4YY3C 3UX2A 2OPLA 3IMLA 4G36A 2KZFA 1PA4A 1RG9A 4LF9C 1P4EC 5CZVA 5KYVA 2OPLB 5LCIA 4JI0C 2PROA 1V25A 3R9WA 1FJGC 4NDNA 5T8TA 2ATWA 3B7WA 1QM4A 1YGTA 2MCQA 1XNQC 2F4VC 1XMQC 2Y27A 4ZLPA 2YCBA 4BBYA 4OX9C 4DG8A 3CW9A 1HNZC 2BJOA 4IR7A 3AY0A 2E8FA 1MKYA 3L8CA 1RY2A 4B3SC 4U5YD 3FCCA 4LE5A 1USPA 4ZJZA 4DV2C 4RLQA 2D1TA 5GTDA 4RLFA 3GR1A 3PROC 1WH9A 2YWCA 1XMOC 4LF4C 3H2TA 2ZZMA 4DR3C 2D1RA 4DV7C 4OYCA 2Y4OA 1UKKA 2WP0C 2HHHC 1MDFA 3J7AD 4R0MA 2UUCC 4PZPA 4LFAC 4L4QA 4BC9A 1T5DX 1UWDA 3N2QA 5BURA 4X62C 3GKUA 3NI2A 4BC7A 1FLOA 2Y4NA 1VEHA 2QVYX 3CW8X 4DUYC 1WCJA 4EATA 5BR8C 4JM1A 2ONFA 2VQFC 2ZTBA 1MD9A 3EQ6A 3T1HC 2UU9C 3LUSA 3UEBA 3NPDA 4NXNC 1EGAA 2E7GA 3AF6A
chains in the Genus database with same CATH topology
5LMNC 4FTFA 4D57A 4JI4C 4D4IA 4DV6C 2WD9A 2QL8A 1O9TA 2P2MA 1V26A 3TUFA 4ISBA 1QWIA 5A2QD 4KHPC 2OO4A 4I9GA 4DR6C 3EERA 5A1GA 1BA3A 1N32C 1IBLC 5IT9D 2P2JA 1ULTA 4B3MC 5FLXD 4DCVA 3DAYA 3LGXA 4JI7C 5KEIA 5ADZA 5E7QA 4LF6C 4WV3A 2UXBC 2UXCC 1XNRC 5LMUC 4BCAA 2P2BA 3C5EA 4HPVA 4LFCC 1XRCA 4JI5C 4AQYC 1HNWC 4B3RC 1MXCA 4DCUA 1T5HX 2D1SA 4DCSA 2V7BA 2UUBC 4LFBC 2D28C 3LNVA 3I08A 4XX2A 2CXCA 3R9XA 1MDBA 3PBKA 5A19A 4LF8C 4LF5C 1P7LA 2ZM6C 3GR0A 4G37A 1JOSA 2QVZX 1PG4A 4D56A 3ETOA 2P20A 1VLAA 4DCTA 4OXIA 4X65C 3VNSA 4DV1C 3TDEA 1XRAA 3J81D 2AYAA 2ASBA 4PHTA 2VQEC 4X66C 2VZEA 5BUSA 4RMNA 4K0KC 2YWBA 4RM3A 1WF3A 3VNRA 4FUTA 2D27A 4JI3C 5K85A 3TQIA 1IBMC 3A9VA 4KTTA 3RV2A 1K0RA 5CZXA 4I9FA 3VNQA 4R1MA 2PN2A 4DR1C 5BSRA 4DG9A 5T8SA 3RG2A 4FUQA 4GKJC 3NYRA 2P02A 2OBVA 3IPLA 2BH1X 4DUZC 5BUQA 2E8CA 3N54B 4PROC 2UXDC 4LF7C 4DV4C 1O90A 2QW0X 4GS5A 5BSUA 2DYJA 4KTVA 4D4GA 1N2FA 1LQLA 5BSTA 3ETCA 5KYTA 2HJGA 1N34C 1KKGA 4DR5C 3NYQA 5IFIA 2D7VA 1GPMA 3KXWA 4IZ6A 4YHHC 2D1QA 1HR0C 3T1YC 1ML8A 2VSQA 3R44A 3AF5A 4NOZA 5BSWA 2UUAC 3IEUA 4RVNA 4DR2C 3J80D 4RM2A 3DHVA 1FUGA 1N36C 1ZB8A 4DV5C 2CY1A 4K0BA 3G7SA 3IEVA 3DLPX 2DPLA 1HH2P 2XR1A 3LAXA 2E0GA 3UOWA 5A1IA 4GXRA 1YJ7A 5JRHA 4DR4C 4X64C 4BSZA 4GKKC 3A9UA 2EGTA 3SO4A 1I94C 2JMPA 1LCIA 4L7IA 5K8FA 3GPCA 3L95X 5AE3A 4DV3C 1PG3A 3CJEA 4B3TC 3UZ0A 4TPSB 4G1IA 1AMUA 1HNXC 4GXQA 4DR7C 1O93A 3PESA 1MXAA 4WS9A 4JI8C 1N33C 4MTNA 3E7XA 1J5EC 5H9UA 2E5LC 4NXMC 5AE1A 5BSVA 2QVXX 4R1LA 3OTOC 4RVOA 3E7WA 4JYAC 1USPB 3S82A 1NYEA 1O92A 2E8EA 4JI1C 1IBKC 1XRBA 4MH4A 5DV9A 5AE2A 1ZB9A 1L2FA 4L2ZA 4JV5C 4DV0C 3FCEA 3JAMD 3A4IA 4ODJA 2P2QA 2PT7G 4JI6C 2P2FA 3I07A 1MXBA 4JI2C 5BSMA 5IWAC 4YY3C 2OPLA 3IMLA 4G36A 2KZFA 1PA4A 1RG9A 4LF9C 5CZVA 5KYVA 2OPLB 4JI0C 2PROA 1V25A 3R9WA 1FJGC 4NDNA 5T8TA 2ATWA 3B7WA 1QM4A 1XNQC 2F4VC 1XMQC 2Y27A 4ZLPA 2YCBA 4BBYA 4OX9C 4DG8A 3CW9A 1HNZC 2BJOA 4IR7A 2E8FA 1MKYA 3L8CA 1RY2A 4B3SC 4U5YD 3FCCA 4LE5A 1USPA 4ZJZA 4DV2C 4RLQA 2D1TA 5GTDA 4RLFA 3GR1A 3PROC 1WH9A 2YWCA 1XMOC 4LF4C 3H2TA 4DR3C 2D1RA 4DV7C 4OYCA 2Y4OA 1UKKA 2WP0C 2HHHC 1MDFA 3J7AD 4R0MA 2UUCC 4PZPA 4LFAC 4L4QA 4BC9A 1T5DX 3N2QA 5BURA 4X62C 3GKUA 3NI2A 4BC7A 2Y4NA 3CW8X 2QVYX 4DUYC 4EATA 5BR8C 4JM1A 2ONFA 2VQFC 1MD9A 3EQ6A 3T1HC 2UU9C 3LUSA 3NPDA 4NXNC 1EGAA 2E7GA 3AF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZF A;  2VQE C;  5LMN C;  4X66 C;  1PA4 A;  4LF9 C;  4JI4 C;  1N36 C;  1ZB8 A;  2OPL B;  4DV5 C;  2CY1 A;  4DV6 C;  2QL8 A;  3IEV A;  4JI0 C;  3R9W A;  4K0K C;  1FJG C;  2ATW A;  1QWI A;  5A2Q D;  1HH2 P;  2XR1 A;  1XNQ C;  2F4V C;  4KHP C;  1WF3 A;  4JI3 C;  1XMQ C;  4DR6 C;  2YCB A;  3EER A;  1IBM C;  4DR4 C;  4X64 C;  4BSZ A;  4OX9 C;  1N32 C;  1IBL C;  5IT9 D;  1K0R A;  4GKK C;  1HNZ C;  2BJO A;  2EGT A;  2E8F A;  1MKY A;  2PN2 A;  4B3S C;  4DR1 C;  1I94 C;  1USP A;  4DV2 C;  2JMP A;  5FLX D;  4B3M C;  4DCV A;  4GKJ C;  4JI7 C;  4DV3 C;  1WH9 A;  3CJE A;  4LF6 C;  4B3T C;  2UXB C;  2UXC C;  1XMO C;  4LF4 C;  1XNR C;  5LMU C;  4DUZ C;  1HNX C;  4DR3 C;  4DR7 C;  4DV7 C;  4LFC C;  2E8C A;  4JI5 C;  1UKK A;  2HHH C;  3J7A D;  2UXD C;  4AQY C;  1HNW C;  2UUC C;  4JI8 C;  4LF7 C;  4DV4 C;  4B3R C;  1N33 C;  4DCU A;  4MTN A;  4LFA C;  1J5E C;  2DYJ A;  4DCS A;  2UUB C;  4LFB C;  2E5L C;  1N2F A;  1LQL A;  4NXM C;  3OTO C;  4X62 C;  4XX2 A;  2CXC A;  3R9X A;  3GKU A;  2HJG A;  1N34 C;  4JYA C;  4LF8 C;  1USP B;  1KKG A;  4LF5 C;  1NYE A;  2ZM6 C;  2E8E A;  4DUY C;  4DR5 C;  2D7V A;  4JI1 C;  1JOS A;  1IBK C;  4MH4 A;  1ZB9 A;  1L2F A;  5BR8 C;  4JV5 C;  4YHH C;  2ONF A;  2VQF C;  4DV0 C;  1HR0 C;  1VLA A;  3JAM D;  4DCT A;  3T1Y C;  1ML8 A;  4X65 C;  3T1H C;  2PT7 G;  2UU9 C;  4JI6 C;  3AF5 A;  3I07 A;  3LUS A;  4NOZ A;  4NXN C;  4DV1 C;  4JI2 C;  2UUA C;  5IWA C;  3IEU A;  1EGA A;  2E7G A;  4YY3 C;  3J81 D;  2OPL A;  3J80 D;  3AF6 A;  4DR2 C;  2ASB A; 
#chains in the Genus database with same CATH topology
 5LMN C;  4FTF A;  4D57 A;  4JI4 C;  2CU6 A;  4D4I A;  4DV6 C;  2WD9 A;  2QL8 A;  1O9T A;  2P2M A;  1V26 A;  3TUF A;  4ISB A;  1QWI A;  5A2Q D;  4KHP C;  2OO4 A;  3K6R A;  4I9G A;  4DR6 C;  2KDN A;  3EER A;  5A1G A;  1BA3 A;  1N32 C;  1IBL C;  5IT9 D;  2P2J A;  2KZ0 A;  1PU1 A;  1ULT A;  5FLX D;  4B3M C;  4DCV A;  1XS3 A;  3DAY A;  3LGX A;  4JI7 C;  5KEI A;  2MM9 A;  5ADZ A;  5E7Q A;  4LF6 C;  4WV3 A;  2UXB C;  2UXC C;  1XNR C;  5LMU C;  4BCA A;  2P2B A;  3C5E A;  4HPV A;  4LFC C;  1XRC A;  4JI5 C;  4AQY C;  1HNW C;  4B3R C;  1MXC A;  4DCU A;  1T5H X;  2D1S A;  4DCS A;  2V7B A;  2UUB C;  4LFB C;  4PUH A;  2Z51 A;  2D28 C;  3LNV A;  3I08 A;  4XX2 A;  2CXC A;  3R9X A;  1MDB A;  3PBK A;  4PUI A;  5A19 A;  4LF8 C;  4LF5 C;  1P7L A;  2ZM6 C;  3GR0 A;  4G37 A;  1JOS A;  2QVZ X;  1PG4 A;  4D56 A;  3ETO A;  2P20 A;  1VLA A;  4DCT A;  4OXI A;  4X65 C;  3VNS A;  4DV1 C;  3TDE A;  1NY8 A;  3A25 A;  1XRA A;  3J81 D;  2AYA A;  1M6X A;  2ASB A;  4PHT A;  2VQE C;  4X66 C;  2VZE A;  3O2E A;  5BUS A;  4RMN A;  4K0K C;  2YWB A;  4RM3 A;  2JNV A;  1WF3 A;  3VNR A;  4FUT A;  2D27 A;  4JI3 C;  5K85 A;  3TQI A;  1IBM C;  3A9V A;  4KTT A;  3RV2 A;  1K0R A;  5CZX A;  4I9F A;  3VNQ A;  4R1M A;  2PN2 A;  3CQ2 A;  4DR1 C;  5BSR A;  4DG9 A;  5T8S A;  3RG2 A;  4FUQ A;  4GKJ C;  3NYR A;  2P02 A;  2OBV A;  3IPL A;  2BH1 X;  2M5O A;  2ZZN A;  4DUZ C;  2DHM A;  5BUQ A;  2E8C A;  3N54 B;  4PRO C;  2UXD C;  4LF7 C;  4DV4 C;  1O90 A;  2YX1 A;  2QW0 X;  4GS5 A;  5BSU A;  2DYJ A;  4KTV A;  4D4G A;  2M5H A;  1N2F A;  1LQL A;  3TR3 A;  5BST A;  3ETC A;  5KYT A;  3UX3 A;  1P4E A;  3LNO A;  2HJG A;  1N34 C;  1KKG A;  4DR5 C;  3NYQ A;  5IFI A;  2D7V A;  1GPM A;  2PG1 E;  3KXW A;  4IZ6 A;  4YHH C;  2D1Q A;  1HR0 C;  3T1Y C;  1ML8 A;  2VSQ A;  3R44 A;  3AF5 A;  1IB8 A;  4NOZ A;  5BSW A;  2NCL A;  2UUA C;  3IEU A;  3A26 A;  4RVN A;  4DR2 C;  3J80 D;  4RM2 A;  3DHV A;  1FUG A;  1N36 C;  1ZB8 A;  4DV5 C;  2CY1 A;  4K0B A;  3G7S A;  3IEV A;  3DLP X;  2DPL A;  1HH2 P;  2XR1 A;  3CQ1 A;  3LAX A;  2E0G A;  3UOW A;  5A1I A;  1XDX A;  4GXR A;  1YJ7 A;  5JRH A;  4DR4 C;  4X64 C;  4BSZ A;  4GKK C;  4PUG A;  3A9U A;  2EGT A;  1M6X C;  1TH5 A;  3SO4 A;  1I94 C;  2JMP A;  1LCI A;  4L7I A;  5K8F A;  3FM7 A;  3GPC A;  3L95 X;  5AE3 A;  4DV3 C;  1PG3 A;  3CJE A;  4B3T C;  3UZ0 A;  4TPS B;  4G1I A;  1AMU A;  1HNX C;  4GXQ A;  4DR7 C;  1O93 A;  3PES A;  1MXA A;  4WS9 A;  4JI8 C;  1N33 C;  4MTN A;  3E7X A;  1J5E C;  5H9U A;  2E5L C;  4NXM C;  5AE1 A;  5BSV A;  2QVX X;  4R1L A;  3OTO C;  2MMA B;  4RVO A;  3E7W A;  4JYA C;  1USP B;  3S82 A;  1NYE A;  1O92 A;  2E8E A;  4JI1 C;  1V60 A;  3CQ3 A;  1IBK C;  1XRB A;  4MH4 A;  5DV9 A;  5AE2 A;  1ZB9 A;  1L2F A;  4L2Z A;  4JV5 C;  4DV0 C;  3FCE A;  3JAM D;  3A4I A;  4ODJ A;  2P2Q A;  2PT7 G;  4JI6 C;  2P2F A;  3I07 A;  1MXB A;  4JI2 C;  1XHJ A;  5BSM A;  5IWA C;  4YY3 C;  3UX2 A;  2OPL A;  3IML A;  4G36 A;  2KZF A;  1PA4 A;  1RG9 A;  4LF9 C;  1P4E C;  5CZV A;  5KYV A;  2OPL B;  5LCI A;  4JI0 C;  2PRO A;  1V25 A;  3R9W A;  1FJG C;  4NDN A;  5T8T A;  2ATW A;  3B7W A;  1QM4 A;  1YGT A;  2MCQ A;  1XNQ C;  2F4V C;  1XMQ C;  2Y27 A;  4ZLP A;  2YCB A;  4BBY A;  4OX9 C;  4DG8 A;  3CW9 A;  1HNZ C;  2BJO A;  4IR7 A;  3AY0 A;  2E8F A;  1MKY A;  3L8C A;  1RY2 A;  4B3S C;  4U5Y D;  3FCC A;  4LE5 A;  1USP A;  4ZJZ A;  4DV2 C;  4RLQ A;  2D1T A;  5GTD A;  4RLF A;  3GR1 A;  3PRO C;  1WH9 A;  2YWC A;  1XMO C;  4LF4 C;  3H2T A;  2ZZM A;  4DR3 C;  2D1R A;  4DV7 C;  4OYC A;  2Y4O A;  1UKK A;  2WP0 C;  2HHH C;  1MDF A;  3J7A D;  4R0M A;  2UUC C;  4PZP A;  4LFA C;  4L4Q A;  4BC9 A;  1T5D X;  1UWD A;  3N2Q A;  5BUR A;  4X62 C;  3GKU A;  3NI2 A;  4BC7 A;  1FLO A;  2Y4N A;  1VEH A;  2QVY X;  3CW8 X;  4DUY C;  1WCJ A;  4EAT A;  5BR8 C;  4JM1 A;  2ONF A;  2VQF C;  2ZTB A;  1MD9 A;  3EQ6 A;  3T1H C;  2UU9 C;  3LUS A;  3UEB A;  3NPD A;  4NXN C;  1EGA A;  2E7G A;  3AF6 A; 
#chains in the Genus database with same CATH homology
 5LMN C;  4FTF A;  4D57 A;  4JI4 C;  4D4I A;  4DV6 C;  2WD9 A;  2QL8 A;  1O9T A;  2P2M A;  1V26 A;  3TUF A;  4ISB A;  1QWI A;  5A2Q D;  4KHP C;  2OO4 A;  4I9G A;  4DR6 C;  3EER A;  5A1G A;  1BA3 A;  1N32 C;  1IBL C;  5IT9 D;  2P2J A;  1ULT A;  4B3M C;  5FLX D;  4DCV A;  3DAY A;  3LGX A;  4JI7 C;  5KEI A;  5ADZ A;  5E7Q A;  4LF6 C;  4WV3 A;  2UXB C;  2UXC C;  1XNR C;  5LMU C;  4BCA A;  2P2B A;  3C5E A;  4HPV A;  4LFC C;  1XRC A;  4JI5 C;  4AQY C;  1HNW C;  4B3R C;  1MXC A;  4DCU A;  1T5H X;  2D1S A;  4DCS A;  2V7B A;  2UUB C;  4LFB C;  2D28 C;  3LNV A;  3I08 A;  4XX2 A;  2CXC A;  3R9X A;  1MDB A;  3PBK A;  5A19 A;  4LF8 C;  4LF5 C;  1P7L A;  2ZM6 C;  3GR0 A;  4G37 A;  1JOS A;  2QVZ X;  1PG4 A;  4D56 A;  3ETO A;  2P20 A;  1VLA A;  4DCT A;  4OXI A;  4X65 C;  3VNS A;  4DV1 C;  3TDE A;  1XRA A;  3J81 D;  2AYA A;  2ASB A;  4PHT A;  2VQE C;  4X66 C;  2VZE A;  5BUS A;  4RMN A;  4K0K C;  2YWB A;  4RM3 A;  1WF3 A;  3VNR A;  4FUT A;  2D27 A;  4JI3 C;  5K85 A;  3TQI A;  1IBM C;  3A9V A;  4KTT A;  3RV2 A;  1K0R A;  5CZX A;  4I9F A;  3VNQ A;  4R1M A;  2PN2 A;  4DR1 C;  5BSR A;  4DG9 A;  5T8S A;  3RG2 A;  4FUQ A;  4GKJ C;  3NYR A;  2P02 A;  2OBV A;  3IPL A;  2BH1 X;  4DUZ C;  5BUQ A;  2E8C A;  3N54 B;  4PRO C;  2UXD C;  4LF7 C;  4DV4 C;  1O90 A;  2QW0 X;  4GS5 A;  5BSU A;  2DYJ A;  4KTV A;  4D4G A;  1N2F A;  1LQL A;  5BST A;  3ETC A;  5KYT A;  2HJG A;  1N34 C;  1KKG A;  4DR5 C;  3NYQ A;  5IFI A;  2D7V A;  1GPM A;  3KXW A;  4IZ6 A;  4YHH C;  2D1Q A;  1HR0 C;  3T1Y C;  1ML8 A;  2VSQ A;  3R44 A;  3AF5 A;  4NOZ A;  5BSW A;  2UUA C;  3IEU A;  4RVN A;  4DR2 C;  3J80 D;  4RM2 A;  3DHV A;  1FUG A;  1N36 C;  1ZB8 A;  4DV5 C;  2CY1 A;  4K0B A;  3G7S A;  3IEV A;  3DLP X;  2DPL A;  1HH2 P;  2XR1 A;  3LAX A;  2E0G A;  3UOW A;  5A1I A;  4GXR A;  1YJ7 A;  5JRH A;  4DR4 C;  4X64 C;  4BSZ A;  4GKK C;  3A9U A;  2EGT A;  3SO4 A;  1I94 C;  2JMP A;  1LCI A;  4L7I A;  5K8F A;  3GPC A;  3L95 X;  5AE3 A;  4DV3 C;  1PG3 A;  3CJE A;  4B3T C;  3UZ0 A;  4TPS B;  4G1I A;  1AMU A;  1HNX C;  4GXQ A;  4DR7 C;  1O93 A;  3PES A;  1MXA A;  4WS9 A;  4JI8 C;  1N33 C;  4MTN A;  3E7X A;  1J5E C;  5H9U A;  2E5L C;  4NXM C;  5AE1 A;  5BSV A;  2QVX X;  4R1L A;  3OTO C;  4RVO A;  3E7W A;  4JYA C;  1USP B;  3S82 A;  1NYE A;  1O92 A;  2E8E A;  4JI1 C;  1IBK C;  1XRB A;  4MH4 A;  5DV9 A;  5AE2 A;  1ZB9 A;  1L2F A;  4L2Z A;  4JV5 C;  4DV0 C;  3FCE A;  3JAM D;  3A4I A;  4ODJ A;  2P2Q A;  2PT7 G;  4JI6 C;  2P2F A;  3I07 A;  1MXB A;  4JI2 C;  5BSM A;  5IWA C;  4YY3 C;  2OPL A;  3IML A;  4G36 A;  2KZF A;  1PA4 A;  1RG9 A;  4LF9 C;  5CZV A;  5KYV A;  2OPL B;  4JI0 C;  2PRO A;  1V25 A;  3R9W A;  1FJG C;  4NDN A;  5T8T A;  2ATW A;  3B7W A;  1QM4 A;  1XNQ C;  2F4V C;  1XMQ C;  2Y27 A;  4ZLP A;  2YCB A;  4BBY A;  4OX9 C;  4DG8 A;  3CW9 A;  1HNZ C;  2BJO A;  4IR7 A;  2E8F A;  1MKY A;  3L8C A;  1RY2 A;  4B3S C;  4U5Y D;  3FCC A;  4LE5 A;  1USP A;  4ZJZ A;  4DV2 C;  4RLQ A;  2D1T A;  5GTD A;  4RLF A;  3GR1 A;  3PRO C;  1WH9 A;  2YWC A;  1XMO C;  4LF4 C;  3H2T A;  4DR3 C;  2D1R A;  4DV7 C;  4OYC A;  2Y4O A;  1UKK A;  2WP0 C;  2HHH C;  1MDF A;  3J7A D;  4R0M A;  2UUC C;  4PZP A;  4LFA C;  4L4Q A;  4BC9 A;  1T5D X;  3N2Q A;  5BUR A;  4X62 C;  3GKU A;  3NI2 A;  4BC7 A;  2Y4N A;  3CW8 X;  2QVY X;  4DUY C;  4EAT A;  5BR8 C;  4JM1 A;  2ONF A;  2VQF C;  1MD9 A;  3EQ6 A;  3T1H C;  2UU9 C;  3LUS A;  3NPD A;  4NXN C;  1EGA A;  2E7G A;  3AF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...