1HNXC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnxC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnxC02
2JMPA 4DR7C 4LFBC 3T1YC 1QWIA 1IBLC 4LFAC 1WH9A 2XR1A 4DV6C 4AQYC 4DV7C 4GKJC 1N33C 3AF5A 4JI2C 1PA4A 4OX9C 3J7AD 5IT9D 2ZM6C 4DCUA 4DV4C 1XMQC 2UUBC 3IEVA 2UUCC 1USPA 2E7GA 4DCVA 2HHHC 4DCTA 1N2FA 4DUYC 4DV3C 2E8CA 4JI5C 1EGAA 3I07A 4JI3C 1KKGA 1VLAA 4LF4C 1HNXC 1HNZC 4X66C 4DCSA 2E8FA 2UU9C 4LF5C 1NYEA 1ZB8A 2EGTA 4LF9C 4X64C 5FLXD 3JAMD 1IBMC 2PT7G 4DR2C 4LFCC 4JYAC 1N32C 2VQFC 3LUSA 4YHHC 4DV0C 2VQEC 1XNRC 5LMUC 1HH2P 3T1HC 2F4VC 2PN2A 4B3MC 3GKUA 4DR4C 4NXNC 3AF6A 4B3SC 2ASBA 2YCBA 2UXBC 4DR5C 5BR8C 4DR3C 2HJGA 2OPLA 4JI1C 1LQLA 3EERA 3OTOC 1JOSA 2E5LC 4NOZA 4MH4A 1HNWC 1FJGC 2CY1A 2DYJA 4JI6C 1L2FA 5LMNC 4YY3C 5A2QD 2UXDC 4BSZA 4X65C 4JV5C 3J81D 4X62C 2D7VA 4DV5C 1K0RA 3J80D 4GKKC 2KZFA 2CXCA 4LF8C 4NXMC 1UKKA 2QL8A 2UUAC 1XNQC 4DV2C 3CJEA 1USPB 2ONFA 1XMOC 4B3TC 4LF6C 4K0KC 2ATWA 4B3RC 1N34C 1HR0C 1N36C 4JI7C 3IEUA 1MKYA 3R9WA 2E8EA 2UXCC 4DR6C 1ML8A 4DR1C 4MTNA 4JI8C 2BJOA 2OPLB 1I94C 4KHPC 1WF3A 4DUZC 3R9XA 4JI0C 4LF7C 4DV1C 1ZB9A 4JI4C 5IWAC 4XX2A 1J5EC 1IBKC
chains in the Genus database with same CATH superfamily
4G36A 2WP0C 3K6RA 5K8FA 4PUGA 2OO4A 4LFAC 1MXBA 3PESA 3AY0A 1N33C 5IT9D 2D1RA 2ZM6C 3E7XA 2UUCC 1MXCA 3L8CA 2ZZMA 4DUYC 4ZLPA 4RMNA 4FTFA 1M6XA 5KYTA 4X66C 4GS5A 1ZB8A 2EGTA 5FLXD 1RY2A 2KDNA 1XNRC 2VQEC 1V26A 4R0MA 4L4QA 4B3MC 3GKUA 3GPCA 2Y4OA 3GR1A 3AF6A 5T8SA 2YX1A 2YCBA 4OYCA 5A1IA 1LQLA 1P7LA 3EERA 4RM2A 3TR3A 3LAXA 2E5LC 4NOZA 3SO4A 2YWCA 2D1TA 3R44A 5LMNC 5BURA 4YY3C 2BH1X 5KYVA 4G37A 1AMUA 2D1QA 4X65C 5BSWA 5ADZA 1P4EA 3A25A 4GKKC 4BC9A 4KTTA 4ODJA 4U5YD 4RM3A 4K0BA 1XMOC 2MM9A 3DLPX 2ATWA 5BSVA 3UOWA 4JI7C 1MKYA 3R9WA 1QM4A 3DHVA 3NPDA 2P2JA 5T8TA 3UX3A 3N54B 2BJOA 2P2FA 4KHPC 4DUZC 4JI0C 3UEBA 4EATA 4OXIA 2JMPA 4DR7C 4LFBC 1MD9A 4PUHA 2Z51A 4RVOA 3EQ6A 1IBLC 1O92A 3CW9A 5BSMA 3O2EA 4JI2C 2E7GA 4IR7A 2KZ0A 3RV2A 4DCTA 5A1GA 4DV3C 3S82A 2DPLA 4D4GA 2MCQA 3N2QA 2Y27A 1HNXC 5BSRA 2E8FA 4RLQA 4LF5C 5GTDA 3VNSA 3PROC 2Y4NA 3LUSA 4HPVA 4DV0C 3LNOA 5BUSA 2P20A 3H2TA 1PG4A 1BA3A 1FUGA 1YGTA 5H9UA 1O93A 4DR5C 5BR8C 4PZPA 4DR3C 5AE3A 4JI1C 4DG8A 1MXAA 3IMLA 1V25A 4ISBA 3A9VA 4BBYA 1XS3A 3CQ2A 1HNWC 2VZEA 3TQIA 4JI6C 4BCAA 1XDXA 3TUFA 2D27A 2PG1E 3PBKA 1O90A 4DV5C 3ETCA 3J80D 4D4IA 4FUQA 2KZFA 3UZ0A 2QL8A 2M5HA 4B3RC 4RVNA 3IEUA 3A26A 2VSQA 1ML8A 4DR1C 4JI8C 3A9UA 2OPLB 3ETOA 2WD9A 1WF3A 1ULTA 5BUQA 4I9GA 5A19A 1PG3A 1FLOA 1IBKC 3VNQA 3CW8X 5KEIA 2XR1A 4DV6C 4DV7C 4TPSB 4NDNA 2P02A 1PA4A 4JM1A 1T5DX 2D28C 4WS9A 4DV4C 1XMQC 2UUBC 3IEVA 1USPA 2QVXX 3CQ1A 3GR0A 1XHJA 4JI5C 1VLAA 5IFIA 1HNZC 4D57A 4DCSA 2UU9C 1NYEA 4X64C 5JRHA 4DR2C 3NYQA 2VQFC 4YHHC 4L7IA 5LMUC 1HH2P 2OBVA 2F4VC 3TDEA 4DR4C 4NXNC 2CU6A 4RLFA 2ASBA 4BC7A 4I9FA 2UXBC 5CZXA 3KXWA 2OPLA 1JOSA 1GPMA 3I08A 1XRCA 1FJGC 2DYJA 4G1IA 4IZ6A 5A2QD 4ZJZA 4PROC 2ZZNA 4JV5C 3J81D 2D7VA 1LCIA 1K0RA 1M6XC 5AE1A 1UWDA 5AE2A 2CXCA 3RG2A 2JNVA 4LF8C 2M5OA 1UKKA 5BSUA 1XNQC 4DV2C 1O9TA 1USPB 3A4IA 4B3TC 4LF6C 4LE5A 4R1LA 1N34C 1HR0C 2P2QA 3UX2A 2E8EA 2V7BA 3L95X 4KTVA 2ZTBA 1ZB9A 5IWAC 1NY8A 1J5EC 5K85A 3T1YC 4R1MA 4GXRA 1QWIA 1WH9A 2QVYX 1T5HX 4AQYC 4GKJC 3IPLA 2D1SA 3AF5A 2YWBA 4OX9C 3J7AD 3FCEA 4DCUA 3CQ3A 1XRAA 3FCCA 2HHHC 4DCVA 4L2ZA 1PU1A 1N2FA 4WV3A 3B7WA 1WCJA 2E8CA 1XRBA 1EGAA 3I07A 2QW0X 4JI3C 4FUTA 1KKGA 1P4EC 4LF4C 1RG9A 3E7WA 4PHTA 4LF9C 3NYRA 3JAMD 4GXQA 3VNRA 2AYAA 1IBMC 2PT7G 4LFCC 4JYAC 1N32C 2P2MA 2P2BA 3T1HC 2PN2A 4B3SC 3DAYA 5LCIA 1VEHA 2HJGA 1IB8A 3FM7A 2QVZX 3OTOC 5BSTA 4DG9A 4MH4A 2CY1A 1L2FA 3NI2A 1TH5A 2UXDC 4BSZA 1MDBA 2MMAB 3G7SA 4X62C 4D56A 1MDFA 4NXMC 2UUAC 3CJEA 5DV9A 4PUIA 2ONFA 4K0KC 2PROA 1YJ7A 1N36C 2NCLA 5E7QA 2DHMA 2UXCC 3LGXA 4MTNA 3LNVA 1I94C 3R9XA 4LF7C 4DV1C 3C5EA 4JI4C 4DR6C 4XX2A 1V60A 2E0GA 5CZVA
chains in the Genus database with same CATH topology
4G36A 2WP0C 5K8FA 2OO4A 4LFAC 1MXBA 3PESA 1N33C 5IT9D 2D1RA 2ZM6C 3E7XA 2UUCC 1MXCA 3L8CA 4DUYC 4ZLPA 4RMNA 4FTFA 5KYTA 4X66C 4GS5A 1ZB8A 2EGTA 5FLXD 1RY2A 1XNRC 2VQEC 1V26A 4R0MA 4L4QA 4B3MC 3GKUA 3GPCA 2Y4OA 3GR1A 3AF6A 5T8SA 2YCBA 4OYCA 5A1IA 1LQLA 1P7LA 3EERA 4RM2A 3LAXA 2E5LC 4NOZA 3SO4A 2YWCA 2D1TA 3R44A 5LMNC 5BURA 4YY3C 2BH1X 5KYVA 4G37A 1AMUA 2D1QA 4X65C 5BSWA 5ADZA 4GKKC 4BC9A 4KTTA 4ODJA 4U5YD 4RM3A 4K0BA 1XMOC 3DLPX 2ATWA 5BSVA 3UOWA 4JI7C 1MKYA 3R9WA 1QM4A 3DHVA 3NPDA 2P2JA 5T8TA 3N54B 2BJOA 2P2FA 4KHPC 4DUZC 4JI0C 4EATA 4OXIA 2JMPA 4DR7C 4LFBC 1MD9A 4RVOA 3EQ6A 1IBLC 1O92A 3CW9A 5BSMA 4JI2C 2E7GA 4IR7A 3RV2A 4DCTA 5A1GA 4DV3C 3S82A 2DPLA 4D4GA 3N2QA 2Y27A 1HNXC 5BSRA 2E8FA 4RLQA 4LF5C 5GTDA 3VNSA 3PROC 2Y4NA 3LUSA 4HPVA 4DV0C 5BUSA 2P20A 3H2TA 1PG4A 1BA3A 1FUGA 5H9UA 1O93A 4DR5C 5BR8C 4PZPA 4DR3C 4JI1C 5AE3A 4DG8A 1MXAA 3IMLA 1V25A 4ISBA 3A9VA 4BBYA 1HNWC 2VZEA 3TQIA 4JI6C 4BCAA 3TUFA 2D27A 3PBKA 1O90A 4DV5C 3ETCA 3J80D 4D4IA 4FUQA 2KZFA 3UZ0A 2QL8A 4B3RC 4RVNA 3IEUA 2VSQA 1ML8A 4DR1C 4JI8C 3A9UA 2OPLB 3ETOA 2WD9A 1WF3A 1ULTA 5BUQA 4I9GA 5A19A 1PG3A 1IBKC 3VNQA 3CW8X 5KEIA 2XR1A 4DV6C 4DV7C 4TPSB 4NDNA 2P02A 1PA4A 4JM1A 1T5DX 2D28C 4WS9A 4DV4C 1XMQC 2UUBC 3IEVA 1USPA 2QVXX 3GR0A 4JI5C 1VLAA 5IFIA 1HNZC 4D57A 4DCSA 2UU9C 1NYEA 4X64C 5JRHA 4DR2C 3NYQA 2VQFC 4YHHC 4L7IA 5LMUC 1HH2P 2OBVA 2F4VC 3TDEA 4DR4C 4NXNC 4RLFA 2ASBA 4BC7A 4I9FA 2UXBC 5CZXA 3KXWA 2OPLA 1JOSA 1GPMA 3I08A 1XRCA 1FJGC 2DYJA 4G1IA 4IZ6A 5A2QD 4ZJZA 4PROC 4JV5C 3J81D 2D7VA 1LCIA 1K0RA 5AE1A 5AE2A 2CXCA 3RG2A 4LF8C 1UKKA 5BSUA 1XNQC 4DV2C 1O9TA 1USPB 3A4IA 4B3TC 4LF6C 4LE5A 4R1LA 1N34C 1HR0C 2P2QA 2E8EA 2V7BA 3L95X 4KTVA 1ZB9A 5IWAC 1J5EC 5K85A 3T1YC 4R1MA 4GXRA 1QWIA 1WH9A 2QVYX 1T5HX 4AQYC 4GKJC 3IPLA 2D1SA 3AF5A 2YWBA 4OX9C 3J7AD 3FCEA 4DCUA 1XRAA 3FCCA 2HHHC 4DCVA 4L2ZA 1N2FA 4WV3A 3B7WA 2E8CA 1XRBA 1EGAA 3I07A 2QW0X 4JI3C 4FUTA 1KKGA 4LF4C 1RG9A 3E7WA 4PHTA 4LF9C 3NYRA 3JAMD 4GXQA 3VNRA 2AYAA 1IBMC 2PT7G 4LFCC 4JYAC 1N32C 2P2MA 2P2BA 3T1HC 2PN2A 4B3SC 3DAYA 2HJGA 2QVZX 3OTOC 5BSTA 4DG9A 4MH4A 2CY1A 1L2FA 3NI2A 2UXDC 4BSZA 1MDBA 3G7SA 4X62C 4D56A 1MDFA 4NXMC 2UUAC 3CJEA 5DV9A 2ONFA 4K0KC 2PROA 1YJ7A 1N36C 5E7QA 2UXCC 3LGXA 4MTNA 3LNVA 1I94C 3R9XA 4LF7C 4DV1C 3C5EA 4JI4C 4DR6C 4XX2A 2E0GA 5CZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMP A;  4DR7 C;  4LFB C;  3T1Y C;  1QWI A;  1IBL C;  4LFA C;  1WH9 A;  2XR1 A;  4DV6 C;  4AQY C;  4DV7 C;  4GKJ C;  1N33 C;  3AF5 A;  4JI2 C;  1PA4 A;  4OX9 C;  3J7A D;  5IT9 D;  2ZM6 C;  4DCU A;  4DV4 C;  1XMQ C;  2UUB C;  3IEV A;  2UUC C;  1USP A;  2E7G A;  4DCV A;  2HHH C;  4DCT A;  1N2F A;  4DUY C;  4DV3 C;  2E8C A;  4JI5 C;  1EGA A;  3I07 A;  4JI3 C;  1KKG A;  1VLA A;  4LF4 C;  1HNX C;  1HNZ C;  4X66 C;  4DCS A;  2E8F A;  2UU9 C;  4LF5 C;  1NYE A;  1ZB8 A;  2EGT A;  4LF9 C;  4X64 C;  5FLX D;  3JAM D;  1IBM C;  2PT7 G;  4DR2 C;  4LFC C;  4JYA C;  1N32 C;  2VQF C;  3LUS A;  4YHH C;  4DV0 C;  2VQE C;  1XNR C;  5LMU C;  1HH2 P;  3T1H C;  2F4V C;  2PN2 A;  4B3M C;  3GKU A;  4DR4 C;  4NXN C;  3AF6 A;  4B3S C;  2ASB A;  2YCB A;  2UXB C;  4DR5 C;  5BR8 C;  4DR3 C;  2HJG A;  2OPL A;  4JI1 C;  1LQL A;  3EER A;  3OTO C;  1JOS A;  2E5L C;  4NOZ A;  4MH4 A;  1HNW C;  1FJG C;  2CY1 A;  2DYJ A;  4JI6 C;  1L2F A;  5LMN C;  4YY3 C;  5A2Q D;  2UXD C;  4BSZ A;  4X65 C;  4JV5 C;  3J81 D;  4X62 C;  2D7V A;  4DV5 C;  1K0R A;  3J80 D;  4GKK C;  2KZF A;  2CXC A;  4LF8 C;  4NXM C;  1UKK A;  2QL8 A;  2UUA C;  1XNQ C;  4DV2 C;  3CJE A;  1USP B;  2ONF A;  1XMO C;  4B3T C;  4LF6 C;  4K0K C;  2ATW A;  4B3R C;  1N34 C;  1HR0 C;  1N36 C;  4JI7 C;  3IEU A;  1MKY A;  3R9W A;  2E8E A;  2UXC C;  4DR6 C;  1ML8 A;  4DR1 C;  4MTN A;  4JI8 C;  2BJO A;  2OPL B;  1I94 C;  4KHP C;  1WF3 A;  4DUZ C;  3R9X A;  4JI0 C;  4LF7 C;  4DV1 C;  1ZB9 A;  4JI4 C;  5IWA C;  4XX2 A;  1J5E C;  1IBK C; 
#chains in the Genus database with same CATH topology
 4G36 A;  2WP0 C;  3K6R A;  5K8F A;  4PUG A;  2OO4 A;  4LFA C;  1MXB A;  3PES A;  3AY0 A;  1N33 C;  5IT9 D;  2D1R A;  2ZM6 C;  3E7X A;  2UUC C;  1MXC A;  3L8C A;  2ZZM A;  4DUY C;  4ZLP A;  4RMN A;  4FTF A;  1M6X A;  5KYT A;  4X66 C;  4GS5 A;  1ZB8 A;  2EGT A;  5FLX D;  1RY2 A;  2KDN A;  1XNR C;  2VQE C;  1V26 A;  4R0M A;  4L4Q A;  4B3M C;  3GKU A;  3GPC A;  2Y4O A;  3GR1 A;  3AF6 A;  5T8S A;  2YX1 A;  2YCB A;  4OYC A;  5A1I A;  1LQL A;  1P7L A;  3EER A;  4RM2 A;  3TR3 A;  3LAX A;  2E5L C;  4NOZ A;  3SO4 A;  2YWC A;  2D1T A;  3R44 A;  5LMN C;  5BUR A;  4YY3 C;  2BH1 X;  5KYV A;  4G37 A;  1AMU A;  2D1Q A;  4X65 C;  5BSW A;  5ADZ A;  1P4E A;  3A25 A;  4GKK C;  4BC9 A;  4KTT A;  4ODJ A;  4U5Y D;  4RM3 A;  4K0B A;  1XMO C;  2MM9 A;  3DLP X;  2ATW A;  5BSV A;  3UOW A;  4JI7 C;  1MKY A;  3R9W A;  1QM4 A;  3DHV A;  3NPD A;  2P2J A;  5T8T A;  3UX3 A;  3N54 B;  2BJO A;  2P2F A;  4KHP C;  4DUZ C;  4JI0 C;  3UEB A;  4EAT A;  4OXI A;  2JMP A;  4DR7 C;  4LFB C;  1MD9 A;  4PUH A;  2Z51 A;  4RVO A;  3EQ6 A;  1IBL C;  1O92 A;  3CW9 A;  5BSM A;  3O2E A;  4JI2 C;  2E7G A;  4IR7 A;  2KZ0 A;  3RV2 A;  4DCT A;  5A1G A;  4DV3 C;  3S82 A;  2DPL A;  4D4G A;  2MCQ A;  3N2Q A;  2Y27 A;  1HNX C;  5BSR A;  2E8F A;  4RLQ A;  4LF5 C;  5GTD A;  3VNS A;  3PRO C;  2Y4N A;  3LUS A;  4HPV A;  4DV0 C;  3LNO A;  5BUS A;  2P20 A;  3H2T A;  1PG4 A;  1BA3 A;  1FUG A;  1YGT A;  5H9U A;  1O93 A;  4DR5 C;  5BR8 C;  4PZP A;  4DR3 C;  5AE3 A;  4JI1 C;  4DG8 A;  1MXA A;  3IML A;  1V25 A;  4ISB A;  3A9V A;  4BBY A;  1XS3 A;  3CQ2 A;  1HNW C;  2VZE A;  3TQI A;  4JI6 C;  4BCA A;  1XDX A;  3TUF A;  2D27 A;  2PG1 E;  3PBK A;  1O90 A;  4DV5 C;  3ETC A;  3J80 D;  4D4I A;  4FUQ A;  2KZF A;  3UZ0 A;  2QL8 A;  2M5H A;  4B3R C;  4RVN A;  3IEU A;  3A26 A;  2VSQ A;  1ML8 A;  4DR1 C;  4JI8 C;  3A9U A;  2OPL B;  3ETO A;  2WD9 A;  1WF3 A;  1ULT A;  5BUQ A;  4I9G A;  5A19 A;  1PG3 A;  1FLO A;  1IBK C;  3VNQ A;  3CW8 X;  5KEI A;  2XR1 A;  4DV6 C;  4DV7 C;  4TPS B;  4NDN A;  2P02 A;  1PA4 A;  4JM1 A;  1T5D X;  2D28 C;  4WS9 A;  4DV4 C;  1XMQ C;  2UUB C;  3IEV A;  1USP A;  2QVX X;  3CQ1 A;  3GR0 A;  1XHJ A;  4JI5 C;  1VLA A;  5IFI A;  1HNZ C;  4D57 A;  4DCS A;  2UU9 C;  1NYE A;  4X64 C;  5JRH A;  4DR2 C;  3NYQ A;  2VQF C;  4YHH C;  4L7I A;  5LMU C;  1HH2 P;  2OBV A;  2F4V C;  3TDE A;  4DR4 C;  4NXN C;  2CU6 A;  4RLF A;  2ASB A;  4BC7 A;  4I9F A;  2UXB C;  5CZX A;  3KXW A;  2OPL A;  1JOS A;  1GPM A;  3I08 A;  1XRC A;  1FJG C;  2DYJ A;  4G1I A;  4IZ6 A;  5A2Q D;  4ZJZ A;  4PRO C;  2ZZN A;  4JV5 C;  3J81 D;  2D7V A;  1LCI A;  1K0R A;  1M6X C;  5AE1 A;  1UWD A;  5AE2 A;  2CXC A;  3RG2 A;  2JNV A;  4LF8 C;  2M5O A;  1UKK A;  5BSU A;  1XNQ C;  4DV2 C;  1O9T A;  1USP B;  3A4I A;  4B3T C;  4LF6 C;  4LE5 A;  4R1L A;  1N34 C;  1HR0 C;  2P2Q A;  3UX2 A;  2E8E A;  2V7B A;  3L95 X;  4KTV A;  2ZTB A;  1ZB9 A;  5IWA C;  1NY8 A;  1J5E C;  5K85 A;  3T1Y C;  4R1M A;  4GXR A;  1QWI A;  1WH9 A;  2QVY X;  1T5H X;  4AQY C;  4GKJ C;  3IPL A;  2D1S A;  3AF5 A;  2YWB A;  4OX9 C;  3J7A D;  3FCE A;  4DCU A;  3CQ3 A;  1XRA A;  3FCC A;  2HHH C;  4DCV A;  4L2Z A;  1PU1 A;  1N2F A;  4WV3 A;  3B7W A;  1WCJ A;  2E8C A;  1XRB A;  1EGA A;  3I07 A;  2QW0 X;  4JI3 C;  4FUT A;  1KKG A;  1P4E C;  4LF4 C;  1RG9 A;  3E7W A;  4PHT A;  4LF9 C;  3NYR A;  3JAM D;  4GXQ A;  3VNR A;  2AYA A;  1IBM C;  2PT7 G;  4LFC C;  4JYA C;  1N32 C;  2P2M A;  2P2B A;  3T1H C;  2PN2 A;  4B3S C;  3DAY A;  5LCI A;  1VEH A;  2HJG A;  1IB8 A;  3FM7 A;  2QVZ X;  3OTO C;  5BST A;  4DG9 A;  4MH4 A;  2CY1 A;  1L2F A;  3NI2 A;  1TH5 A;  2UXD C;  4BSZ A;  1MDB A;  2MMA B;  3G7S A;  4X62 C;  4D56 A;  1MDF A;  4NXM C;  2UUA C;  3CJE A;  5DV9 A;  4PUI A;  2ONF A;  4K0K C;  2PRO A;  1YJ7 A;  1N36 C;  2NCL A;  5E7Q A;  2DHM A;  2UXC C;  3LGX A;  4MTN A;  3LNV A;  1I94 C;  3R9X A;  4LF7 C;  4DV1 C;  3C5E A;  4JI4 C;  4DR6 C;  4XX2 A;  1V60 A;  2E0G A;  5CZV A; 
#chains in the Genus database with same CATH homology
 4G36 A;  2WP0 C;  5K8F A;  2OO4 A;  4LFA C;  1MXB A;  3PES A;  1N33 C;  5IT9 D;  2D1R A;  2ZM6 C;  3E7X A;  2UUC C;  1MXC A;  3L8C A;  4DUY C;  4ZLP A;  4RMN A;  4FTF A;  5KYT A;  4X66 C;  4GS5 A;  1ZB8 A;  2EGT A;  5FLX D;  1RY2 A;  1XNR C;  2VQE C;  1V26 A;  4R0M A;  4L4Q A;  4B3M C;  3GKU A;  3GPC A;  2Y4O A;  3GR1 A;  3AF6 A;  5T8S A;  2YCB A;  4OYC A;  5A1I A;  1LQL A;  1P7L A;  3EER A;  4RM2 A;  3LAX A;  2E5L C;  4NOZ A;  3SO4 A;  2YWC A;  2D1T A;  3R44 A;  5LMN C;  5BUR A;  4YY3 C;  2BH1 X;  5KYV A;  4G37 A;  1AMU A;  2D1Q A;  4X65 C;  5BSW A;  5ADZ A;  4GKK C;  4BC9 A;  4KTT A;  4ODJ A;  4U5Y D;  4RM3 A;  4K0B A;  1XMO C;  3DLP X;  2ATW A;  5BSV A;  3UOW A;  4JI7 C;  1MKY A;  3R9W A;  1QM4 A;  3DHV A;  3NPD A;  2P2J A;  5T8T A;  3N54 B;  2BJO A;  2P2F A;  4KHP C;  4DUZ C;  4JI0 C;  4EAT A;  4OXI A;  2JMP A;  4DR7 C;  4LFB C;  1MD9 A;  4RVO A;  3EQ6 A;  1IBL C;  1O92 A;  3CW9 A;  5BSM A;  4JI2 C;  2E7G A;  4IR7 A;  3RV2 A;  4DCT A;  5A1G A;  4DV3 C;  3S82 A;  2DPL A;  4D4G A;  3N2Q A;  2Y27 A;  1HNX C;  5BSR A;  2E8F A;  4RLQ A;  4LF5 C;  5GTD A;  3VNS A;  3PRO C;  2Y4N A;  3LUS A;  4HPV A;  4DV0 C;  5BUS A;  2P20 A;  3H2T A;  1PG4 A;  1BA3 A;  1FUG A;  5H9U A;  1O93 A;  4DR5 C;  5BR8 C;  4PZP A;  4DR3 C;  4JI1 C;  5AE3 A;  4DG8 A;  1MXA A;  3IML A;  1V25 A;  4ISB A;  3A9V A;  4BBY A;  1HNW C;  2VZE A;  3TQI A;  4JI6 C;  4BCA A;  3TUF A;  2D27 A;  3PBK A;  1O90 A;  4DV5 C;  3ETC A;  3J80 D;  4D4I A;  4FUQ A;  2KZF A;  3UZ0 A;  2QL8 A;  4B3R C;  4RVN A;  3IEU A;  2VSQ A;  1ML8 A;  4DR1 C;  4JI8 C;  3A9U A;  2OPL B;  3ETO A;  2WD9 A;  1WF3 A;  1ULT A;  5BUQ A;  4I9G A;  5A19 A;  1PG3 A;  1IBK C;  3VNQ A;  3CW8 X;  5KEI A;  2XR1 A;  4DV6 C;  4DV7 C;  4TPS B;  4NDN A;  2P02 A;  1PA4 A;  4JM1 A;  1T5D X;  2D28 C;  4WS9 A;  4DV4 C;  1XMQ C;  2UUB C;  3IEV A;  1USP A;  2QVX X;  3GR0 A;  4JI5 C;  1VLA A;  5IFI A;  1HNZ C;  4D57 A;  4DCS A;  2UU9 C;  1NYE A;  4X64 C;  5JRH A;  4DR2 C;  3NYQ A;  2VQF C;  4YHH C;  4L7I A;  5LMU C;  1HH2 P;  2OBV A;  2F4V C;  3TDE A;  4DR4 C;  4NXN C;  4RLF A;  2ASB A;  4BC7 A;  4I9F A;  2UXB C;  5CZX A;  3KXW A;  2OPL A;  1JOS A;  1GPM A;  3I08 A;  1XRC A;  1FJG C;  2DYJ A;  4G1I A;  4IZ6 A;  5A2Q D;  4ZJZ A;  4PRO C;  4JV5 C;  3J81 D;  2D7V A;  1LCI A;  1K0R A;  5AE1 A;  5AE2 A;  2CXC A;  3RG2 A;  4LF8 C;  1UKK A;  5BSU A;  1XNQ C;  4DV2 C;  1O9T A;  1USP B;  3A4I A;  4B3T C;  4LF6 C;  4LE5 A;  4R1L A;  1N34 C;  1HR0 C;  2P2Q A;  2E8E A;  2V7B A;  3L95 X;  4KTV A;  1ZB9 A;  5IWA C;  1J5E C;  5K85 A;  3T1Y C;  4R1M A;  4GXR A;  1QWI A;  1WH9 A;  2QVY X;  1T5H X;  4AQY C;  4GKJ C;  3IPL A;  2D1S A;  3AF5 A;  2YWB A;  4OX9 C;  3J7A D;  3FCE A;  4DCU A;  1XRA A;  3FCC A;  2HHH C;  4DCV A;  4L2Z A;  1N2F A;  4WV3 A;  3B7W A;  2E8C A;  1XRB A;  1EGA A;  3I07 A;  2QW0 X;  4JI3 C;  4FUT A;  1KKG A;  4LF4 C;  1RG9 A;  3E7W A;  4PHT A;  4LF9 C;  3NYR A;  3JAM D;  4GXQ A;  3VNR A;  2AYA A;  1IBM C;  2PT7 G;  4LFC C;  4JYA C;  1N32 C;  2P2M A;  2P2B A;  3T1H C;  2PN2 A;  4B3S C;  3DAY A;  2HJG A;  2QVZ X;  3OTO C;  5BST A;  4DG9 A;  4MH4 A;  2CY1 A;  1L2F A;  3NI2 A;  2UXD C;  4BSZ A;  1MDB A;  3G7S A;  4X62 C;  4D56 A;  1MDF A;  4NXM C;  2UUA C;  3CJE A;  5DV9 A;  2ONF A;  4K0K C;  2PRO A;  1YJ7 A;  1N36 C;  5E7Q A;  2UXC C;  3LGX A;  4MTN A;  3LNV A;  1I94 C;  3R9X A;  4LF7 C;  4DV1 C;  3C5E A;  4JI4 C;  4DR6 C;  4XX2 A;  2E0G A;  5CZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...