1XNRC

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnrC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnrC02
4OX9C 1MKYA 3IEVA 1USPB 1N36C 2VQEC 4JI5C 1JOSA 4NXMC 5LMNC 4X65C 4B3RC 1PA4A 4DR1C 2E5LC 5IT9D 4DR5C 4DV1C 1ZB8A 3LUSA 2ONFA 2KZFA 3CJEA 4LF7C 4JI3C 1HNWC 1UKKA 4K0KC 3OTOC 2OPLB 1XNQC 5LMUC 1ML8A 4DR3C 3AF6A 4B3TC 3J7AD 4KHPC 2D7VA 1HNXC 1N2FA 4DUZC 2UUAC 4MTNA 1WF3A 1USPA 2ASBA 2DYJA 1ZB9A 4LFAC 1IBLC 4JI8C 4B3SC 3GKUA 4LF4C 4JI0C 4BSZA 1VLAA 3AF5A 4AQYC 4JI2C 2JMPA 4GKJC 4YHHC 1EGAA 2UUCC 4DV0C 5IWAC 4NXNC 1FJGC 1N34C 2HJGA 4X66C 1IBKC 2YCBA 1N32C 2UU9C 2OPLA 4DR6C 4B3MC 4GKKC 4LFBC 2EGTA 1XMQC 1N33C 4JI6C 4LF6C 4JI7C 5FLXD 2E8FA 2PT7G 1XNRC 3T1HC 1LQLA 4JV5C 2F4VC 2UUBC 2E8CA 2CY1A 4DV5C 4LF5C 4LFCC 2E7GA 2BJOA 3EERA 4JI4C 5A2QD 2PN2A 4DCSA 3JAMD 2VQFC 3J81D 3R9WA 1HNZC 2HHHC 4JYAC 1K0RA 4DV6C 3IEUA 5BR8C 4DV3C 1QWIA 4DCVA 4DR7C 2UXBC 2ATWA 4LF8C 3R9XA 1J5EC 2QL8A 4DV7C 4NOZA 1HH2P 2E8EA 4LF9C 4DV4C 4XX2A 4DCTA 3T1YC 4DR4C 1WH9A 4DV2C 4YY3C 1L2FA 1I94C 1NYEA 1XMOC 4X64C 1KKGA 4JI1C 2XR1A 3I07A 2ZM6C 1IBMC 4DR2C 4X62C 4DCUA 4DUYC 3J80D 2UXDC 1HR0C 2UXCC 2CXCA 4MH4A
chains in the Genus database with same CATH superfamily
4OX9C 3IMLA 1USPB 3O2EA 4I9GA 4RM3A 4NXMC 4B3RC 5IT9D 5BSRA 4GXRA 5AE3A 5BUQA 4PUHA 3OTOC 5LMUC 3RG2A 4B3TC 5BUSA 2WP0C 4G1IA 2YX1A 2YWCA 1MDFA 1WCJA 3A25A 4D4IA 2M5OA 5IFIA 3UX2A 1FJGC 5A1IA 4DG8A 3RV2A 4DR6C 1MD9A 5FLXD 2E8FA 1XNRC 1MXCA 2MMAB 3T1HC 2ZZNA 2V7BA 1LQLA 5T8SA 2E8CA 2CY1A 4OXIA 4RLQA 4LFCC 2DHMA 2MM9A 3NYQA 2QVXX 1V25A 4JI4C 1FUGA 4DCSA 3PBKA 3J81D 3L95X 1HNZC 2HHHC 4DV6C 3IEUA 3LNOA 1MXAA 4RM2A 2D27A 2WD9A 3I08A 1MXBA 4LF8C 3R9XA 2P02A 4BCAA 2QL8A 2Y4NA 3E7XA 2P2JA 1P4EA 1HH2P 4RMNA 4DR4C 5BSUA 1L2FA 1I94C 1NYEA 4X64C 2MCQA 5AE2A 3K6RA 5JRHA 4I9FA 5A19A 3CW8X 4BC9A 2UXCC 4MH4A 3IEVA 4G36A 4PHTA 1PA4A 4DR1C 2PROA 2E5LC 1O9TA 2ONFA 1HNWC 1O92A 4D57A 3CQ1A 1ML8A 2D28C 4OYCA 4DR3C 3AF6A 1XHJA 3A26A 4DUZC 2P2BA 2QVZX 3LNVA 3LAXA 5KYVA 3ETCA 3GKUA 4HPVA 4LF4C 4BSZA 3AF5A 4JI2C 4YHHC 4DV0C 2HJGA 2DPLA 2YCBA 3CQ2A 1M6XA 1RY2A 3GR0A 1ULTA 2OO4A 2PT7G 3TDEA 2D1SA 3LGXA 4JV5C 2UUBC 1XDXA 2D1TA 3PESA 3DLPX 2E7GA 3IPLA 1BA3A 1M6XC 3DHVA 4ZJZA 3FCEA 4TPSB 5K8FA 1YGTA 1MDBA 2PN2A 4BC7A 4BBYA 1PU1A 3R9WA 5BR8C 1QWIA 5BSVA 4L4QA 4RVOA 4R1LA 3GPCA 4L7IA 4FUQA 4WV3A 4NOZA 4LF9C 4DV4C 3T1YC 1O93A 4DV2C 3UX3A 4JI1C 2XR1A 1IBMC 4DUYC 1O90A 3J80D 2UXDC 2KZ0A 3A4IA 5GTDA 1AMUA 1N36C 5T8TA 1JOSA 5LMNC 4X65C 4ZLPA 1ZB8A 3LUSA 4JI3C 1UKKA 1XRAA 1GPMA 4GS5A 1XNQC 1P7LA 4LE5A 5BSMA 4KHPC 2D7VA 1N2FA 3NPDA 3AY0A 2DYJA 1XRBA 1ZB9A 4LFAC 5BSTA 4B3SC 2CU6A 4JI0C 3VNSA 4AQYC 4NDNA 3TUFA 1EGAA 1P4EC 2UUCC 4NXNC 3CW9A 3NYRA 1T5DX 5A1GA 1N32C 2Y4OA 2UU9C 2OPLA 4LFBC 1XMQC 1N33C 4JI6C 4LF6C 4D4GA 4JI7C 5CZVA 4IR7A 2OBVA 3KXWA 4KTTA 2Z51A 3A9UA 4JM1A 3FM7A 4DV5C 2P20A 2PG1E 4ISBA 5H9UA 2BJOA 2QVYX 3EERA 3E7WA 2E0GA 5KYTA 5A2QD 2D1QA 3JAMD 1V60A 3ETOA 1K0RA 4R0MA 4DCVA 1RG9A 2UXBC 3L8CA 3CQ3A 2ATWA 3N54B 3VNRA 4K0BA 5BSWA 1J5EC 3H2TA 3TQIA 3FCCA 4DV7C 2ZTBA 2BH1X 5E7QA 2E8EA 4XX2A 1WH9A 4YY3C 1XMOC 4L2ZA 1KKGA 4EATA 5AE1A 1FLOA 4X62C 4DCUA 1HR0C 3B7WA 2CXCA 1VEHA 1PG3A 1MKYA 2M5HA 2VQEC 3GR1A 4JI5C 5BURA 3NI2A 3EQ6A 4DR5C 4DV1C 1QM4A 2KZFA 3CJEA 5LCIA 4LF7C 4K0KC 2P2QA 1TH5A 3G7SA 2OPLB 4IZ6A 3R44A 3J7AD 1HNXC 1PG4A 2UUAC 4MTNA 1WF3A 1USPA 2ASBA 1XRCA 5KEIA 1IBLC 4JI8C 1T5HX 4GXQA 2JNVA 3A9VA 1VLAA 4PZPA 2JMPA 4GKJC 2ZZMA 5K85A 5IWAC 4KTVA 3N2QA 1N34C 3UZ0A 2YWBA 4X66C 1IBKC 3DAYA 4B3MC 4GKKC 2EGTA 4G37A 2QW0X 3TR3A 4RVNA 3UEBA 2F4VC 3C5EA 2KDNA 4LF5C 4FTFA 1LCIA 4RLFA 3PROC 2NCLA 5CZXA 1IB8A 1XS3A 4R1MA 2P2FA 4FUTA 4WS9A 2D1RA 2VQFC 5ADZA 2P2MA 4JYAC 4PUGA 4DV3C 2VZEA 4DR7C 3UOWA 2AYAA 4PROC 3SO4A 5DV9A 4D56A 4DG9A 2Y27A 1V26A 3S82A 4DCTA 1NY8A 4ODJA 4U5YD 4PUIA 1UWDA 3I07A 2ZM6C 4DR2C 3VNQA 2VSQA 1YJ7A
chains in the Genus database with same CATH topology
4OX9C 3IMLA 1USPB 4I9GA 4RM3A 4NXMC 4B3RC 5IT9D 5BSRA 4GXRA 5AE3A 5BUQA 3OTOC 5LMUC 3RG2A 4B3TC 5BUSA 2WP0C 4G1IA 2YWCA 1MDFA 4D4IA 5IFIA 1FJGC 5A1IA 4DG8A 3RV2A 4DR6C 1MD9A 5FLXD 2E8FA 1XNRC 1MXCA 3T1HC 2V7BA 1LQLA 5T8SA 2E8CA 2CY1A 4OXIA 4RLQA 4LFCC 3NYQA 2QVXX 1V25A 4JI4C 1FUGA 4DCSA 3PBKA 3J81D 3L95X 1HNZC 2HHHC 4DV6C 3IEUA 1MXAA 4RM2A 2D27A 2WD9A 3I08A 1MXBA 4LF8C 3R9XA 2P02A 4BCAA 2QL8A 2Y4NA 3E7XA 2P2JA 1HH2P 4RMNA 4DR4C 5BSUA 1L2FA 1I94C 1NYEA 4X64C 5AE2A 5JRHA 4I9FA 5A19A 3CW8X 4BC9A 2UXCC 4MH4A 3IEVA 4G36A 4PHTA 1PA4A 4DR1C 2PROA 2E5LC 1O9TA 2ONFA 1HNWC 1O92A 4D57A 1ML8A 2D28C 4OYCA 4DR3C 3AF6A 4DUZC 2P2BA 2QVZX 3LNVA 3LAXA 5KYVA 3ETCA 3GKUA 4HPVA 4LF4C 4BSZA 3AF5A 4JI2C 4YHHC 4DV0C 2HJGA 2DPLA 2YCBA 1RY2A 3GR0A 1ULTA 2OO4A 2PT7G 3TDEA 2D1SA 3LGXA 4JV5C 2UUBC 2D1TA 3PESA 3DLPX 2E7GA 3IPLA 1BA3A 3DHVA 4ZJZA 3FCEA 4TPSB 5K8FA 1MDBA 2PN2A 4BC7A 4BBYA 3R9WA 5BR8C 1QWIA 5BSVA 4L4QA 4RVOA 4R1LA 3GPCA 4L7IA 4FUQA 4WV3A 4NOZA 4LF9C 4DV4C 3T1YC 1O93A 4DV2C 4JI1C 2XR1A 1IBMC 4DUYC 1O90A 3J80D 2UXDC 3A4IA 5GTDA 1AMUA 1N36C 5T8TA 1JOSA 5LMNC 4X65C 4ZLPA 1ZB8A 3LUSA 4JI3C 1UKKA 1XRAA 1GPMA 4GS5A 1XNQC 1P7LA 4LE5A 5BSMA 4KHPC 2D7VA 1N2FA 3NPDA 2DYJA 1XRBA 1ZB9A 4LFAC 5BSTA 4B3SC 4JI0C 3VNSA 4AQYC 4NDNA 3TUFA 1EGAA 2UUCC 4NXNC 3CW9A 3NYRA 1T5DX 5A1GA 1N32C 2Y4OA 2UU9C 2OPLA 4LFBC 1XMQC 1N33C 4JI6C 4LF6C 4D4GA 4JI7C 5CZVA 4IR7A 2OBVA 3KXWA 4KTTA 3A9UA 4JM1A 4DV5C 2P20A 4ISBA 5H9UA 2BJOA 2QVYX 3EERA 3E7WA 2E0GA 5KYTA 5A2QD 2D1QA 3JAMD 3ETOA 1K0RA 4R0MA 4DCVA 1RG9A 2UXBC 3L8CA 2ATWA 3N54B 3VNRA 4K0BA 5BSWA 1J5EC 3H2TA 3TQIA 3FCCA 4DV7C 2BH1X 5E7QA 2E8EA 4XX2A 1WH9A 4YY3C 1XMOC 4L2ZA 1KKGA 4EATA 5AE1A 4X62C 4DCUA 1HR0C 3B7WA 2CXCA 1PG3A 1MKYA 2VQEC 3GR1A 4JI5C 5BURA 3NI2A 3EQ6A 4DR5C 4DV1C 1QM4A 2KZFA 3CJEA 4LF7C 4K0KC 2P2QA 3G7SA 2OPLB 4IZ6A 3R44A 3J7AD 1HNXC 1PG4A 2UUAC 4MTNA 1WF3A 1USPA 2ASBA 1XRCA 5KEIA 1IBLC 4JI8C 1T5HX 4GXQA 3A9VA 1VLAA 4PZPA 2JMPA 4GKJC 5K85A 5IWAC 4KTVA 3N2QA 1N34C 3UZ0A 2YWBA 4X66C 1IBKC 3DAYA 4B3MC 4GKKC 2EGTA 4G37A 2QW0X 4RVNA 2F4VC 3C5EA 4LF5C 4FTFA 1LCIA 4RLFA 3PROC 5CZXA 4R1MA 2P2FA 4FUTA 4WS9A 2D1RA 2VQFC 5ADZA 2P2MA 4JYAC 4DV3C 2VZEA 4DR7C 3UOWA 2AYAA 4PROC 3SO4A 5DV9A 4D56A 4DG9A 2Y27A 1V26A 3S82A 4DCTA 4ODJA 4U5YD 3I07A 2ZM6C 4DR2C 3VNQA 2VSQA 1YJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 C;  1MKY A;  3IEV A;  1USP B;  1N36 C;  2VQE C;  4JI5 C;  1JOS A;  4NXM C;  5LMN C;  4X65 C;  4B3R C;  1PA4 A;  4DR1 C;  2E5L C;  5IT9 D;  4DR5 C;  4DV1 C;  1ZB8 A;  3LUS A;  2ONF A;  2KZF A;  3CJE A;  4LF7 C;  4JI3 C;  1HNW C;  1UKK A;  4K0K C;  3OTO C;  2OPL B;  1XNQ C;  5LMU C;  1ML8 A;  4DR3 C;  3AF6 A;  4B3T C;  3J7A D;  4KHP C;  2D7V A;  1HNX C;  1N2F A;  4DUZ C;  2UUA C;  4MTN A;  1WF3 A;  1USP A;  2ASB A;  2DYJ A;  1ZB9 A;  4LFA C;  1IBL C;  4JI8 C;  4B3S C;  3GKU A;  4LF4 C;  4JI0 C;  4BSZ A;  1VLA A;  3AF5 A;  4AQY C;  4JI2 C;  2JMP A;  4GKJ C;  4YHH C;  1EGA A;  2UUC C;  4DV0 C;  5IWA C;  4NXN C;  1FJG C;  1N34 C;  2HJG A;  4X66 C;  1IBK C;  2YCB A;  1N32 C;  2UU9 C;  2OPL A;  4DR6 C;  4B3M C;  4GKK C;  4LFB C;  2EGT A;  1XMQ C;  1N33 C;  4JI6 C;  4LF6 C;  4JI7 C;  5FLX D;  2E8F A;  2PT7 G;  1XNR C;  3T1H C;  1LQL A;  4JV5 C;  2F4V C;  2UUB C;  2E8C A;  2CY1 A;  4DV5 C;  4LF5 C;  4LFC C;  2E7G A;  2BJO A;  3EER A;  4JI4 C;  5A2Q D;  2PN2 A;  4DCS A;  3JAM D;  2VQF C;  3J81 D;  3R9W A;  1HNZ C;  2HHH C;  4JYA C;  1K0R A;  4DV6 C;  3IEU A;  5BR8 C;  4DV3 C;  1QWI A;  4DCV A;  4DR7 C;  2UXB C;  2ATW A;  4LF8 C;  3R9X A;  1J5E C;  2QL8 A;  4DV7 C;  4NOZ A;  1HH2 P;  2E8E A;  4LF9 C;  4DV4 C;  4XX2 A;  4DCT A;  3T1Y C;  4DR4 C;  1WH9 A;  4DV2 C;  4YY3 C;  1L2F A;  1I94 C;  1NYE A;  1XMO C;  4X64 C;  1KKG A;  4JI1 C;  2XR1 A;  3I07 A;  2ZM6 C;  1IBM C;  4DR2 C;  4X62 C;  4DCU A;  4DUY C;  3J80 D;  2UXD C;  1HR0 C;  2UXC C;  2CXC A;  4MH4 A; 
#chains in the Genus database with same CATH topology
 4OX9 C;  3IML A;  1USP B;  3O2E A;  4I9G A;  4RM3 A;  4NXM C;  4B3R C;  5IT9 D;  5BSR A;  4GXR A;  5AE3 A;  5BUQ A;  4PUH A;  3OTO C;  5LMU C;  3RG2 A;  4B3T C;  5BUS A;  2WP0 C;  4G1I A;  2YX1 A;  2YWC A;  1MDF A;  1WCJ A;  3A25 A;  4D4I A;  2M5O A;  5IFI A;  3UX2 A;  1FJG C;  5A1I A;  4DG8 A;  3RV2 A;  4DR6 C;  1MD9 A;  5FLX D;  2E8F A;  1XNR C;  1MXC A;  2MMA B;  3T1H C;  2ZZN A;  2V7B A;  1LQL A;  5T8S A;  2E8C A;  2CY1 A;  4OXI A;  4RLQ A;  4LFC C;  2DHM A;  2MM9 A;  3NYQ A;  2QVX X;  1V25 A;  4JI4 C;  1FUG A;  4DCS A;  3PBK A;  3J81 D;  3L95 X;  1HNZ C;  2HHH C;  4DV6 C;  3IEU A;  3LNO A;  1MXA A;  4RM2 A;  2D27 A;  2WD9 A;  3I08 A;  1MXB A;  4LF8 C;  3R9X A;  2P02 A;  4BCA A;  2QL8 A;  2Y4N A;  3E7X A;  2P2J A;  1P4E A;  1HH2 P;  4RMN A;  4DR4 C;  5BSU A;  1L2F A;  1I94 C;  1NYE A;  4X64 C;  2MCQ A;  5AE2 A;  3K6R A;  5JRH A;  4I9F A;  5A19 A;  3CW8 X;  4BC9 A;  2UXC C;  4MH4 A;  3IEV A;  4G36 A;  4PHT A;  1PA4 A;  4DR1 C;  2PRO A;  2E5L C;  1O9T A;  2ONF A;  1HNW C;  1O92 A;  4D57 A;  3CQ1 A;  1ML8 A;  2D28 C;  4OYC A;  4DR3 C;  3AF6 A;  1XHJ A;  3A26 A;  4DUZ C;  2P2B A;  2QVZ X;  3LNV A;  3LAX A;  5KYV A;  3ETC A;  3GKU A;  4HPV A;  4LF4 C;  4BSZ A;  3AF5 A;  4JI2 C;  4YHH C;  4DV0 C;  2HJG A;  2DPL A;  2YCB A;  3CQ2 A;  1M6X A;  1RY2 A;  3GR0 A;  1ULT A;  2OO4 A;  2PT7 G;  3TDE A;  2D1S A;  3LGX A;  4JV5 C;  2UUB C;  1XDX A;  2D1T A;  3PES A;  3DLP X;  2E7G A;  3IPL A;  1BA3 A;  1M6X C;  3DHV A;  4ZJZ A;  3FCE A;  4TPS B;  5K8F A;  1YGT A;  1MDB A;  2PN2 A;  4BC7 A;  4BBY A;  1PU1 A;  3R9W A;  5BR8 C;  1QWI A;  5BSV A;  4L4Q A;  4RVO A;  4R1L A;  3GPC A;  4L7I A;  4FUQ A;  4WV3 A;  4NOZ A;  4LF9 C;  4DV4 C;  3T1Y C;  1O93 A;  4DV2 C;  3UX3 A;  4JI1 C;  2XR1 A;  1IBM C;  4DUY C;  1O90 A;  3J80 D;  2UXD C;  2KZ0 A;  3A4I A;  5GTD A;  1AMU A;  1N36 C;  5T8T A;  1JOS A;  5LMN C;  4X65 C;  4ZLP A;  1ZB8 A;  3LUS A;  4JI3 C;  1UKK A;  1XRA A;  1GPM A;  4GS5 A;  1XNQ C;  1P7L A;  4LE5 A;  5BSM A;  4KHP C;  2D7V A;  1N2F A;  3NPD A;  3AY0 A;  2DYJ A;  1XRB A;  1ZB9 A;  4LFA C;  5BST A;  4B3S C;  2CU6 A;  4JI0 C;  3VNS A;  4AQY C;  4NDN A;  3TUF A;  1EGA A;  1P4E C;  2UUC C;  4NXN C;  3CW9 A;  3NYR A;  1T5D X;  5A1G A;  1N32 C;  2Y4O A;  2UU9 C;  2OPL A;  4LFB C;  1XMQ C;  1N33 C;  4JI6 C;  4LF6 C;  4D4G A;  4JI7 C;  5CZV A;  4IR7 A;  2OBV A;  3KXW A;  4KTT A;  2Z51 A;  3A9U A;  4JM1 A;  3FM7 A;  4DV5 C;  2P20 A;  2PG1 E;  4ISB A;  5H9U A;  2BJO A;  2QVY X;  3EER A;  3E7W A;  2E0G A;  5KYT A;  5A2Q D;  2D1Q A;  3JAM D;  1V60 A;  3ETO A;  1K0R A;  4R0M A;  4DCV A;  1RG9 A;  2UXB C;  3L8C A;  3CQ3 A;  2ATW A;  3N54 B;  3VNR A;  4K0B A;  5BSW A;  1J5E C;  3H2T A;  3TQI A;  3FCC A;  4DV7 C;  2ZTB A;  2BH1 X;  5E7Q A;  2E8E A;  4XX2 A;  1WH9 A;  4YY3 C;  1XMO C;  4L2Z A;  1KKG A;  4EAT A;  5AE1 A;  1FLO A;  4X62 C;  4DCU A;  1HR0 C;  3B7W A;  2CXC A;  1VEH A;  1PG3 A;  1MKY A;  2M5H A;  2VQE C;  3GR1 A;  4JI5 C;  5BUR A;  3NI2 A;  3EQ6 A;  4DR5 C;  4DV1 C;  1QM4 A;  2KZF A;  3CJE A;  5LCI A;  4LF7 C;  4K0K C;  2P2Q A;  1TH5 A;  3G7S A;  2OPL B;  4IZ6 A;  3R44 A;  3J7A D;  1HNX C;  1PG4 A;  2UUA C;  4MTN A;  1WF3 A;  1USP A;  2ASB A;  1XRC A;  5KEI A;  1IBL C;  4JI8 C;  1T5H X;  4GXQ A;  2JNV A;  3A9V A;  1VLA A;  4PZP A;  2JMP A;  4GKJ C;  2ZZM A;  5K85 A;  5IWA C;  4KTV A;  3N2Q A;  1N34 C;  3UZ0 A;  2YWB A;  4X66 C;  1IBK C;  3DAY A;  4B3M C;  4GKK C;  2EGT A;  4G37 A;  2QW0 X;  3TR3 A;  4RVN A;  3UEB A;  2F4V C;  3C5E A;  2KDN A;  4LF5 C;  4FTF A;  1LCI A;  4RLF A;  3PRO C;  2NCL A;  5CZX A;  1IB8 A;  1XS3 A;  4R1M A;  2P2F A;  4FUT A;  4WS9 A;  2D1R A;  2VQF C;  5ADZ A;  2P2M A;  4JYA C;  4PUG A;  4DV3 C;  2VZE A;  4DR7 C;  3UOW A;  2AYA A;  4PRO C;  3SO4 A;  5DV9 A;  4D56 A;  4DG9 A;  2Y27 A;  1V26 A;  3S82 A;  4DCT A;  1NY8 A;  4ODJ A;  4U5Y D;  4PUI A;  1UWD A;  3I07 A;  2ZM6 C;  4DR2 C;  3VNQ A;  2VSQ A;  1YJ7 A; 
#chains in the Genus database with same CATH homology
 4OX9 C;  3IML A;  1USP B;  4I9G A;  4RM3 A;  4NXM C;  4B3R C;  5IT9 D;  5BSR A;  4GXR A;  5AE3 A;  5BUQ A;  3OTO C;  5LMU C;  3RG2 A;  4B3T C;  5BUS A;  2WP0 C;  4G1I A;  2YWC A;  1MDF A;  4D4I A;  5IFI A;  1FJG C;  5A1I A;  4DG8 A;  3RV2 A;  4DR6 C;  1MD9 A;  5FLX D;  2E8F A;  1XNR C;  1MXC A;  3T1H C;  2V7B A;  1LQL A;  5T8S A;  2E8C A;  2CY1 A;  4OXI A;  4RLQ A;  4LFC C;  3NYQ A;  2QVX X;  1V25 A;  4JI4 C;  1FUG A;  4DCS A;  3PBK A;  3J81 D;  3L95 X;  1HNZ C;  2HHH C;  4DV6 C;  3IEU A;  1MXA A;  4RM2 A;  2D27 A;  2WD9 A;  3I08 A;  1MXB A;  4LF8 C;  3R9X A;  2P02 A;  4BCA A;  2QL8 A;  2Y4N A;  3E7X A;  2P2J A;  1HH2 P;  4RMN A;  4DR4 C;  5BSU A;  1L2F A;  1I94 C;  1NYE A;  4X64 C;  5AE2 A;  5JRH A;  4I9F A;  5A19 A;  3CW8 X;  4BC9 A;  2UXC C;  4MH4 A;  3IEV A;  4G36 A;  4PHT A;  1PA4 A;  4DR1 C;  2PRO A;  2E5L C;  1O9T A;  2ONF A;  1HNW C;  1O92 A;  4D57 A;  1ML8 A;  2D28 C;  4OYC A;  4DR3 C;  3AF6 A;  4DUZ C;  2P2B A;  2QVZ X;  3LNV A;  3LAX A;  5KYV A;  3ETC A;  3GKU A;  4HPV A;  4LF4 C;  4BSZ A;  3AF5 A;  4JI2 C;  4YHH C;  4DV0 C;  2HJG A;  2DPL A;  2YCB A;  1RY2 A;  3GR0 A;  1ULT A;  2OO4 A;  2PT7 G;  3TDE A;  2D1S A;  3LGX A;  4JV5 C;  2UUB C;  2D1T A;  3PES A;  3DLP X;  2E7G A;  3IPL A;  1BA3 A;  3DHV A;  4ZJZ A;  3FCE A;  4TPS B;  5K8F A;  1MDB A;  2PN2 A;  4BC7 A;  4BBY A;  3R9W A;  5BR8 C;  1QWI A;  5BSV A;  4L4Q A;  4RVO A;  4R1L A;  3GPC A;  4L7I A;  4FUQ A;  4WV3 A;  4NOZ A;  4LF9 C;  4DV4 C;  3T1Y C;  1O93 A;  4DV2 C;  4JI1 C;  2XR1 A;  1IBM C;  4DUY C;  1O90 A;  3J80 D;  2UXD C;  3A4I A;  5GTD A;  1AMU A;  1N36 C;  5T8T A;  1JOS A;  5LMN C;  4X65 C;  4ZLP A;  1ZB8 A;  3LUS A;  4JI3 C;  1UKK A;  1XRA A;  1GPM A;  4GS5 A;  1XNQ C;  1P7L A;  4LE5 A;  5BSM A;  4KHP C;  2D7V A;  1N2F A;  3NPD A;  2DYJ A;  1XRB A;  1ZB9 A;  4LFA C;  5BST A;  4B3S C;  4JI0 C;  3VNS A;  4AQY C;  4NDN A;  3TUF A;  1EGA A;  2UUC C;  4NXN C;  3CW9 A;  3NYR A;  1T5D X;  5A1G A;  1N32 C;  2Y4O A;  2UU9 C;  2OPL A;  4LFB C;  1XMQ C;  1N33 C;  4JI6 C;  4LF6 C;  4D4G A;  4JI7 C;  5CZV A;  4IR7 A;  2OBV A;  3KXW A;  4KTT A;  3A9U A;  4JM1 A;  4DV5 C;  2P20 A;  4ISB A;  5H9U A;  2BJO A;  2QVY X;  3EER A;  3E7W A;  2E0G A;  5KYT A;  5A2Q D;  2D1Q A;  3JAM D;  3ETO A;  1K0R A;  4R0M A;  4DCV A;  1RG9 A;  2UXB C;  3L8C A;  2ATW A;  3N54 B;  3VNR A;  4K0B A;  5BSW A;  1J5E C;  3H2T A;  3TQI A;  3FCC A;  4DV7 C;  2BH1 X;  5E7Q A;  2E8E A;  4XX2 A;  1WH9 A;  4YY3 C;  1XMO C;  4L2Z A;  1KKG A;  4EAT A;  5AE1 A;  4X62 C;  4DCU A;  1HR0 C;  3B7W A;  2CXC A;  1PG3 A;  1MKY A;  2VQE C;  3GR1 A;  4JI5 C;  5BUR A;  3NI2 A;  3EQ6 A;  4DR5 C;  4DV1 C;  1QM4 A;  2KZF A;  3CJE A;  4LF7 C;  4K0K C;  2P2Q A;  3G7S A;  2OPL B;  4IZ6 A;  3R44 A;  3J7A D;  1HNX C;  1PG4 A;  2UUA C;  4MTN A;  1WF3 A;  1USP A;  2ASB A;  1XRC A;  5KEI A;  1IBL C;  4JI8 C;  1T5H X;  4GXQ A;  3A9V A;  1VLA A;  4PZP A;  2JMP A;  4GKJ C;  5K85 A;  5IWA C;  4KTV A;  3N2Q A;  1N34 C;  3UZ0 A;  2YWB A;  4X66 C;  1IBK C;  3DAY A;  4B3M C;  4GKK C;  2EGT A;  4G37 A;  2QW0 X;  4RVN A;  2F4V C;  3C5E A;  4LF5 C;  4FTF A;  1LCI A;  4RLF A;  3PRO C;  5CZX A;  4R1M A;  2P2F A;  4FUT A;  4WS9 A;  2D1R A;  2VQF C;  5ADZ A;  2P2M A;  4JYA C;  4DV3 C;  2VZE A;  4DR7 C;  3UOW A;  2AYA A;  4PRO C;  3SO4 A;  5DV9 A;  4D56 A;  4DG9 A;  2Y27 A;  1V26 A;  3S82 A;  4DCT A;  4ODJ A;  4U5Y D;  3I07 A;  2ZM6 C;  4DR2 C;  3VNQ A;  2VSQ A;  1YJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...