1XNRC

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 41
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xnrC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1xnrC02
2JMPA 4X64C 1K0RA 1N33C 3AF6A 4LF8C 2CY1A 2E8FA 1EGAA 1NYEA 1IBKC 4LF7C 2UUAC 1ZB9A 1FJGC 4B3MC 3T1YC 1QWIA 4X65C 1J5EC 5A2QD 3I07A 4DR2C 3J80D 4DUYC 4DR3C 1KKGA 4K0KC 2ASBA 1IBMC 4X66C 1MKYA 1UKKA 2ONFA 4DV6C 4NXNC 5LMUC 4LF5C 1HH2P 2DYJA 4DV2C 4JV5C 3R9WA 4GKJC 3GKUA 4BSZA 2OPLB 4JI6C 1WF3A 4YY3C 4JI4C 4LF4C 3T1HC 4JI1C 1N36C 1JOSA 3IEVA 4DR7C 2E8CA 4DV0C 2UUCC 2QL8A 4DR1C 2E5LC 1N32C 2UXDC 1N2FA 1L2FA 1VLAA 4NOZA 2F4VC 2UUBC 4GKKC 5FLXD 2BJOA 2CXCA 5LMNC 1IBLC 1HR0C 4LFAC 4DR4C 3R9XA 4YHHC 3IEUA 3J81D 2VQFC 2OPLA 2D7VA 1HNZC 4JI7C 4LFBC 3AF5A 4DV3C 2XR1A 4LF9C 4B3RC 4JYAC 2EGTA 3CJEA 1XNRC 4DCSA 2ATWA 4B3TC 4JI3C 5IWAC 4DCUA 4DR6C 1PA4A 4X62C 4DV7C 1N34C 1XNQC 2KZFA 1XMQC 4DUZC 1XMOC 2ZM6C 4JI8C 4DR5C 4DCTA 4DCVA 1USPB 4LFCC 1HNXC 1ZB8A 1ML8A 4NXMC 4B3SC 4JI5C 4OX9C 1USPA 3OTOC 2E8EA 1LQLA 5BR8C 1HNWC 4KHPC 1I94C 3JAMD 3LUSA 4DV4C 3EERA 4JI0C 2UXCC 4LF6C 2YCBA 2VQEC 2PT7G 2PN2A 1WH9A 2HJGA 4AQYC 4DV5C 4JI2C 4MH4A 2E7GA 4XX2A 2UXBC 5IT9D 3J7AD 2UU9C 4MTNA 4DV1C 2HHHC
chains in the Genus database with same CATH superfamily
4PUHA 3E7WA 1K0RA 4JM1A 2MM9A 4NDNA 5BURA 5BSMA 5BSRA 4PUGA 2DHMA 2P20A 2Y27A 1XDXA 3UX3A 2WD9A 1XRBA 3T1YC 4R0MA 3R44A 1QWIA 1TH5A 1O9TA 3J80D 2V7BA 4DUYC 3LAXA 3N2QA 1XRAA 3PBKA 4EATA 2M5OA 1MKYA 2AYAA 3UZ0A 4JV5C 3N54B 1PU1A 3GKUA 2OPLB 1WF3A 3VNQA 4YY3C 4U5YD 2D28C 2Y4NA 3AY0A 5A1GA 3K6RA 3EQ6A 1N36C 1JOSA 2E8CA 4ODJA 2UUCC 2UXDC 2E5LC 4FUTA 4TPSB 2CXCA 3KXWA 5JRHA 1MXCA 1HR0C 4LFAC 4DR4C 3R9XA 2VQFC 3UX2A 4JI7C 1T5HX 4B3RC 1VEHA 4BCAA 3S82A 3NPDA 4DCUA 2KZ0A 2KZFA 3NYRA 2P02A 4IR7A 5BSWA 2YWCA 2Z51A 1USPB 2MMAB 3DLPX 4JI5C 3VNRA 4I9GA 5ADZA 2P2QA 3FM7A 2E8EA 1MXAA 5BR8C 4D56A 4KHPC 1I94C 3LUSA 3TR3A 1M6XA 1FUGA 5CZXA 4R1LA 2VQEC 1V25A 2E0GA 4KTVA 2E7GA 4PZPA 3G7SA 4MTNA 5AE3A 4X64C 4DG8A 3AF6A 2E8FA 5H9UA 1WCJA 1NYEA 3CW8X 4DG9A 3L8CA 1IBKC 3DAYA 1MDBA 1FJGC 2WP0C 3A26A 1XHJA 4GXRA 4X65C 3B7WA 1J5EC 3TQIA 4GS5A 5K8FA 3TUFA 4BBYA 1MXBA 4WV3A 4K0KC 1IBMC 1UKKA 3O2EA 2ONFA 4DV6C 5LMUC 1HH2P 1V26A 1YJ7A 3R9WA 5KYVA 3CQ3A 2ZTBA 5T8SA 3IEVA 3DHVA 4DR7C 4DV0C 1N32C 2QL8A 4DR1C 3LNVA 1L2FA 5T8TA 1VLAA 1P4EC 4NOZA 1BA3A 1NY8A 2UUBC 5AE1A 1V60A 4OYCA 1RG9A 4YHHC 3IEUA 3J81D 3IMLA 2OPLA 4L2ZA 4LFBC 3A9VA 4DV3C 2EGTA 3CJEA 1XNRC 4DCSA 4R1MA 4JI3C 4X62C 2MCQA 4DV7C 1N34C 1XNQC 3GR0A 4RMNA 4RVOA 4DCVA 2NCLA 2D1SA 4NXMC 3L95X 5LCIA 2OBVA 4D57A 3OTOC 5KYTA 4DV4C 4RLQA 2KDNA 2UXCC 4LF6C 1WH9A 4XX2A 2UXBC 1O92A 5IT9D 2PG1E 2UU9C 5BSTA 2P2JA 2CY1A 1EGAA 3RG2A 2UUAC 1ZB9A 3I08A 4B3MC 5KEIA 3IPLA 4L7IA 3UOWA 5IFIA 3I07A 4HPVA 4PROC 2YX1A 1RY2A 5DV9A 4DR3C 5GTDA 5BUSA 2P2FA 5A1IA 4LF5C 2CU6A 1O93A 2QVYX 3CQ1A 3SO4A 4FTFA 5K85A 4D4IA 2VSQA 3GPCA 3FCCA 1PG4A 4G37A 4I9FA 4GKKC 3A25A 1IBLC 5CZVA 1XS3A 1HNZC 2BH1X 3A9UA 2P2MA 4RVNA 4JYAC 3GR1A 3PROC 2ATWA 2QVZX 1UWDA 5IWAC 4IZ6A 1MDFA 2YWBA 1XMOC 2D1TA 4DR5C 2QW0X 3CQ2A 4DCTA 4LFCC 4BC9A 1ML8A 4B3SC 2OO4A 4OX9C 2DPLA 1XRCA 1O90A 3A4IA 4K0BA 4GXQA 1HNWC 1M6XC 5BSUA 3JAMD 3EERA 4OXIA 2YCBA 2PT7G 2PN2A 4D4GA 2HJGA 4AQYC 4RM3A 2PROA 4ZJZA 3J7AD 1MD9A 4DV1C 1LCIA 2JMPA 1P4EA 3PESA 4G1IA 4ZLPA 1N33C 3RV2A 4LF8C 2D1RA 1AMUA 3TDEA 3CW9A 4LF7C 1PG3A 3LGXA 5E7QA 4FUQA 3ETOA 1T5DX 2VZEA 5A2QD 2JNVA 3ETCA 4DR2C 2M5HA 4G36A 3FCEA 1KKGA 2ASBA 4X66C 4L4QA 4ISBA 4NXNC 2P2BA 2DYJA 4LE5A 4DV2C 4GKJC 2ZZMA 4BSZA 4JI6C 4JI4C 4RLFA 4LF4C 3T1HC 4KTTA 4JI1C 2D27A 1N2FA 2F4VC 5BUQA 5FLXD 5LMNC 2BJOA 4PUIA 1IB8A 1GPMA 2D1QA 1FLOA 2D7VA 1ULTA 5A19A 3AF5A 4LF9C 2XR1A 4B3TC 5BSVA 4DR6C 1PA4A 4RM2A 1XMQC 1P7LA 4DUZC 2ZM6C 4JI8C 3NYQA 4PHTA 3E7XA 4WS9A 1HNXC 1ZB8A 3C5EA 2Y4OA 3NI2A 3UEBA 3VNSA 2QVXX 3H2TA 1USPA 1YGTA 1LQLA 1QM4A 2ZZNA 5AE2A 4JI0C 4BC7A 4DV5C 4JI2C 4MH4A 3LNOA 2HHHC
chains in the Genus database with same CATH topology
3E7WA 1K0RA 4JM1A 5BURA 4NDNA 5BSMA 5BSRA 2P20A 2Y27A 2WD9A 1XRBA 3T1YC 4R0MA 3R44A 1QWIA 1O9TA 3J80D 2V7BA 4DUYC 3LAXA 3N2QA 1XRAA 3PBKA 4EATA 1MKYA 2AYAA 3UZ0A 4JV5C 3N54B 3GKUA 2OPLB 1WF3A 3VNQA 4YY3C 4U5YD 2D28C 2Y4NA 5A1GA 3EQ6A 1N36C 1JOSA 2E8CA 4ODJA 2UUCC 2UXDC 2E5LC 4FUTA 4TPSB 2CXCA 3KXWA 5JRHA 1MXCA 1HR0C 4LFAC 4DR4C 3R9XA 2VQFC 4JI7C 1T5HX 4B3RC 4BCAA 3S82A 3NPDA 4DCUA 2KZFA 3NYRA 2P02A 4IR7A 5BSWA 2YWCA 1USPB 3DLPX 4JI5C 3VNRA 4I9GA 5ADZA 2P2QA 2E8EA 1MXAA 5BR8C 4D56A 4KHPC 1I94C 3LUSA 1FUGA 5CZXA 4R1LA 2VQEC 1V25A 2E0GA 4KTVA 2E7GA 4PZPA 3G7SA 4MTNA 5AE3A 4X64C 4DG8A 3AF6A 2E8FA 5H9UA 1NYEA 3CW8X 4DG9A 3L8CA 1IBKC 3DAYA 1MDBA 1FJGC 2WP0C 4GXRA 4X65C 3B7WA 1J5EC 3TQIA 4GS5A 5K8FA 3TUFA 4BBYA 1MXBA 4WV3A 4K0KC 1IBMC 1UKKA 2ONFA 4DV6C 5LMUC 1HH2P 1V26A 1YJ7A 3R9WA 5KYVA 5T8SA 3IEVA 3DHVA 4DR7C 4DV0C 1N32C 2QL8A 4DR1C 3LNVA 1L2FA 5T8TA 1VLAA 4NOZA 1BA3A 2UUBC 5AE1A 4OYCA 1RG9A 4YHHC 3IEUA 3J81D 3IMLA 2OPLA 4L2ZA 4LFBC 3A9VA 4DV3C 2EGTA 3CJEA 1XNRC 4DCSA 4R1MA 4JI3C 4X62C 4DV7C 1N34C 1XNQC 3GR0A 4RMNA 4RVOA 4DCVA 2D1SA 4NXMC 3L95X 2OBVA 4D57A 3OTOC 5KYTA 4DV4C 4RLQA 2UXCC 4LF6C 1WH9A 4XX2A 2UXBC 1O92A 5IT9D 2UU9C 5BSTA 2P2JA 2CY1A 1EGAA 3RG2A 2UUAC 1ZB9A 3I08A 4B3MC 5KEIA 3IPLA 4L7IA 3UOWA 5IFIA 3I07A 4HPVA 4PROC 1RY2A 5DV9A 4DR3C 5GTDA 5BUSA 2P2FA 5A1IA 4LF5C 1O93A 2QVYX 3SO4A 4FTFA 5K85A 4D4IA 2VSQA 3GPCA 3FCCA 1PG4A 4G37A 4I9FA 4GKKC 1IBLC 5CZVA 1HNZC 2BH1X 3A9UA 2P2MA 4RVNA 4JYAC 3GR1A 3PROC 2ATWA 2QVZX 5IWAC 4IZ6A 1MDFA 2YWBA 1XMOC 2D1TA 4DR5C 2QW0X 4DCTA 4LFCC 4BC9A 1ML8A 4B3SC 2OO4A 4OX9C 2DPLA 1XRCA 1O90A 3A4IA 4K0BA 4GXQA 1HNWC 5BSUA 3JAMD 3EERA 4OXIA 2YCBA 2PT7G 2PN2A 4D4GA 2HJGA 4AQYC 4RM3A 2PROA 4ZJZA 3J7AD 1MD9A 4DV1C 1LCIA 2JMPA 3PESA 4G1IA 4ZLPA 1N33C 3RV2A 4LF8C 2D1RA 1AMUA 3TDEA 3CW9A 4LF7C 1PG3A 3LGXA 5E7QA 4FUQA 3ETOA 1T5DX 2VZEA 5A2QD 3ETCA 4DR2C 4G36A 3FCEA 1KKGA 2ASBA 4X66C 4L4QA 4ISBA 4NXNC 2P2BA 2DYJA 4LE5A 4DV2C 4GKJC 4BSZA 4JI6C 4JI4C 4RLFA 4LF4C 3T1HC 4KTTA 4JI1C 2D27A 1N2FA 2F4VC 5BUQA 5FLXD 2BJOA 5LMNC 1GPMA 2D1QA 2D7VA 1ULTA 5A19A 3AF5A 4LF9C 2XR1A 4B3TC 5BSVA 4DR6C 1PA4A 4RM2A 1XMQC 1P7LA 4DUZC 2ZM6C 4JI8C 3NYQA 4PHTA 3E7XA 4WS9A 1HNXC 1ZB8A 3C5EA 2Y4OA 3NI2A 3VNSA 2QVXX 3H2TA 1USPA 1LQLA 1QM4A 5AE2A 4JI0C 4BC7A 4DV5C 4JI2C 4MH4A 2HHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMP A;  4X64 C;  1K0R A;  1N33 C;  3AF6 A;  4LF8 C;  2CY1 A;  2E8F A;  1EGA A;  1NYE A;  1IBK C;  4LF7 C;  2UUA C;  1ZB9 A;  1FJG C;  4B3M C;  3T1Y C;  1QWI A;  4X65 C;  1J5E C;  5A2Q D;  3I07 A;  4DR2 C;  3J80 D;  4DUY C;  4DR3 C;  1KKG A;  4K0K C;  2ASB A;  1IBM C;  4X66 C;  1MKY A;  1UKK A;  2ONF A;  4DV6 C;  4NXN C;  5LMU C;  4LF5 C;  1HH2 P;  2DYJ A;  4DV2 C;  4JV5 C;  3R9W A;  4GKJ C;  3GKU A;  4BSZ A;  2OPL B;  4JI6 C;  1WF3 A;  4YY3 C;  4JI4 C;  4LF4 C;  3T1H C;  4JI1 C;  1N36 C;  1JOS A;  3IEV A;  4DR7 C;  2E8C A;  4DV0 C;  2UUC C;  2QL8 A;  4DR1 C;  2E5L C;  1N32 C;  2UXD C;  1N2F A;  1L2F A;  1VLA A;  4NOZ A;  2F4V C;  2UUB C;  4GKK C;  5FLX D;  2BJO A;  2CXC A;  5LMN C;  1IBL C;  1HR0 C;  4LFA C;  4DR4 C;  3R9X A;  4YHH C;  3IEU A;  3J81 D;  2VQF C;  2OPL A;  2D7V A;  1HNZ C;  4JI7 C;  4LFB C;  3AF5 A;  4DV3 C;  2XR1 A;  4LF9 C;  4B3R C;  4JYA C;  2EGT A;  3CJE A;  1XNR C;  4DCS A;  2ATW A;  4B3T C;  4JI3 C;  5IWA C;  4DCU A;  4DR6 C;  1PA4 A;  4X62 C;  4DV7 C;  1N34 C;  1XNQ C;  2KZF A;  1XMQ C;  4DUZ C;  1XMO C;  2ZM6 C;  4JI8 C;  4DR5 C;  4DCT A;  4DCV A;  1USP B;  4LFC C;  1HNX C;  1ZB8 A;  1ML8 A;  4NXM C;  4B3S C;  4JI5 C;  4OX9 C;  1USP A;  3OTO C;  2E8E A;  1LQL A;  5BR8 C;  1HNW C;  4KHP C;  1I94 C;  3JAM D;  3LUS A;  4DV4 C;  3EER A;  4JI0 C;  2UXC C;  4LF6 C;  2YCB A;  2VQE C;  2PT7 G;  2PN2 A;  1WH9 A;  2HJG A;  4AQY C;  4DV5 C;  4JI2 C;  4MH4 A;  2E7G A;  4XX2 A;  2UXB C;  5IT9 D;  3J7A D;  2UU9 C;  4MTN A;  4DV1 C;  2HHH C; 
#chains in the Genus database with same CATH topology
 4PUH A;  3E7W A;  1K0R A;  4JM1 A;  2MM9 A;  4NDN A;  5BUR A;  5BSM A;  5BSR A;  4PUG A;  2DHM A;  2P20 A;  2Y27 A;  1XDX A;  3UX3 A;  2WD9 A;  1XRB A;  3T1Y C;  4R0M A;  3R44 A;  1QWI A;  1TH5 A;  1O9T A;  3J80 D;  2V7B A;  4DUY C;  3LAX A;  3N2Q A;  1XRA A;  3PBK A;  4EAT A;  2M5O A;  1MKY A;  2AYA A;  3UZ0 A;  4JV5 C;  3N54 B;  1PU1 A;  3GKU A;  2OPL B;  1WF3 A;  3VNQ A;  4YY3 C;  4U5Y D;  2D28 C;  2Y4N A;  3AY0 A;  5A1G A;  3K6R A;  3EQ6 A;  1N36 C;  1JOS A;  2E8C A;  4ODJ A;  2UUC C;  2UXD C;  2E5L C;  4FUT A;  4TPS B;  2CXC A;  3KXW A;  5JRH A;  1MXC A;  1HR0 C;  4LFA C;  4DR4 C;  3R9X A;  2VQF C;  3UX2 A;  4JI7 C;  1T5H X;  4B3R C;  1VEH A;  4BCA A;  3S82 A;  3NPD A;  4DCU A;  2KZ0 A;  2KZF A;  3NYR A;  2P02 A;  4IR7 A;  5BSW A;  2YWC A;  2Z51 A;  1USP B;  2MMA B;  3DLP X;  4JI5 C;  3VNR A;  4I9G A;  5ADZ A;  2P2Q A;  3FM7 A;  2E8E A;  1MXA A;  5BR8 C;  4D56 A;  4KHP C;  1I94 C;  3LUS A;  3TR3 A;  1M6X A;  1FUG A;  5CZX A;  4R1L A;  2VQE C;  1V25 A;  2E0G A;  4KTV A;  2E7G A;  4PZP A;  3G7S A;  4MTN A;  5AE3 A;  4X64 C;  4DG8 A;  3AF6 A;  2E8F A;  5H9U A;  1WCJ A;  1NYE A;  3CW8 X;  4DG9 A;  3L8C A;  1IBK C;  3DAY A;  1MDB A;  1FJG C;  2WP0 C;  3A26 A;  1XHJ A;  4GXR A;  4X65 C;  3B7W A;  1J5E C;  3TQI A;  4GS5 A;  5K8F A;  3TUF A;  4BBY A;  1MXB A;  4WV3 A;  4K0K C;  1IBM C;  1UKK A;  3O2E A;  2ONF A;  4DV6 C;  5LMU C;  1HH2 P;  1V26 A;  1YJ7 A;  3R9W A;  5KYV A;  3CQ3 A;  2ZTB A;  5T8S A;  3IEV A;  3DHV A;  4DR7 C;  4DV0 C;  1N32 C;  2QL8 A;  4DR1 C;  3LNV A;  1L2F A;  5T8T A;  1VLA A;  1P4E C;  4NOZ A;  1BA3 A;  1NY8 A;  2UUB C;  5AE1 A;  1V60 A;  4OYC A;  1RG9 A;  4YHH C;  3IEU A;  3J81 D;  3IML A;  2OPL A;  4L2Z A;  4LFB C;  3A9V A;  4DV3 C;  2EGT A;  3CJE A;  1XNR C;  4DCS A;  4R1M A;  4JI3 C;  4X62 C;  2MCQ A;  4DV7 C;  1N34 C;  1XNQ C;  3GR0 A;  4RMN A;  4RVO A;  4DCV A;  2NCL A;  2D1S A;  4NXM C;  3L95 X;  5LCI A;  2OBV A;  4D57 A;  3OTO C;  5KYT A;  4DV4 C;  4RLQ A;  2KDN A;  2UXC C;  4LF6 C;  1WH9 A;  4XX2 A;  2UXB C;  1O92 A;  5IT9 D;  2PG1 E;  2UU9 C;  5BST A;  2P2J A;  2CY1 A;  1EGA A;  3RG2 A;  2UUA C;  1ZB9 A;  3I08 A;  4B3M C;  5KEI A;  3IPL A;  4L7I A;  3UOW A;  5IFI A;  3I07 A;  4HPV A;  4PRO C;  2YX1 A;  1RY2 A;  5DV9 A;  4DR3 C;  5GTD A;  5BUS A;  2P2F A;  5A1I A;  4LF5 C;  2CU6 A;  1O93 A;  2QVY X;  3CQ1 A;  3SO4 A;  4FTF A;  5K85 A;  4D4I A;  2VSQ A;  3GPC A;  3FCC A;  1PG4 A;  4G37 A;  4I9F A;  4GKK C;  3A25 A;  1IBL C;  5CZV A;  1XS3 A;  1HNZ C;  2BH1 X;  3A9U A;  2P2M A;  4RVN A;  4JYA C;  3GR1 A;  3PRO C;  2ATW A;  2QVZ X;  1UWD A;  5IWA C;  4IZ6 A;  1MDF A;  2YWB A;  1XMO C;  2D1T A;  4DR5 C;  2QW0 X;  3CQ2 A;  4DCT A;  4LFC C;  4BC9 A;  1ML8 A;  4B3S C;  2OO4 A;  4OX9 C;  2DPL A;  1XRC A;  1O90 A;  3A4I A;  4K0B A;  4GXQ A;  1HNW C;  1M6X C;  5BSU A;  3JAM D;  3EER A;  4OXI A;  2YCB A;  2PT7 G;  2PN2 A;  4D4G A;  2HJG A;  4AQY C;  4RM3 A;  2PRO A;  4ZJZ A;  3J7A D;  1MD9 A;  4DV1 C;  1LCI A;  2JMP A;  1P4E A;  3PES A;  4G1I A;  4ZLP A;  1N33 C;  3RV2 A;  4LF8 C;  2D1R A;  1AMU A;  3TDE A;  3CW9 A;  4LF7 C;  1PG3 A;  3LGX A;  5E7Q A;  4FUQ A;  3ETO A;  1T5D X;  2VZE A;  5A2Q D;  2JNV A;  3ETC A;  4DR2 C;  2M5H A;  4G36 A;  3FCE A;  1KKG A;  2ASB A;  4X66 C;  4L4Q A;  4ISB A;  4NXN C;  2P2B A;  2DYJ A;  4LE5 A;  4DV2 C;  4GKJ C;  2ZZM A;  4BSZ A;  4JI6 C;  4JI4 C;  4RLF A;  4LF4 C;  3T1H C;  4KTT A;  4JI1 C;  2D27 A;  1N2F A;  2F4V C;  5BUQ A;  5FLX D;  5LMN C;  2BJO A;  4PUI A;  1IB8 A;  1GPM A;  2D1Q A;  1FLO A;  2D7V A;  1ULT A;  5A19 A;  3AF5 A;  4LF9 C;  2XR1 A;  4B3T C;  5BSV A;  4DR6 C;  1PA4 A;  4RM2 A;  1XMQ C;  1P7L A;  4DUZ C;  2ZM6 C;  4JI8 C;  3NYQ A;  4PHT A;  3E7X A;  4WS9 A;  1HNX C;  1ZB8 A;  3C5E A;  2Y4O A;  3NI2 A;  3UEB A;  3VNS A;  2QVX X;  3H2T A;  1USP A;  1YGT A;  1LQL A;  1QM4 A;  2ZZN A;  5AE2 A;  4JI0 C;  4BC7 A;  4DV5 C;  4JI2 C;  4MH4 A;  3LNO A;  2HHH C; 
#chains in the Genus database with same CATH homology
 3E7W A;  1K0R A;  4JM1 A;  5BUR A;  4NDN A;  5BSM A;  5BSR A;  2P20 A;  2Y27 A;  2WD9 A;  1XRB A;  3T1Y C;  4R0M A;  3R44 A;  1QWI A;  1O9T A;  3J80 D;  2V7B A;  4DUY C;  3LAX A;  3N2Q A;  1XRA A;  3PBK A;  4EAT A;  1MKY A;  2AYA A;  3UZ0 A;  4JV5 C;  3N54 B;  3GKU A;  2OPL B;  1WF3 A;  3VNQ A;  4YY3 C;  4U5Y D;  2D28 C;  2Y4N A;  5A1G A;  3EQ6 A;  1N36 C;  1JOS A;  2E8C A;  4ODJ A;  2UUC C;  2UXD C;  2E5L C;  4FUT A;  4TPS B;  2CXC A;  3KXW A;  5JRH A;  1MXC A;  1HR0 C;  4LFA C;  4DR4 C;  3R9X A;  2VQF C;  4JI7 C;  1T5H X;  4B3R C;  4BCA A;  3S82 A;  3NPD A;  4DCU A;  2KZF A;  3NYR A;  2P02 A;  4IR7 A;  5BSW A;  2YWC A;  1USP B;  3DLP X;  4JI5 C;  3VNR A;  4I9G A;  5ADZ A;  2P2Q A;  2E8E A;  1MXA A;  5BR8 C;  4D56 A;  4KHP C;  1I94 C;  3LUS A;  1FUG A;  5CZX A;  4R1L A;  2VQE C;  1V25 A;  2E0G A;  4KTV A;  2E7G A;  4PZP A;  3G7S A;  4MTN A;  5AE3 A;  4X64 C;  4DG8 A;  3AF6 A;  2E8F A;  5H9U A;  1NYE A;  3CW8 X;  4DG9 A;  3L8C A;  1IBK C;  3DAY A;  1MDB A;  1FJG C;  2WP0 C;  4GXR A;  4X65 C;  3B7W A;  1J5E C;  3TQI A;  4GS5 A;  5K8F A;  3TUF A;  4BBY A;  1MXB A;  4WV3 A;  4K0K C;  1IBM C;  1UKK A;  2ONF A;  4DV6 C;  5LMU C;  1HH2 P;  1V26 A;  1YJ7 A;  3R9W A;  5KYV A;  5T8S A;  3IEV A;  3DHV A;  4DR7 C;  4DV0 C;  1N32 C;  2QL8 A;  4DR1 C;  3LNV A;  1L2F A;  5T8T A;  1VLA A;  4NOZ A;  1BA3 A;  2UUB C;  5AE1 A;  4OYC A;  1RG9 A;  4YHH C;  3IEU A;  3J81 D;  3IML A;  2OPL A;  4L2Z A;  4LFB C;  3A9V A;  4DV3 C;  2EGT A;  3CJE A;  1XNR C;  4DCS A;  4R1M A;  4JI3 C;  4X62 C;  4DV7 C;  1N34 C;  1XNQ C;  3GR0 A;  4RMN A;  4RVO A;  4DCV A;  2D1S A;  4NXM C;  3L95 X;  2OBV A;  4D57 A;  3OTO C;  5KYT A;  4DV4 C;  4RLQ A;  2UXC C;  4LF6 C;  1WH9 A;  4XX2 A;  2UXB C;  1O92 A;  5IT9 D;  2UU9 C;  5BST A;  2P2J A;  2CY1 A;  1EGA A;  3RG2 A;  2UUA C;  1ZB9 A;  3I08 A;  4B3M C;  5KEI A;  3IPL A;  4L7I A;  3UOW A;  5IFI A;  3I07 A;  4HPV A;  4PRO C;  1RY2 A;  5DV9 A;  4DR3 C;  5GTD A;  5BUS A;  2P2F A;  5A1I A;  4LF5 C;  1O93 A;  2QVY X;  3SO4 A;  4FTF A;  5K85 A;  4D4I A;  2VSQ A;  3GPC A;  3FCC A;  1PG4 A;  4G37 A;  4I9F A;  4GKK C;  1IBL C;  5CZV A;  1HNZ C;  2BH1 X;  3A9U A;  2P2M A;  4RVN A;  4JYA C;  3GR1 A;  3PRO C;  2ATW A;  2QVZ X;  5IWA C;  4IZ6 A;  1MDF A;  2YWB A;  1XMO C;  2D1T A;  4DR5 C;  2QW0 X;  4DCT A;  4LFC C;  4BC9 A;  1ML8 A;  4B3S C;  2OO4 A;  4OX9 C;  2DPL A;  1XRC A;  1O90 A;  3A4I A;  4K0B A;  4GXQ A;  1HNW C;  5BSU A;  3JAM D;  3EER A;  4OXI A;  2YCB A;  2PT7 G;  2PN2 A;  4D4G A;  2HJG A;  4AQY C;  4RM3 A;  2PRO A;  4ZJZ A;  3J7A D;  1MD9 A;  4DV1 C;  1LCI A;  2JMP A;  3PES A;  4G1I A;  4ZLP A;  1N33 C;  3RV2 A;  4LF8 C;  2D1R A;  1AMU A;  3TDE A;  3CW9 A;  4LF7 C;  1PG3 A;  3LGX A;  5E7Q A;  4FUQ A;  3ETO A;  1T5D X;  2VZE A;  5A2Q D;  3ETC A;  4DR2 C;  4G36 A;  3FCE A;  1KKG A;  2ASB A;  4X66 C;  4L4Q A;  4ISB A;  4NXN C;  2P2B A;  2DYJ A;  4LE5 A;  4DV2 C;  4GKJ C;  4BSZ A;  4JI6 C;  4JI4 C;  4RLF A;  4LF4 C;  3T1H C;  4KTT A;  4JI1 C;  2D27 A;  1N2F A;  2F4V C;  5BUQ A;  5FLX D;  2BJO A;  5LMN C;  1GPM A;  2D1Q A;  2D7V A;  1ULT A;  5A19 A;  3AF5 A;  4LF9 C;  2XR1 A;  4B3T C;  5BSV A;  4DR6 C;  1PA4 A;  4RM2 A;  1XMQ C;  1P7L A;  4DUZ C;  2ZM6 C;  4JI8 C;  3NYQ A;  4PHT A;  3E7X A;  4WS9 A;  1HNX C;  1ZB8 A;  3C5E A;  2Y4O A;  3NI2 A;  3VNS A;  2QVX X;  3H2T A;  1USP A;  1LQL A;  1QM4 A;  5AE2 A;  4JI0 C;  4BC7 A;  4DV5 C;  4JI2 C;  4MH4 A;  2HHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...