1XNRC

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnrC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnrC02
2PT7G 4OX9C 4LF4C 2VQFC 3AF6A 4BSZA 4DR3C 4MTNA 5A2QD 1UKKA 5FLXD 5LMNC 1HNXC 1N33C 4DR7C 2DYJA 2JMPA 3J80D 2UUCC 4LFCC 2ASBA 1USPB 1N32C 1LQLA 4DCVA 2KZFA 4JI0C 4DV2C 5IT9D 1J5EC 2UUAC 4K0KC 2HJGA 3JAMD 3EERA 4NOZA 1EGAA 4JI7C 1WF3A 1HNZC 3IEVA 1IBKC 1USPA 3J7AD 2UXBC 4DV3C 1HH2P 4B3MC 2UXCC 4DUYC 1N36C 1HNWC 1WH9A 4DR4C 3AF5A 4JI4C 4LFBC 1ZB8A 4DCSA 1FJGC 1IBLC 4NXMC 1NYEA 4YHHC 4JI8C 4LF6C 4DV6C 4DUZC 1ZB9A 2PN2A 2E8EA 1N2FA 3IEUA 4DCTA 4JI1C 3I07A 3LUSA 2CXCA 4KHPC 1JOSA 1XMQC 2UXDC 2ATWA 4LF7C 1PA4A 3J81D 2HHHC 4JYAC 1HR0C 4B3SC 1XNQC 4XX2A 1XNRC 3R9XA 4JI2C 2CY1A 3GKUA 2UU9C 2OPLB 4LF5C 3CJEA 1QWIA 2BJOA 2EGTA 4DR2C 4JI3C 4X66C 3T1YC 4DR5C 4DR1C 2E8CA 4X65C 4AQYC 2F4VC 4X62C 3T1HC 2D7VA 3R9WA 4GKJC 4LFAC 1MKYA 4DV0C 4GKKC 2E5LC 4NXNC 2ONFA 4DV5C 4B3TC 4X64C 4DCUA 2YCBA 2VQEC 4B3RC 4DV7C 4LF9C 4JI5C 5IWAC 2E8FA 4LF8C 1K0RA 2E7GA 5LMUC 1I94C 1N34C 1IBMC 2UUBC 2QL8A 1VLAA 3OTOC 1XMOC 2XR1A 4DR6C 1L2FA 1KKGA 1ML8A 5BR8C 4JI6C 4JV5C 4DV4C 4MH4A 4DV1C 2ZM6C 2OPLA 4YY3C
chains in the Genus database with same CATH superfamily
4OX9C 4LF4C 5BSVA 1QM4A 4DR3C 4D56A 1UKKA 1MDBA 4DR7C 3AY0A 1O90A 2ASBA 1USPB 1N32C 4IZ6A 4U5YD 4JI0C 4DV2C 5IT9D 2QVZX 3ETCA 2NCLA 4L2ZA 4K0KC 3R44A 3EERA 4NOZA 4JI7C 1IBKC 3DLPX 3PBKA 1XRAA 3J7AD 4DUYC 1N36C 1HNWC 2QW0X 4PUGA 3AF5A 4JI4C 4LFBC 3UX2A 1FJGC 1IBLC 4NXMC 3TUFA 1LCIA 3UX3A 4YHHC 1GPMA 3C5EA 4EATA 1ZB9A 3TR3A 3ETOA 2Y4NA 4JM1A 3UEBA 4KHPC 3N2QA 1YJ7A 3DAYA 1XMQC 3VNRA 3LNVA 2HHHC 4JYAC 1FLOA 4XX2A 2CY1A 5AE1A 1XHJA 1QWIA 4DR2C 3T1YC 4RVNA 2F4VC 2VSQA 3GR0A 5T8TA 2D1TA 1MKYA 3UOWA 2YCBA 4GXQA 2BH1X 3VNQA 5IFIA 4D4IA 4LF8C 3B7WA 1L2FA 4MH4A 1MDFA 2ZM6C 2VQFC 3AF6A 3CQ3A 5CZVA 5ADZA 2PROA 1N33C 2JMPA 2UUCC 3GR1A 3A9VA 3NYQA 1TH5A 1P4EC 4D57A 3G7SA 2KDNA 2MCQA 3JAMD 1WF3A 2M5OA 3A26A 3PROC 1XDXA 3FCCA 1O92A 1WH9A 3O2EA 4DCSA 1ZB8A 4BBYA 2M5HA 4R0MA 1O9TA 4GS5A 3CW8X 3FCEA 3FM7A 4RLFA 5KYVA 4I9GA 2D28C 1N2FA 4DCTA 3I07A 2CXCA 1RG9A 4I9FA 2DHMA 4D4GA 4FUTA 3E7XA 4B3SC 1V26A 5E7QA 3A4IA 3A25A 3GKUA 2UU9C 2OPLB 4LF5C 1FUGA 1MXAA 4OYCA 3CQ2A 1XS3A 2BJOA 2EGTA 2KZ0A 2E8CA 3VNSA 2P2JA 1XRCA 2Z51A 2YWBA 4GKKC 2E5LC 4B3TC 4X64C 4DCUA 2VQEC 3L8CA 4DV7C 4PHTA 4RVOA 5IWAC 2JNVA 1AMUA 2P02A 2E8FA 5LMUC 5T8SA 5A1GA 2QL8A 2MM9A 2XR1A 1V60A 3SO4A 5BSWA 4JV5C 2AYAA 2DPLA 4DV1C 2OPLA 1EGAA 4YY3C 4DG9A 5GTDA 5BSUA 4MTNA 5LMNC 1HNXC 2DYJA 3J80D 4LFCC 1LQLA 5BSMA 4DCVA 2KZFA 2YWCA 1RY2A 5JRHA 1J5EC 3TQIA 2Y27A 2YX1A 2UUAC 2ZTBA 2HJGA 1XRBA 1HNZC 1IB8A 3DHVA 2UXBC 1HH2P 4B3MC 3RG2A 2D1QA 4GXRA 2QVXX 4TPSB 5LCIA 1P7LA 4L4QA 3NPDA 2Y4OA 4JI8C 4LF6C 4DV6C 4ZLPA 1M6XA 1T5DX 4ZJZA 2PN2A 2E8EA 4ODJA 3LNOA 1WCJA 1YGTA 5CZXA 3LUSA 4RLQA 3GPCA 3EQ6A 1JOSA 4WV3A 1MXCA 2ATWA 4LF7C 2QVYX 5AE3A 3LAXA 5A1IA 2P20A 2PG1E 2P2MA 1XNQC 3TDEA 2OBVA 1BA3A 3CQ1A 3KXWA 4PZPA 4WS9A 3PESA 4K0BA 4G36A 2ZZNA 3CW9A 4R1LA 4JI3C 4X66C 2WP0C 4DR1C 4L7IA 4X65C 4DR5C 1PG3A 4X62C 5A19A 2D7VA 3K6RA 2ZZMA 4PROC 4BCAA 3H2TA 2ONFA 4DV5C 4B3RC 3L95X 3IMLA 5KEIA 2E7GA 4IR7A 5K8FA 1N34C 1IBMC 2UUBC 2D1SA 3OTOC 4DR6C 1MXBA 5BR8C 3A9UA 4R1MA 2MMAB 4DV4C 2PT7G 2WD9A 4BSZA 4FUQA 4BC9A 5A2QD 5FLXD 3RV2A 5BUSA 3S82A 5KYTA 2D1RA 4LE5A 5BSRA 4ISBA 1VEHA 5H9UA 1ULTA 2E0GA 5K85A 2P2BA 4RM2A 3IEVA 3IPLA 1USPA 1UWDA 4DV3C 2UXCC 2P2FA 4DR4C 1NY8A 4RMNA 1PU1A 4DG8A 4G1IA 4HPVA 3NI2A 1NYEA 3E7WA 3N54B 4RM3A 5DV9A 4DUZC 3UZ0A 5BUQA 2D27A 1V25A 3IEUA 4KTTA 4JI1C 2V7BA 2P2QA 2UXDC 2VZEA 4PUHA 1PA4A 3J81D 1HR0C 1M6XC 1XNRC 2CU6A 3R9XA 4JI2C 1PG4A 4OXIA 3NYRA 4NDNA 3CJEA 5BSTA 4KTVA 1MD9A 1T5HX 3I08A 4G37A 4AQYC 3T1HC 3R9WA 4GKJC 5BURA 4BC7A 4DV0C 4NXNC 4LF9C 1O93A 4JI5C 4FTFA 3LGXA 5AE2A 1K0RA 1I94C 1VLAA 1XMOC 1P4EA 1KKGA 1ML8A 4PUIA 2OO4A 4JI6C 4LFAC
chains in the Genus database with same CATH topology
4OX9C 4LF4C 5BSVA 1QM4A 4DR3C 4D56A 1UKKA 1MDBA 4DR7C 1O90A 2ASBA 1USPB 1N32C 4IZ6A 4U5YD 4JI0C 4DV2C 5IT9D 2QVZX 3ETCA 4L2ZA 4K0KC 3R44A 3EERA 4NOZA 4JI7C 1IBKC 3DLPX 3PBKA 1XRAA 3J7AD 4DUYC 1N36C 1HNWC 2QW0X 3AF5A 4JI4C 4LFBC 1FJGC 1IBLC 4NXMC 3TUFA 1LCIA 4YHHC 1GPMA 3C5EA 4EATA 1ZB9A 3ETOA 2Y4NA 4JM1A 4KHPC 3N2QA 1YJ7A 3DAYA 1XMQC 3VNRA 3LNVA 2HHHC 4JYAC 4XX2A 2CY1A 5AE1A 1QWIA 4DR2C 3T1YC 4RVNA 2F4VC 2VSQA 3GR0A 5T8TA 2D1TA 1MKYA 3UOWA 2YCBA 4GXQA 2BH1X 3VNQA 5IFIA 4D4IA 4LF8C 3B7WA 1L2FA 4MH4A 1MDFA 2ZM6C 2VQFC 3AF6A 5CZVA 5ADZA 2PROA 1N33C 2JMPA 2UUCC 3GR1A 3A9VA 3NYQA 4D57A 3G7SA 3JAMD 1WF3A 3PROC 3FCCA 1O92A 1WH9A 1ZB8A 4DCSA 4BBYA 4R0MA 1O9TA 4GS5A 3CW8X 3FCEA 4RLFA 5KYVA 4I9GA 2D28C 1N2FA 4DCTA 3I07A 2CXCA 1RG9A 4I9FA 4D4GA 4FUTA 3E7XA 4B3SC 1V26A 5E7QA 3A4IA 3GKUA 2UU9C 2OPLB 4LF5C 1FUGA 1MXAA 4OYCA 2BJOA 2EGTA 2E8CA 3VNSA 2P2JA 1XRCA 2YWBA 4GKKC 2E5LC 4B3TC 4X64C 4DCUA 2VQEC 3L8CA 4DV7C 4PHTA 4RVOA 5IWAC 1AMUA 2P02A 2E8FA 5LMUC 5T8SA 5A1GA 2QL8A 2XR1A 3SO4A 5BSWA 4JV5C 2AYAA 2DPLA 4DV1C 2OPLA 4YY3C 1EGAA 4DG9A 5GTDA 5BSUA 4MTNA 5LMNC 1HNXC 2DYJA 3J80D 4LFCC 1LQLA 5BSMA 4DCVA 2KZFA 2YWCA 1RY2A 5JRHA 1J5EC 3TQIA 2Y27A 2UUAC 2HJGA 1XRBA 1HNZC 3DHVA 2UXBC 1HH2P 4B3MC 3RG2A 2D1QA 4GXRA 2QVXX 4TPSB 1P7LA 4L4QA 3NPDA 2Y4OA 4JI8C 4LF6C 4DV6C 4ZLPA 1T5DX 4ZJZA 2PN2A 2E8EA 4ODJA 5CZXA 3LUSA 4RLQA 3GPCA 3EQ6A 1JOSA 4WV3A 1MXCA 2ATWA 4LF7C 2QVYX 5AE3A 3LAXA 5A1IA 2P20A 2P2MA 1XNQC 3TDEA 2OBVA 1BA3A 3KXWA 4PZPA 4WS9A 3PESA 4K0BA 4G36A 3CW9A 4R1LA 4JI3C 4X66C 2WP0C 4DR1C 4L7IA 4X65C 4DR5C 1PG3A 4X62C 5A19A 2D7VA 4PROC 4BCAA 3H2TA 2ONFA 4DV5C 4B3RC 3L95X 3IMLA 5KEIA 2E7GA 4IR7A 5K8FA 1N34C 1IBMC 2UUBC 2D1SA 3OTOC 4DR6C 1MXBA 5BR8C 3A9UA 4R1MA 4DV4C 2PT7G 2WD9A 4BSZA 4FUQA 4BC9A 5A2QD 5FLXD 3RV2A 5BUSA 3S82A 5KYTA 2D1RA 4LE5A 5BSRA 4ISBA 5H9UA 1ULTA 2E0GA 5K85A 2P2BA 4RM2A 3IEVA 3IPLA 1USPA 4DV3C 2UXCC 2P2FA 4DR4C 4RMNA 4DG8A 4G1IA 4HPVA 3NI2A 1NYEA 3E7WA 3N54B 4RM3A 5DV9A 4DUZC 3UZ0A 5BUQA 2D27A 1V25A 3IEUA 4KTTA 4JI1C 2V7BA 2P2QA 2UXDC 2VZEA 1PA4A 3J81D 1HR0C 1XNRC 3R9XA 4JI2C 1PG4A 4OXIA 3NYRA 4NDNA 3CJEA 5BSTA 4KTVA 1MD9A 1T5HX 3I08A 4G37A 4AQYC 3T1HC 3R9WA 4GKJC 5BURA 4BC7A 4DV0C 4NXNC 4LF9C 1O93A 4JI5C 4FTFA 3LGXA 5AE2A 1K0RA 1I94C 1VLAA 1XMOC 1KKGA 1ML8A 2OO4A 4JI6C 4LFAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PT7 G;  4OX9 C;  4LF4 C;  2VQF C;  3AF6 A;  4BSZ A;  4DR3 C;  4MTN A;  5A2Q D;  1UKK A;  5FLX D;  5LMN C;  1HNX C;  1N33 C;  4DR7 C;  2DYJ A;  2JMP A;  3J80 D;  2UUC C;  4LFC C;  2ASB A;  1USP B;  1N32 C;  1LQL A;  4DCV A;  2KZF A;  4JI0 C;  4DV2 C;  5IT9 D;  1J5E C;  2UUA C;  4K0K C;  2HJG A;  3JAM D;  3EER A;  4NOZ A;  1EGA A;  4JI7 C;  1WF3 A;  1HNZ C;  3IEV A;  1IBK C;  1USP A;  3J7A D;  2UXB C;  4DV3 C;  1HH2 P;  4B3M C;  2UXC C;  4DUY C;  1N36 C;  1HNW C;  1WH9 A;  4DR4 C;  3AF5 A;  4JI4 C;  4LFB C;  1ZB8 A;  4DCS A;  1FJG C;  1IBL C;  4NXM C;  1NYE A;  4YHH C;  4JI8 C;  4LF6 C;  4DV6 C;  4DUZ C;  1ZB9 A;  2PN2 A;  2E8E A;  1N2F A;  3IEU A;  4DCT A;  4JI1 C;  3I07 A;  3LUS A;  2CXC A;  4KHP C;  1JOS A;  1XMQ C;  2UXD C;  2ATW A;  4LF7 C;  1PA4 A;  3J81 D;  2HHH C;  4JYA C;  1HR0 C;  4B3S C;  1XNQ C;  4XX2 A;  1XNR C;  3R9X A;  4JI2 C;  2CY1 A;  3GKU A;  2UU9 C;  2OPL B;  4LF5 C;  3CJE A;  1QWI A;  2BJO A;  2EGT A;  4DR2 C;  4JI3 C;  4X66 C;  3T1Y C;  4DR5 C;  4DR1 C;  2E8C A;  4X65 C;  4AQY C;  2F4V C;  4X62 C;  3T1H C;  2D7V A;  3R9W A;  4GKJ C;  4LFA C;  1MKY A;  4DV0 C;  4GKK C;  2E5L C;  4NXN C;  2ONF A;  4DV5 C;  4B3T C;  4X64 C;  4DCU A;  2YCB A;  2VQE C;  4B3R C;  4DV7 C;  4LF9 C;  4JI5 C;  5IWA C;  2E8F A;  4LF8 C;  1K0R A;  2E7G A;  5LMU C;  1I94 C;  1N34 C;  1IBM C;  2UUB C;  2QL8 A;  1VLA A;  3OTO C;  1XMO C;  2XR1 A;  4DR6 C;  1L2F A;  1KKG A;  1ML8 A;  5BR8 C;  4JI6 C;  4JV5 C;  4DV4 C;  4MH4 A;  4DV1 C;  2ZM6 C;  2OPL A;  4YY3 C; 
#chains in the Genus database with same CATH topology
 4OX9 C;  4LF4 C;  5BSV A;  1QM4 A;  4DR3 C;  4D56 A;  1UKK A;  1MDB A;  4DR7 C;  3AY0 A;  1O90 A;  2ASB A;  1USP B;  1N32 C;  4IZ6 A;  4U5Y D;  4JI0 C;  4DV2 C;  5IT9 D;  2QVZ X;  3ETC A;  2NCL A;  4L2Z A;  4K0K C;  3R44 A;  3EER A;  4NOZ A;  4JI7 C;  1IBK C;  3DLP X;  3PBK A;  1XRA A;  3J7A D;  4DUY C;  1N36 C;  1HNW C;  2QW0 X;  4PUG A;  3AF5 A;  4JI4 C;  4LFB C;  3UX2 A;  1FJG C;  1IBL C;  4NXM C;  3TUF A;  1LCI A;  3UX3 A;  4YHH C;  1GPM A;  3C5E A;  4EAT A;  1ZB9 A;  3TR3 A;  3ETO A;  2Y4N A;  4JM1 A;  3UEB A;  4KHP C;  3N2Q A;  1YJ7 A;  3DAY A;  1XMQ C;  3VNR A;  3LNV A;  2HHH C;  4JYA C;  1FLO A;  4XX2 A;  2CY1 A;  5AE1 A;  1XHJ A;  1QWI A;  4DR2 C;  3T1Y C;  4RVN A;  2F4V C;  2VSQ A;  3GR0 A;  5T8T A;  2D1T A;  1MKY A;  3UOW A;  2YCB A;  4GXQ A;  2BH1 X;  3VNQ A;  5IFI A;  4D4I A;  4LF8 C;  3B7W A;  1L2F A;  4MH4 A;  1MDF A;  2ZM6 C;  2VQF C;  3AF6 A;  3CQ3 A;  5CZV A;  5ADZ A;  2PRO A;  1N33 C;  2JMP A;  2UUC C;  3GR1 A;  3A9V A;  3NYQ A;  1TH5 A;  1P4E C;  4D57 A;  3G7S A;  2KDN A;  2MCQ A;  3JAM D;  1WF3 A;  2M5O A;  3A26 A;  3PRO C;  1XDX A;  3FCC A;  1O92 A;  1WH9 A;  3O2E A;  4DCS A;  1ZB8 A;  4BBY A;  2M5H A;  4R0M A;  1O9T A;  4GS5 A;  3CW8 X;  3FCE A;  3FM7 A;  4RLF A;  5KYV A;  4I9G A;  2D28 C;  1N2F A;  4DCT A;  3I07 A;  2CXC A;  1RG9 A;  4I9F A;  2DHM A;  4D4G A;  4FUT A;  3E7X A;  4B3S C;  1V26 A;  5E7Q A;  3A4I A;  3A25 A;  3GKU A;  2UU9 C;  2OPL B;  4LF5 C;  1FUG A;  1MXA A;  4OYC A;  3CQ2 A;  1XS3 A;  2BJO A;  2EGT A;  2KZ0 A;  2E8C A;  3VNS A;  2P2J A;  1XRC A;  2Z51 A;  2YWB A;  4GKK C;  2E5L C;  4B3T C;  4X64 C;  4DCU A;  2VQE C;  3L8C A;  4DV7 C;  4PHT A;  4RVO A;  5IWA C;  2JNV A;  1AMU A;  2P02 A;  2E8F A;  5LMU C;  5T8S A;  5A1G A;  2QL8 A;  2MM9 A;  2XR1 A;  1V60 A;  3SO4 A;  5BSW A;  4JV5 C;  2AYA A;  2DPL A;  4DV1 C;  2OPL A;  1EGA A;  4YY3 C;  4DG9 A;  5GTD A;  5BSU A;  4MTN A;  5LMN C;  1HNX C;  2DYJ A;  3J80 D;  4LFC C;  1LQL A;  5BSM A;  4DCV A;  2KZF A;  2YWC A;  1RY2 A;  5JRH A;  1J5E C;  3TQI A;  2Y27 A;  2YX1 A;  2UUA C;  2ZTB A;  2HJG A;  1XRB A;  1HNZ C;  1IB8 A;  3DHV A;  2UXB C;  1HH2 P;  4B3M C;  3RG2 A;  2D1Q A;  4GXR A;  2QVX X;  4TPS B;  5LCI A;  1P7L A;  4L4Q A;  3NPD A;  2Y4O A;  4JI8 C;  4LF6 C;  4DV6 C;  4ZLP A;  1M6X A;  1T5D X;  4ZJZ A;  2PN2 A;  2E8E A;  4ODJ A;  3LNO A;  1WCJ A;  1YGT A;  5CZX A;  3LUS A;  4RLQ A;  3GPC A;  3EQ6 A;  1JOS A;  4WV3 A;  1MXC A;  2ATW A;  4LF7 C;  2QVY X;  5AE3 A;  3LAX A;  5A1I A;  2P20 A;  2PG1 E;  2P2M A;  1XNQ C;  3TDE A;  2OBV A;  1BA3 A;  3CQ1 A;  3KXW A;  4PZP A;  4WS9 A;  3PES A;  4K0B A;  4G36 A;  2ZZN A;  3CW9 A;  4R1L A;  4JI3 C;  4X66 C;  2WP0 C;  4DR1 C;  4L7I A;  4X65 C;  4DR5 C;  1PG3 A;  4X62 C;  5A19 A;  2D7V A;  3K6R A;  2ZZM A;  4PRO C;  4BCA A;  3H2T A;  2ONF A;  4DV5 C;  4B3R C;  3L95 X;  3IML A;  5KEI A;  2E7G A;  4IR7 A;  5K8F A;  1N34 C;  1IBM C;  2UUB C;  2D1S A;  3OTO C;  4DR6 C;  1MXB A;  5BR8 C;  3A9U A;  4R1M A;  2MMA B;  4DV4 C;  2PT7 G;  2WD9 A;  4BSZ A;  4FUQ A;  4BC9 A;  5A2Q D;  5FLX D;  3RV2 A;  5BUS A;  3S82 A;  5KYT A;  2D1R A;  4LE5 A;  5BSR A;  4ISB A;  1VEH A;  5H9U A;  1ULT A;  2E0G A;  5K85 A;  2P2B A;  4RM2 A;  3IEV A;  3IPL A;  1USP A;  1UWD A;  4DV3 C;  2UXC C;  2P2F A;  4DR4 C;  1NY8 A;  4RMN A;  1PU1 A;  4DG8 A;  4G1I A;  4HPV A;  3NI2 A;  1NYE A;  3E7W A;  3N54 B;  4RM3 A;  5DV9 A;  4DUZ C;  3UZ0 A;  5BUQ A;  2D27 A;  1V25 A;  3IEU A;  4KTT A;  4JI1 C;  2V7B A;  2P2Q A;  2UXD C;  2VZE A;  4PUH A;  1PA4 A;  3J81 D;  1HR0 C;  1M6X C;  1XNR C;  2CU6 A;  3R9X A;  4JI2 C;  1PG4 A;  4OXI A;  3NYR A;  4NDN A;  3CJE A;  5BST A;  4KTV A;  1MD9 A;  1T5H X;  3I08 A;  4G37 A;  4AQY C;  3T1H C;  3R9W A;  4GKJ C;  5BUR A;  4BC7 A;  4DV0 C;  4NXN C;  4LF9 C;  1O93 A;  4JI5 C;  4FTF A;  3LGX A;  5AE2 A;  1K0R A;  1I94 C;  1VLA A;  1XMO C;  1P4E A;  1KKG A;  1ML8 A;  4PUI A;  2OO4 A;  4JI6 C;  4LFA C; 
#chains in the Genus database with same CATH homology
 4OX9 C;  4LF4 C;  5BSV A;  1QM4 A;  4DR3 C;  4D56 A;  1UKK A;  1MDB A;  4DR7 C;  1O90 A;  2ASB A;  1USP B;  1N32 C;  4IZ6 A;  4U5Y D;  4JI0 C;  4DV2 C;  5IT9 D;  2QVZ X;  3ETC A;  4L2Z A;  4K0K C;  3R44 A;  3EER A;  4NOZ A;  4JI7 C;  1IBK C;  3DLP X;  3PBK A;  1XRA A;  3J7A D;  4DUY C;  1N36 C;  1HNW C;  2QW0 X;  3AF5 A;  4JI4 C;  4LFB C;  1FJG C;  1IBL C;  4NXM C;  3TUF A;  1LCI A;  4YHH C;  1GPM A;  3C5E A;  4EAT A;  1ZB9 A;  3ETO A;  2Y4N A;  4JM1 A;  4KHP C;  3N2Q A;  1YJ7 A;  3DAY A;  1XMQ C;  3VNR A;  3LNV A;  2HHH C;  4JYA C;  4XX2 A;  2CY1 A;  5AE1 A;  1QWI A;  4DR2 C;  3T1Y C;  4RVN A;  2F4V C;  2VSQ A;  3GR0 A;  5T8T A;  2D1T A;  1MKY A;  3UOW A;  2YCB A;  4GXQ A;  2BH1 X;  3VNQ A;  5IFI A;  4D4I A;  4LF8 C;  3B7W A;  1L2F A;  4MH4 A;  1MDF A;  2ZM6 C;  2VQF C;  3AF6 A;  5CZV A;  5ADZ A;  2PRO A;  1N33 C;  2JMP A;  2UUC C;  3GR1 A;  3A9V A;  3NYQ A;  4D57 A;  3G7S A;  3JAM D;  1WF3 A;  3PRO C;  3FCC A;  1O92 A;  1WH9 A;  1ZB8 A;  4DCS A;  4BBY A;  4R0M A;  1O9T A;  4GS5 A;  3CW8 X;  3FCE A;  4RLF A;  5KYV A;  4I9G A;  2D28 C;  1N2F A;  4DCT A;  3I07 A;  2CXC A;  1RG9 A;  4I9F A;  4D4G A;  4FUT A;  3E7X A;  4B3S C;  1V26 A;  5E7Q A;  3A4I A;  3GKU A;  2UU9 C;  2OPL B;  4LF5 C;  1FUG A;  1MXA A;  4OYC A;  2BJO A;  2EGT A;  2E8C A;  3VNS A;  2P2J A;  1XRC A;  2YWB A;  4GKK C;  2E5L C;  4B3T C;  4X64 C;  4DCU A;  2VQE C;  3L8C A;  4DV7 C;  4PHT A;  4RVO A;  5IWA C;  1AMU A;  2P02 A;  2E8F A;  5LMU C;  5T8S A;  5A1G A;  2QL8 A;  2XR1 A;  3SO4 A;  5BSW A;  4JV5 C;  2AYA A;  2DPL A;  4DV1 C;  2OPL A;  4YY3 C;  1EGA A;  4DG9 A;  5GTD A;  5BSU A;  4MTN A;  5LMN C;  1HNX C;  2DYJ A;  3J80 D;  4LFC C;  1LQL A;  5BSM A;  4DCV A;  2KZF A;  2YWC A;  1RY2 A;  5JRH A;  1J5E C;  3TQI A;  2Y27 A;  2UUA C;  2HJG A;  1XRB A;  1HNZ C;  3DHV A;  2UXB C;  1HH2 P;  4B3M C;  3RG2 A;  2D1Q A;  4GXR A;  2QVX X;  4TPS B;  1P7L A;  4L4Q A;  3NPD A;  2Y4O A;  4JI8 C;  4LF6 C;  4DV6 C;  4ZLP A;  1T5D X;  4ZJZ A;  2PN2 A;  2E8E A;  4ODJ A;  5CZX A;  3LUS A;  4RLQ A;  3GPC A;  3EQ6 A;  1JOS A;  4WV3 A;  1MXC A;  2ATW A;  4LF7 C;  2QVY X;  5AE3 A;  3LAX A;  5A1I A;  2P20 A;  2P2M A;  1XNQ C;  3TDE A;  2OBV A;  1BA3 A;  3KXW A;  4PZP A;  4WS9 A;  3PES A;  4K0B A;  4G36 A;  3CW9 A;  4R1L A;  4JI3 C;  4X66 C;  2WP0 C;  4DR1 C;  4L7I A;  4X65 C;  4DR5 C;  1PG3 A;  4X62 C;  5A19 A;  2D7V A;  4PRO C;  4BCA A;  3H2T A;  2ONF A;  4DV5 C;  4B3R C;  3L95 X;  3IML A;  5KEI A;  2E7G A;  4IR7 A;  5K8F A;  1N34 C;  1IBM C;  2UUB C;  2D1S A;  3OTO C;  4DR6 C;  1MXB A;  5BR8 C;  3A9U A;  4R1M A;  4DV4 C;  2PT7 G;  2WD9 A;  4BSZ A;  4FUQ A;  4BC9 A;  5A2Q D;  5FLX D;  3RV2 A;  5BUS A;  3S82 A;  5KYT A;  2D1R A;  4LE5 A;  5BSR A;  4ISB A;  5H9U A;  1ULT A;  2E0G A;  5K85 A;  2P2B A;  4RM2 A;  3IEV A;  3IPL A;  1USP A;  4DV3 C;  2UXC C;  2P2F A;  4DR4 C;  4RMN A;  4DG8 A;  4G1I A;  4HPV A;  3NI2 A;  1NYE A;  3E7W A;  3N54 B;  4RM3 A;  5DV9 A;  4DUZ C;  3UZ0 A;  5BUQ A;  2D27 A;  1V25 A;  3IEU A;  4KTT A;  4JI1 C;  2V7B A;  2P2Q A;  2UXD C;  2VZE A;  1PA4 A;  3J81 D;  1HR0 C;  1XNR C;  3R9X A;  4JI2 C;  1PG4 A;  4OXI A;  3NYR A;  4NDN A;  3CJE A;  5BST A;  4KTV A;  1MD9 A;  1T5H X;  3I08 A;  4G37 A;  4AQY C;  3T1H C;  3R9W A;  4GKJ C;  5BUR A;  4BC7 A;  4DV0 C;  4NXN C;  4LF9 C;  1O93 A;  4JI5 C;  4FTF A;  3LGX A;  5AE2 A;  1K0R A;  1I94 C;  1VLA A;  1XMO C;  1KKG A;  1ML8 A;  2OO4 A;  4JI6 C;  4LFA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...