1HNXC

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 40
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1hnxC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 1hnxC02
2XR1A 4LF8C 2YCBA 4LF9C 2UXBC 1ZB8A 4JI6C 3AF5A 4X66C 4BSZA 1N34C 1J5EC 3GKUA 4NXMC 1HH2P 2E8FA 2F4VC 1UKKA 1IBLC 4NOZA 2E7GA 2DYJA 4JI1C 3R9WA 2UUCC 4JI0C 4DCUA 4JV5C 3LUSA 5BR8C 2ONFA 5IT9D 4DCSA 4DV7C 4DCVA 4DR3C 1N33C 4LF5C 4DR2C 1XNQC 2ATWA 4JI8C 4JI5C 2PT7G 1N2FA 2VQEC 1XMOC 1N32C 1IBKC 2PN2A 2BJOA 5FLXD 4X62C 4LFCC 1MKYA 4DR5C 1I94C 3T1HC 1HNXC 1XMQC 2UXDC 2UU9C 4DR7C 1IBMC 4JI2C 4NXNC 2HJGA 4MTNA 1PA4A 1USPA 4DV6C 3T1YC 4GKJC 4DR6C 4DUZC 3J81D 4DV1C 2E5LC 1WF3A 2OPLA 5A2QD 4B3RC 4KHPC 4X64C 4YY3C 3I07A 2CY1A 3EERA 4DR1C 1LQLA 5IWAC 4JYAC 2CXCA 4DV2C 2JMPA 4DUYC 4OX9C 4MH4A 2ASBA 3IEUA 2ZM6C 3R9XA 4DR4C 4JI7C 4DCTA 4XX2A 1NYEA 3OTOC 2HHHC 4JI3C 4AQYC 3CJEA 3JAMD 2OPLB 4DV5C 4K0KC 4JI4C 5LMUC 4B3SC 1VLAA 2D7VA 5LMNC 1HR0C 2VQFC 4DV4C 4LFAC 4YHHC 3J80D 1L2FA 1JOSA 2KZFA 4LF6C 1FJGC 3J7AD 1ZB9A 1KKGA 1WH9A 1N36C 3IEVA 1USPB 1EGAA 1HNZC 4GKKC 1HNWC 1QWIA 2EGTA 4DV3C 4LF7C 1XNRC 2E8EA 2QL8A 1K0RA 2UUBC 2E8CA 4X65C 1ML8A 2UUAC 4B3TC 4DV0C 3AF6A 4LF4C 2UXCC 4LFBC 4B3MC
chains in the Genus database with same CATH superfamily
3DAYA 5BURA 2BH1X 5H9UA 2MMAB 2OBVA 2P20A 1ULTA 2CU6A 4G1IA 1ZB8A 1P4EA 4RLQA 2MCQA 1N34C 1J5EC 2OO4A 4L4QA 1MD9A 5BSWA 1UKKA 1IBLC 1P7LA 1MXCA 4OXIA 3ETCA 3LAXA 5AE1A 2ONFA 4DV7C 1N33C 4LF5C 4JI8C 2P2MA 1PG3A 4OYCA 3VNRA 2BJOA 4ISBA 3IPLA 4DR5C 1XMQC 2UXDC 1TH5A 4DR7C 4WS9A 1UWDA 2Y4OA 5A19A 2HJGA 5K85A 1USPA 4DV6C 4DR6C 3B7WA 2OPLA 3PROC 4X64C 4YY3C 3GPCA 4DR1C 4RVOA 4PUHA 3OTOC 4DV5C 5LMUC 1O9TA 3DLPX 5KYVA 4PHTA 4DV4C 5BUQA 2P2JA 5BSUA 1ZB9A 4RM3A 2P2QA 1KKGA 5GTDA 3LGXA 4ODJA 4GKKC 2QVZX 4LF7C 3FM7A 2E8EA 2M5HA 1M6XC 3N2QA 2WD9A 4EATA 2UXCC 4RMNA 2D28C 2XR1A 4I9FA 2YCBA 2UXBC 3AF5A 4U5YD 1XDXA 1VEHA 2D1SA 2M5OA 4BSZA 2VZEA 1O93A 1FUGA 4NXMC 4G36A 5IFIA 3VNQA 2E8FA 3PESA 3DHVA 2Z51A 4RM2A 4JI1C 2UUCC 4JI0C 3LUSA 5BR8C 5IT9D 1PU1A 4LE5A 3E7WA 3UX3A 3TDEA 4DR2C 3TUFA 2ATWA 4PZPA 3VNSA 2PT7G 1N2FA 2VQEC 2P2BA 3SO4A 2DHMA 1IBKC 1YJ7A 4X62C 1MKYA 3G7SA 3LNVA 1I94C 3T1HC 5A1IA 2DPLA 4BC9A 3GR1A 4PROC 1IBMC 4R1LA 3LNOA 4R0MA 2P2FA 3KXWA 4GKJC 3UZ0A 3O2EA 5A2QD 3NYQA 4KHPC 1O90A 1M6XA 1LQLA 5IWAC 4JYAC 1XRCA 4DG8A 4DV2C 4OX9C 2ASBA 4DR4C 4XX2A 4AQYC 3CJEA 3JAMD 4NDNA 2D1QA 3NYRA 1BA3A 3A25A 3CQ2A 4BBYA 4D56A 4KTVA 1GPMA 3R44A 4YHHC 4TPSB 2AYAA 2PROA 1JOSA 5BUSA 1XRBA 2KZFA 1MDFA 4PUIA 1N36C 3IEVA 1YGTA 3H2TA 4ZJZA 1HNWC 2EGTA 5CZXA 1XNRC 1XS3A 1K0RA 2QW0X 2UUBC 2E8CA 4B3TC 1ML8A 4GXQA 4LF4C 3A9UA 4G37A 3CQ1A 3CQ3A 5AE3A 4LF8C 3NI2A 5BSTA 4LF9C 1XRAA 4JI6C 4X66C 5T8TA 3GKUA 2E0GA 1HH2P 2F4VC 3N54B 4NOZA 3L95X 3A26A 4FUQA 2YWBA 2E7GA 1WCJA 5LCIA 2DYJA 4JV5C 4DCUA 1O92A 4DCVA 1XNQC 1LCIA 3NPDA 4D57A 3TR3A 2PN2A 3AY0A 4HPVA 5FLXD 4KTTA 3A9VA 1HNXC 4WV3A 4JI2C 3C5EA 4NXNC 2P02A 5E7QA 4MTNA 1PA4A 3T1YC 1RG9A 2D1TA 4FTFA 2NCLA 2QVYX 3UEBA 4B3RC 5CZVA 5A1GA 3GR0A 2WP0C 1T5DX 5BSVA 3EERA 2JMPA 5BSRA 2ZM6C 3R9XA 4JI7C 4DCTA 2Y4NA 2OPLB 3E7XA 4JI4C 4B3SC 1VLAA 1HR0C 5LMNC 2PG1E 3FCEA 2ZZNA 4IZ6A 2ZTBA 4LFAC 4IR7A 2V7BA 4PUGA 2D27A 1L2FA 1V26A 3CW8X 3J7AD 1NY8A 5AE2A 5KEIA 1FLOA 1WH9A 1EGAA 4R1MA 1RY2A 2Y27A 1QWIA 1MXBA 4DV3C 2JNVA 4D4GA 2ZZMA 2KZ0A 4DV0C 4LFBC 4B3MC 4ZLPA 2QVXX 4K0BA 4RVNA 1MDBA 4GXRA 1IB8A 3IMLA 3I08A 1V60A 3R9WA 4DCSA 3TQIA 4DR3C 4L2ZA 4BCAA 5KYTA 4JI5C 3CW9A 1XMOC 1N32C 3UOWA 4L7IA 4LFCC 4I9GA 2UU9C 3PBKA 3A4IA 1P4EC 4DUZC 2D1RA 4FUTA 3J81D 4DV1C 3S82A 2E5LC 1WF3A 5DV9A 4BC7A 1MXAA 3I07A 3RV2A 2CY1A 3ETOA 4D4IA 2CXCA 3L8CA 5ADZA 1PG4A 2MM9A 4DUYC 4MH4A 5JRHA 3IEUA 4JM1A 2YWCA 1NYEA 2HHHC 4JI3C 4K0KC 4GS5A 2D7VA 1AMUA 2VQFC 3FCCA 3UX2A 3EQ6A 3J80D 5BSMA 2YX1A 1V25A 4LF6C 1FJGC 4RLFA 1XHJA 3K6RA 1USPB 1QM4A 5K8FA 1HNZC 2VSQA 3RG2A 2QL8A 5T8SA 1T5HX 4DG9A 2UUAC 4X65C 3AF6A 2KDNA
chains in the Genus database with same CATH topology
3DAYA 5BURA 2BH1X 5H9UA 2P20A 2OBVA 1ULTA 4G1IA 1ZB8A 4RLQA 1N34C 1J5EC 2OO4A 4L4QA 1MD9A 5BSWA 1UKKA 1IBLC 1P7LA 1MXCA 4OXIA 3ETCA 3LAXA 5AE1A 2ONFA 4DV7C 1N33C 4LF5C 4JI8C 2P2MA 1PG3A 4OYCA 3VNRA 2BJOA 4ISBA 3IPLA 4DR5C 1XMQC 2UXDC 4DR7C 4WS9A 2Y4OA 5A19A 2HJGA 5K85A 1USPA 4DV6C 4DR6C 3B7WA 2OPLA 3PROC 4X64C 4YY3C 3GPCA 4DR1C 4RVOA 3OTOC 4DV5C 5LMUC 1O9TA 3DLPX 5KYVA 4PHTA 4DV4C 5BUQA 2P2JA 5BSUA 1ZB9A 4RM3A 2P2QA 1KKGA 5GTDA 3LGXA 4ODJA 4GKKC 2QVZX 4LF7C 2E8EA 3N2QA 2WD9A 4EATA 2UXCC 4RMNA 2D28C 2XR1A 4I9FA 2YCBA 2UXBC 3AF5A 4U5YD 2D1SA 4BSZA 2VZEA 1O93A 1FUGA 4NXMC 4G36A 5IFIA 3VNQA 2E8FA 3PESA 3DHVA 4RM2A 4JI1C 2UUCC 4JI0C 3LUSA 5BR8C 5IT9D 4LE5A 3E7WA 3TDEA 4DR2C 3TUFA 2ATWA 4PZPA 3VNSA 2PT7G 1N2FA 2VQEC 2P2BA 3SO4A 1IBKC 1YJ7A 4X62C 1MKYA 3G7SA 3LNVA 1I94C 3T1HC 5A1IA 2DPLA 4BC9A 3GR1A 4PROC 1IBMC 4R1LA 4R0MA 2P2FA 3KXWA 4GKJC 3UZ0A 5A2QD 3NYQA 4KHPC 1O90A 1LQLA 5IWAC 4JYAC 1XRCA 4DG8A 4DV2C 4OX9C 2ASBA 4DR4C 4XX2A 4AQYC 3CJEA 3JAMD 4NDNA 2D1QA 3NYRA 1BA3A 4BBYA 4D56A 4KTVA 1GPMA 3R44A 4YHHC 4TPSB 2AYAA 2PROA 1JOSA 5BUSA 1XRBA 2KZFA 1MDFA 1N36C 3IEVA 3H2TA 4ZJZA 1HNWC 2EGTA 5CZXA 1XNRC 1K0RA 2QW0X 2UUBC 2E8CA 4B3TC 1ML8A 4GXQA 4LF4C 3A9UA 4G37A 5AE3A 4LF8C 3NI2A 5BSTA 4LF9C 1XRAA 4JI6C 4X66C 5T8TA 3GKUA 2E0GA 1HH2P 2F4VC 3N54B 4NOZA 3L95X 4FUQA 2YWBA 2E7GA 2DYJA 4JV5C 4DCUA 1O92A 4DCVA 1XNQC 1LCIA 3NPDA 4D57A 2PN2A 4HPVA 5FLXD 4KTTA 3A9VA 1HNXC 4WV3A 4JI2C 3C5EA 4NXNC 2P02A 5E7QA 4MTNA 1PA4A 3T1YC 1RG9A 2D1TA 4FTFA 2QVYX 4B3RC 5CZVA 5A1GA 3GR0A 2WP0C 1T5DX 5BSVA 3EERA 2JMPA 5BSRA 2ZM6C 3R9XA 4JI7C 4DCTA 2Y4NA 2OPLB 3E7XA 4JI4C 4B3SC 1VLAA 1HR0C 5LMNC 3FCEA 4IZ6A 4LFAC 4IR7A 2V7BA 2D27A 1L2FA 1V26A 3CW8X 3J7AD 5AE2A 5KEIA 1WH9A 1EGAA 4R1MA 1RY2A 2Y27A 1QWIA 1MXBA 4DV3C 4D4GA 4DV0C 4LFBC 4B3MC 4ZLPA 2QVXX 4K0BA 4RVNA 1MDBA 4GXRA 3IMLA 3I08A 3R9WA 4DCSA 3TQIA 4DR3C 4L2ZA 4BCAA 5KYTA 4JI5C 3CW9A 1XMOC 1N32C 3UOWA 4L7IA 4LFCC 4I9GA 2UU9C 3PBKA 3A4IA 4DUZC 2D1RA 4FUTA 3J81D 4DV1C 3S82A 2E5LC 1WF3A 5DV9A 4BC7A 1MXAA 3I07A 3RV2A 2CY1A 3ETOA 4D4IA 2CXCA 3L8CA 5ADZA 1PG4A 4DUYC 4MH4A 5JRHA 3IEUA 4JM1A 2YWCA 1NYEA 2HHHC 4JI3C 4K0KC 4GS5A 2D7VA 1AMUA 2VQFC 3FCCA 3EQ6A 3J80D 5BSMA 1V25A 4LF6C 1FJGC 4RLFA 1USPB 1QM4A 5K8FA 1HNZC 2VSQA 3RG2A 2QL8A 5T8SA 1T5HX 4DG9A 2UUAC 4X65C 3AF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  4LF8 C;  2YCB A;  4LF9 C;  2UXB C;  1ZB8 A;  4JI6 C;  3AF5 A;  4X66 C;  4BSZ A;  1N34 C;  1J5E C;  3GKU A;  4NXM C;  1HH2 P;  2E8F A;  2F4V C;  1UKK A;  1IBL C;  4NOZ A;  2E7G A;  2DYJ A;  4JI1 C;  3R9W A;  2UUC C;  4JI0 C;  4DCU A;  4JV5 C;  3LUS A;  5BR8 C;  2ONF A;  5IT9 D;  4DCS A;  4DV7 C;  4DCV A;  4DR3 C;  1N33 C;  4LF5 C;  4DR2 C;  1XNQ C;  2ATW A;  4JI8 C;  4JI5 C;  2PT7 G;  1N2F A;  2VQE C;  1XMO C;  1N32 C;  1IBK C;  2PN2 A;  2BJO A;  5FLX D;  4X62 C;  4LFC C;  1MKY A;  4DR5 C;  1I94 C;  3T1H C;  1HNX C;  1XMQ C;  2UXD C;  2UU9 C;  4DR7 C;  1IBM C;  4JI2 C;  4NXN C;  2HJG A;  4MTN A;  1PA4 A;  1USP A;  4DV6 C;  3T1Y C;  4GKJ C;  4DR6 C;  4DUZ C;  3J81 D;  4DV1 C;  2E5L C;  1WF3 A;  2OPL A;  5A2Q D;  4B3R C;  4KHP C;  4X64 C;  4YY3 C;  3I07 A;  2CY1 A;  3EER A;  4DR1 C;  1LQL A;  5IWA C;  4JYA C;  2CXC A;  4DV2 C;  2JMP A;  4DUY C;  4OX9 C;  4MH4 A;  2ASB A;  3IEU A;  2ZM6 C;  3R9X A;  4DR4 C;  4JI7 C;  4DCT A;  4XX2 A;  1NYE A;  3OTO C;  2HHH C;  4JI3 C;  4AQY C;  3CJE A;  3JAM D;  2OPL B;  4DV5 C;  4K0K C;  4JI4 C;  5LMU C;  4B3S C;  1VLA A;  2D7V A;  5LMN C;  1HR0 C;  2VQF C;  4DV4 C;  4LFA C;  4YHH C;  3J80 D;  1L2F A;  1JOS A;  2KZF A;  4LF6 C;  1FJG C;  3J7A D;  1ZB9 A;  1KKG A;  1WH9 A;  1N36 C;  3IEV A;  1USP B;  1EGA A;  1HNZ C;  4GKK C;  1HNW C;  1QWI A;  2EGT A;  4DV3 C;  4LF7 C;  1XNR C;  2E8E A;  2QL8 A;  1K0R A;  2UUB C;  2E8C A;  4X65 C;  1ML8 A;  2UUA C;  4B3T C;  4DV0 C;  3AF6 A;  4LF4 C;  2UXC C;  4LFB C;  4B3M C; 
#chains in the Genus database with same CATH topology
 3DAY A;  5BUR A;  2BH1 X;  5H9U A;  2MMA B;  2OBV A;  2P20 A;  1ULT A;  2CU6 A;  4G1I A;  1ZB8 A;  1P4E A;  4RLQ A;  2MCQ A;  1N34 C;  1J5E C;  2OO4 A;  4L4Q A;  1MD9 A;  5BSW A;  1UKK A;  1IBL C;  1P7L A;  1MXC A;  4OXI A;  3ETC A;  3LAX A;  5AE1 A;  2ONF A;  4DV7 C;  1N33 C;  4LF5 C;  4JI8 C;  2P2M A;  1PG3 A;  4OYC A;  3VNR A;  2BJO A;  4ISB A;  3IPL A;  4DR5 C;  1XMQ C;  2UXD C;  1TH5 A;  4DR7 C;  4WS9 A;  1UWD A;  2Y4O A;  5A19 A;  2HJG A;  5K85 A;  1USP A;  4DV6 C;  4DR6 C;  3B7W A;  2OPL A;  3PRO C;  4X64 C;  4YY3 C;  3GPC A;  4DR1 C;  4RVO A;  4PUH A;  3OTO C;  4DV5 C;  5LMU C;  1O9T A;  3DLP X;  5KYV A;  4PHT A;  4DV4 C;  5BUQ A;  2P2J A;  5BSU A;  1ZB9 A;  4RM3 A;  2P2Q A;  1KKG A;  5GTD A;  3LGX A;  4ODJ A;  4GKK C;  2QVZ X;  4LF7 C;  3FM7 A;  2E8E A;  2M5H A;  1M6X C;  3N2Q A;  2WD9 A;  4EAT A;  2UXC C;  4RMN A;  2D28 C;  2XR1 A;  4I9F A;  2YCB A;  2UXB C;  3AF5 A;  4U5Y D;  1XDX A;  1VEH A;  2D1S A;  2M5O A;  4BSZ A;  2VZE A;  1O93 A;  1FUG A;  4NXM C;  4G36 A;  5IFI A;  3VNQ A;  2E8F A;  3PES A;  3DHV A;  2Z51 A;  4RM2 A;  4JI1 C;  2UUC C;  4JI0 C;  3LUS A;  5BR8 C;  5IT9 D;  1PU1 A;  4LE5 A;  3E7W A;  3UX3 A;  3TDE A;  4DR2 C;  3TUF A;  2ATW A;  4PZP A;  3VNS A;  2PT7 G;  1N2F A;  2VQE C;  2P2B A;  3SO4 A;  2DHM A;  1IBK C;  1YJ7 A;  4X62 C;  1MKY A;  3G7S A;  3LNV A;  1I94 C;  3T1H C;  5A1I A;  2DPL A;  4BC9 A;  3GR1 A;  4PRO C;  1IBM C;  4R1L A;  3LNO A;  4R0M A;  2P2F A;  3KXW A;  4GKJ C;  3UZ0 A;  3O2E A;  5A2Q D;  3NYQ A;  4KHP C;  1O90 A;  1M6X A;  1LQL A;  5IWA C;  4JYA C;  1XRC A;  4DG8 A;  4DV2 C;  4OX9 C;  2ASB A;  4DR4 C;  4XX2 A;  4AQY C;  3CJE A;  3JAM D;  4NDN A;  2D1Q A;  3NYR A;  1BA3 A;  3A25 A;  3CQ2 A;  4BBY A;  4D56 A;  4KTV A;  1GPM A;  3R44 A;  4YHH C;  4TPS B;  2AYA A;  2PRO A;  1JOS A;  5BUS A;  1XRB A;  2KZF A;  1MDF A;  4PUI A;  1N36 C;  3IEV A;  1YGT A;  3H2T A;  4ZJZ A;  1HNW C;  2EGT A;  5CZX A;  1XNR C;  1XS3 A;  1K0R A;  2QW0 X;  2UUB C;  2E8C A;  4B3T C;  1ML8 A;  4GXQ A;  4LF4 C;  3A9U A;  4G37 A;  3CQ1 A;  3CQ3 A;  5AE3 A;  4LF8 C;  3NI2 A;  5BST A;  4LF9 C;  1XRA A;  4JI6 C;  4X66 C;  5T8T A;  3GKU A;  2E0G A;  1HH2 P;  2F4V C;  3N54 B;  4NOZ A;  3L95 X;  3A26 A;  4FUQ A;  2YWB A;  2E7G A;  1WCJ A;  5LCI A;  2DYJ A;  4JV5 C;  4DCU A;  1O92 A;  4DCV A;  1XNQ C;  1LCI A;  3NPD A;  4D57 A;  3TR3 A;  2PN2 A;  3AY0 A;  4HPV A;  5FLX D;  4KTT A;  3A9V A;  1HNX C;  4WV3 A;  4JI2 C;  3C5E A;  4NXN C;  2P02 A;  5E7Q A;  4MTN A;  1PA4 A;  3T1Y C;  1RG9 A;  2D1T A;  4FTF A;  2NCL A;  2QVY X;  3UEB A;  4B3R C;  5CZV A;  5A1G A;  3GR0 A;  2WP0 C;  1T5D X;  5BSV A;  3EER A;  2JMP A;  5BSR A;  2ZM6 C;  3R9X A;  4JI7 C;  4DCT A;  2Y4N A;  2OPL B;  3E7X A;  4JI4 C;  4B3S C;  1VLA A;  1HR0 C;  5LMN C;  2PG1 E;  3FCE A;  2ZZN A;  4IZ6 A;  2ZTB A;  4LFA C;  4IR7 A;  2V7B A;  4PUG A;  2D27 A;  1L2F A;  1V26 A;  3CW8 X;  3J7A D;  1NY8 A;  5AE2 A;  5KEI A;  1FLO A;  1WH9 A;  1EGA A;  4R1M A;  1RY2 A;  2Y27 A;  1QWI A;  1MXB A;  4DV3 C;  2JNV A;  4D4G A;  2ZZM A;  2KZ0 A;  4DV0 C;  4LFB C;  4B3M C;  4ZLP A;  2QVX X;  4K0B A;  4RVN A;  1MDB A;  4GXR A;  1IB8 A;  3IML A;  3I08 A;  1V60 A;  3R9W A;  4DCS A;  3TQI A;  4DR3 C;  4L2Z A;  4BCA A;  5KYT A;  4JI5 C;  3CW9 A;  1XMO C;  1N32 C;  3UOW A;  4L7I A;  4LFC C;  4I9G A;  2UU9 C;  3PBK A;  3A4I A;  1P4E C;  4DUZ C;  2D1R A;  4FUT A;  3J81 D;  4DV1 C;  3S82 A;  2E5L C;  1WF3 A;  5DV9 A;  4BC7 A;  1MXA A;  3I07 A;  3RV2 A;  2CY1 A;  3ETO A;  4D4I A;  2CXC A;  3L8C A;  5ADZ A;  1PG4 A;  2MM9 A;  4DUY C;  4MH4 A;  5JRH A;  3IEU A;  4JM1 A;  2YWC A;  1NYE A;  2HHH C;  4JI3 C;  4K0K C;  4GS5 A;  2D7V A;  1AMU A;  2VQF C;  3FCC A;  3UX2 A;  3EQ6 A;  3J80 D;  5BSM A;  2YX1 A;  1V25 A;  4LF6 C;  1FJG C;  4RLF A;  1XHJ A;  3K6R A;  1USP B;  1QM4 A;  5K8F A;  1HNZ C;  2VSQ A;  3RG2 A;  2QL8 A;  5T8S A;  1T5H X;  4DG9 A;  2UUA C;  4X65 C;  3AF6 A;  2KDN A; 
#chains in the Genus database with same CATH homology
 3DAY A;  5BUR A;  2BH1 X;  5H9U A;  2P20 A;  2OBV A;  1ULT A;  4G1I A;  1ZB8 A;  4RLQ A;  1N34 C;  1J5E C;  2OO4 A;  4L4Q A;  1MD9 A;  5BSW A;  1UKK A;  1IBL C;  1P7L A;  1MXC A;  4OXI A;  3ETC A;  3LAX A;  5AE1 A;  2ONF A;  4DV7 C;  1N33 C;  4LF5 C;  4JI8 C;  2P2M A;  1PG3 A;  4OYC A;  3VNR A;  2BJO A;  4ISB A;  3IPL A;  4DR5 C;  1XMQ C;  2UXD C;  4DR7 C;  4WS9 A;  2Y4O A;  5A19 A;  2HJG A;  5K85 A;  1USP A;  4DV6 C;  4DR6 C;  3B7W A;  2OPL A;  3PRO C;  4X64 C;  4YY3 C;  3GPC A;  4DR1 C;  4RVO A;  3OTO C;  4DV5 C;  5LMU C;  1O9T A;  3DLP X;  5KYV A;  4PHT A;  4DV4 C;  5BUQ A;  2P2J A;  5BSU A;  1ZB9 A;  4RM3 A;  2P2Q A;  1KKG A;  5GTD A;  3LGX A;  4ODJ A;  4GKK C;  2QVZ X;  4LF7 C;  2E8E A;  3N2Q A;  2WD9 A;  4EAT A;  2UXC C;  4RMN A;  2D28 C;  2XR1 A;  4I9F A;  2YCB A;  2UXB C;  3AF5 A;  4U5Y D;  2D1S A;  4BSZ A;  2VZE A;  1O93 A;  1FUG A;  4NXM C;  4G36 A;  5IFI A;  3VNQ A;  2E8F A;  3PES A;  3DHV A;  4RM2 A;  4JI1 C;  2UUC C;  4JI0 C;  3LUS A;  5BR8 C;  5IT9 D;  4LE5 A;  3E7W A;  3TDE A;  4DR2 C;  3TUF A;  2ATW A;  4PZP A;  3VNS A;  2PT7 G;  1N2F A;  2VQE C;  2P2B A;  3SO4 A;  1IBK C;  1YJ7 A;  4X62 C;  1MKY A;  3G7S A;  3LNV A;  1I94 C;  3T1H C;  5A1I A;  2DPL A;  4BC9 A;  3GR1 A;  4PRO C;  1IBM C;  4R1L A;  4R0M A;  2P2F A;  3KXW A;  4GKJ C;  3UZ0 A;  5A2Q D;  3NYQ A;  4KHP C;  1O90 A;  1LQL A;  5IWA C;  4JYA C;  1XRC A;  4DG8 A;  4DV2 C;  4OX9 C;  2ASB A;  4DR4 C;  4XX2 A;  4AQY C;  3CJE A;  3JAM D;  4NDN A;  2D1Q A;  3NYR A;  1BA3 A;  4BBY A;  4D56 A;  4KTV A;  1GPM A;  3R44 A;  4YHH C;  4TPS B;  2AYA A;  2PRO A;  1JOS A;  5BUS A;  1XRB A;  2KZF A;  1MDF A;  1N36 C;  3IEV A;  3H2T A;  4ZJZ A;  1HNW C;  2EGT A;  5CZX A;  1XNR C;  1K0R A;  2QW0 X;  2UUB C;  2E8C A;  4B3T C;  1ML8 A;  4GXQ A;  4LF4 C;  3A9U A;  4G37 A;  5AE3 A;  4LF8 C;  3NI2 A;  5BST A;  4LF9 C;  1XRA A;  4JI6 C;  4X66 C;  5T8T A;  3GKU A;  2E0G A;  1HH2 P;  2F4V C;  3N54 B;  4NOZ A;  3L95 X;  4FUQ A;  2YWB A;  2E7G A;  2DYJ A;  4JV5 C;  4DCU A;  1O92 A;  4DCV A;  1XNQ C;  1LCI A;  3NPD A;  4D57 A;  2PN2 A;  4HPV A;  5FLX D;  4KTT A;  3A9V A;  1HNX C;  4WV3 A;  4JI2 C;  3C5E A;  4NXN C;  2P02 A;  5E7Q A;  4MTN A;  1PA4 A;  3T1Y C;  1RG9 A;  2D1T A;  4FTF A;  2QVY X;  4B3R C;  5CZV A;  5A1G A;  3GR0 A;  2WP0 C;  1T5D X;  5BSV A;  3EER A;  2JMP A;  5BSR A;  2ZM6 C;  3R9X A;  4JI7 C;  4DCT A;  2Y4N A;  2OPL B;  3E7X A;  4JI4 C;  4B3S C;  1VLA A;  1HR0 C;  5LMN C;  3FCE A;  4IZ6 A;  4LFA C;  4IR7 A;  2V7B A;  2D27 A;  1L2F A;  1V26 A;  3CW8 X;  3J7A D;  5AE2 A;  5KEI A;  1WH9 A;  1EGA A;  4R1M A;  1RY2 A;  2Y27 A;  1QWI A;  1MXB A;  4DV3 C;  4D4G A;  4DV0 C;  4LFB C;  4B3M C;  4ZLP A;  2QVX X;  4K0B A;  4RVN A;  1MDB A;  4GXR A;  3IML A;  3I08 A;  3R9W A;  4DCS A;  3TQI A;  4DR3 C;  4L2Z A;  4BCA A;  5KYT A;  4JI5 C;  3CW9 A;  1XMO C;  1N32 C;  3UOW A;  4L7I A;  4LFC C;  4I9G A;  2UU9 C;  3PBK A;  3A4I A;  4DUZ C;  2D1R A;  4FUT A;  3J81 D;  4DV1 C;  3S82 A;  2E5L C;  1WF3 A;  5DV9 A;  4BC7 A;  1MXA A;  3I07 A;  3RV2 A;  2CY1 A;  3ETO A;  4D4I A;  2CXC A;  3L8C A;  5ADZ A;  1PG4 A;  4DUY C;  4MH4 A;  5JRH A;  3IEU A;  4JM1 A;  2YWC A;  1NYE A;  2HHH C;  4JI3 C;  4K0K C;  4GS5 A;  2D7V A;  1AMU A;  2VQF C;  3FCC A;  3EQ6 A;  3J80 D;  5BSM A;  1V25 A;  4LF6 C;  1FJG C;  4RLF A;  1USP B;  1QM4 A;  5K8F A;  1HNZ C;  2VSQ A;  3RG2 A;  2QL8 A;  5T8S A;  1T5H X;  4DG9 A;  2UUA C;  4X65 C;  3AF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...