5IWAC

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
b'GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 55
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5iwaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5iwaC02
4DV0C 4OX9C 1QWIA 4X64C 4B3TC 2D7VA 4GKKC 2ONFA 4JI0C 1NYEA 4NOZA 2E8CA 5LMNC 1IBLC 1XNQC 4DR6C 2E7GA 4DCSA 4NXMC 2EGTA 4LF6C 4DCVA 1XNRC 4YHHC 1IBMC 4JI2C 3IEVA 4LFBC 1KKGA 1EGAA 2UXDC 4LF5C 2E5LC 4KHPC 3J81D 2VQFC 3T1YC 1USPA 2ASBA 1PA4A 4LF9C 1UKKA 1WF3A 4DR7C 3T1HC 4MH4A 3AF6A 1I94C 4K0KC 4LFCC 4B3RC 4B3MC 1HR0C 2UUAC 3AF5A 4JYAC 1LQLA 1N2FA 4JI1C 4DR4C 1VLAA 2OPLA 4DR1C 2YCBA 4JI6C 3LUSA 1HNZC 2JMPA 4GKJC 4X66C 1ML8A 1N33C 1ZB9A 1N36C 4DV6C 4DR2C 5FLXD 1HH2P 1USPB 4LF4C 2HJGA 3R9WA 1XMQC 2PN2A 2ZM6C 1JOSA 4LF7C 4AQYC 2E8EA 3OTOC 4JI4C 1HNWC 1L2FA 2QL8A 4YY3C 4JI7C 1N32C 3EERA 5A2QD 4BSZA 2VQEC 2OPLB 3J80D 4X65C 3I07A 4DCUA 4NXNC 4B3SC 2UXBC 2HHHC 2UUBC 1HNXC 2F4VC 4DV2C 2ATWA 4DR3C 3CJEA 2BJOA 1ZB8A 2DYJA 4LFAC 2E8FA 4DUZC 4LF8C 3JAMD 5BR8C 2UUCC 3GKUA 4DV1C 1N34C 1IBKC 4DV3C 2UU9C 2KZFA 2UXCC 4DV5C 2XR1A 4JI8C 2PT7G 5LMUC 3R9XA 1WH9A 2CXCA 5IWAC 3IEUA 4XX2A 4X62C 4DUYC 4DV4C 1J5EC 1FJGC 4MTNA 4JI3C 5IT9D 4JI5C 4JV5C 1K0RA 2CY1A 3J7AD 1MKYA 4DR5C 4DV7C 4DCTA 1XMOC
chains in the Genus database with same CATH superfamily
2P20A 2D1RA 4G36A 5A19A 3UEBA 2DHMA 3A9UA 2ONFA 3H2TA 1NYEA 1V25A 2E8CA 5LMNC 1XNQC 4FUQA 4GXRA 3NI2A 3G7SA 4DCSA 4I9GA 4DCVA 1FLOA 4LFBC 1KKGA 3NPDA 2E5LC 3A25A 2MCQA 3J81D 5H9UA 4LE5A 2WP0C 2AYAA 2D28C 3AF6A 4LFCC 2P02A 1XRAA 3LGXA 2OO4A 2P2QA 4L7IA 1ULTA 2YWBA 3PESA 3LUSA 2JMPA 2KZ0A 3O2EA 2P2BA 5A1GA 1N36C 4R1MA 2V7BA 5FLXD 3R9WA 2Y4OA 4I9FA 1JOSA 1P7LA 1L2FA 5BSMA 1P4EC 4R1LA 5A2QD 3FCCA 2VQEC 3PROC 2MM9A 3A26A 4K0BA 5BSWA 5LCIA 1GPMA 5CZVA 5KYTA 2ATWA 4PUGA 3VNQA 2DYJA 4DUZC 5CZXA 3UZ0A 1XRCA 3JAMD 4RLFA 3CQ1A 4DV3C 2XR1A 2CU6A 3R9XA 5BSVA 4WS9A 1MXCA 4XX2A 1T5DX 2E0GA 4JI3C 3LNOA 4PUHA 5IT9D 5AE3A 4G37A 4DR5C 4GXQA 4DCTA 4DV0C 3E7XA 3PBKA 4U5YD 4NOZA 4IZ6A 1IBLC 1XRBA 3SO4A 1M6XA 2BH1X 2ZZNA 5ADZA 4NXMC 5E7QA 5BSTA 5KEIA 3N54B 2PROA 1PG4A 2NCLA 3UX3A 1XDXA 3TUFA 1V60A 3S82A 1USPA 2P2FA 3RV2A 2ZTBA 3E7WA 4FTFA 3T1HC 4ZJZA 1I94C 4K0KC 5T8SA 4ISBA 5K85A 3ETCA 4DR4C 4IR7A 2VZEA 3DAYA 4BC9A 2OPLA 4EATA 4L2ZA 4JI6C 1MXAA 1V26A 2OBVA 4X66C 2P2JA 1HH2P 1O92A 5BSUA 1VEHA 2ZM6C 4BC7A 5K8FA 4LF7C 2E8EA 4PUIA 3OTOC 2YX1A 4YY3C 4JI7C 3GR1A 4L4QA 1RG9A 1YGTA 4B3SC 2UXBC 3DLPX 3CW9A 5A1IA 1WCJA 1XS3A 2D1QA 2BJOA 1ZB8A 3EQ6A 2M5HA 3CW8X 5BR8C 2UUCC 4KTTA 1N34C 2MMAB 1IBKC 4G1IA 3LNVA 2UXCC 2KZFA 4JI8C 1YJ7A 4RVNA 2PT7G 5BUSA 4DG9A 5LMUC 4ZLPA 4RM3A 5IWAC 1J5EC 4X62C 1FJGC 4HPVA 4KTVA 3J7AD 1MKYA 3RG2A 4DV7C 5KYVA 3UX2A 1QWIA 4B3TC 1AMUA 2D7VA 4OXIA 4GKKC 4R0MA 1UWDA 4PHTA 2D1TA 2QVYX 1BA3A 5BUQA 3I08A 1P4EA 5T8TA 4GS5A 4LF6C 3DHVA 1XNRC 2QVXX 4JI2C 3A4IA 2UXDC 4LF5C 4KHPC 2KDNA 3TQIA 2VQFC 3T1YC 2ASBA 3N2QA 4MH4A 1MDBA 4WV3A 4B3MC 2UUAC 4JYAC 4D56A 1N2FA 4OYCA 1LCIA 4RVOA 2YCBA 2QW0X 3ETOA 4GKJC 3AY0A 2Z51A 1N33C 4DG8A 4DV6C 4DR2C 5AE2A 1IB8A 2PN2A 1MDFA 2JNVA 4NDNA 1QM4A 4AQYC 4JI4C 1XHJA 1HNWC 1O90A 2QL8A 3NYRA 3J80D 5AE1A 4NXNC 3B7WA 2HHHC 5IFIA 2UUBC 2F4VC 4D57A 3LAXA 4RMNA 3CJEA 4PZPA 4LFAC 3A9VA 2QVZX 4DV1C 2Y4NA 2UU9C 4DV5C 3FCEA 1WH9A 3FM7A 5GTDA 2M5OA 3CQ2A 3KXWA 5BSRA 4D4GA 4JV5C 4DR1C 1XMOC 3GR0A 4OX9C 3L8CA 4X64C 4JI0C 3CQ3A 2DPLA 2WD9A 1O93A 4DR6C 2E7GA 4JM1A 2EGTA 4BCAA 3K6RA 3UOWA 4YHHC 1IBMC 2ZZMA 3IEVA 1EGAA 2Y27A 2YWCA 4RM2A 1PA4A 4LF9C 1UKKA 1WF3A 1TH5A 4DR7C 1NY8A 4B3RC 1HR0C 3AF5A 1LQLA 4JI1C 1O9TA 3NYQA 1VLAA 3VNRA 1HNZC 1T5HX 2VSQA 1ML8A 4ODJA 1ZB9A 1RY2A 5JRHA 2D1SA 2PG1E 1MD9A 1USPB 4LF4C 2HJGA 1XMQC 3C5EA 2D27A 3GPCA 1M6XC 1MXBA 3R44A 1FUGA 1N32C 3EERA 3TDEA 4BSZA 2OPLB 4X65C 3I07A 4DCUA 1HNXC 1PU1A 3L95X 4DV2C 1PG3A 2P2MA 4FUTA 4DR3C 2E8FA 4TPSB 4LF8C 3GKUA 4D4IA 3IPLA 3TR3A 3IMLA 3VNSA 4BBYA 2CXCA 4PROC 4RLQA 5DV9A 3IEUA 4DUYC 4DV4C 4MTNA 5BURA 4JI5C 1K0RA 2CY1A
chains in the Genus database with same CATH topology
2P20A 2D1RA 4G36A 5A19A 3A9UA 2ONFA 3H2TA 1NYEA 1V25A 2E8CA 5LMNC 1XNQC 4FUQA 4GXRA 3NI2A 3G7SA 4DCSA 4I9GA 4DCVA 4LFBC 1KKGA 3NPDA 2E5LC 3J81D 5H9UA 4LE5A 2WP0C 2AYAA 2D28C 3AF6A 4LFCC 2P02A 1XRAA 3LGXA 2OO4A 2P2QA 4L7IA 1ULTA 2YWBA 3PESA 3LUSA 2JMPA 2P2BA 5A1GA 1N36C 4R1MA 2V7BA 5FLXD 3R9WA 2Y4OA 4I9FA 1JOSA 1P7LA 1L2FA 5BSMA 4R1LA 5A2QD 3FCCA 2VQEC 3PROC 4K0BA 5BSWA 1GPMA 5CZVA 5KYTA 2ATWA 3VNQA 2DYJA 4DUZC 5CZXA 3UZ0A 1XRCA 3JAMD 4RLFA 4DV3C 2XR1A 3R9XA 5BSVA 4WS9A 1MXCA 4XX2A 1T5DX 2E0GA 4JI3C 5IT9D 5AE3A 4G37A 4DR5C 4GXQA 4DCTA 4DV0C 3E7XA 3PBKA 4U5YD 4NOZA 4IZ6A 1IBLC 1XRBA 3SO4A 2BH1X 5ADZA 4NXMC 5E7QA 5BSTA 5KEIA 3N54B 2PROA 1PG4A 3TUFA 3S82A 1USPA 2P2FA 3RV2A 3E7WA 4FTFA 3T1HC 4ZJZA 1I94C 4K0KC 5T8SA 4ISBA 5K85A 3ETCA 4DR4C 4IR7A 2VZEA 3DAYA 4BC9A 2OPLA 4EATA 4L2ZA 4JI6C 1MXAA 1V26A 2OBVA 4X66C 2P2JA 1HH2P 1O92A 5BSUA 2ZM6C 4BC7A 5K8FA 4LF7C 2E8EA 3OTOC 4YY3C 4JI7C 3GR1A 4L4QA 1RG9A 4B3SC 2UXBC 3DLPX 3CW9A 5A1IA 2D1QA 2BJOA 1ZB8A 3EQ6A 3CW8X 5BR8C 2UUCC 4KTTA 1N34C 1IBKC 4G1IA 3LNVA 2UXCC 2KZFA 4JI8C 1YJ7A 4RVNA 2PT7G 5BUSA 4DG9A 5LMUC 4ZLPA 4RM3A 5IWAC 1J5EC 4X62C 1FJGC 4HPVA 4KTVA 3J7AD 1MKYA 3RG2A 4DV7C 5KYVA 1QWIA 4B3TC 1AMUA 2D7VA 4OXIA 4GKKC 4R0MA 4PHTA 2D1TA 2QVYX 1BA3A 5BUQA 3I08A 5T8TA 4GS5A 4LF6C 3DHVA 1XNRC 2QVXX 4JI2C 3A4IA 2UXDC 4LF5C 4KHPC 3TQIA 2VQFC 3T1YC 2ASBA 3N2QA 4MH4A 1MDBA 4WV3A 4B3MC 2UUAC 4JYAC 4D56A 1N2FA 4OYCA 1LCIA 4RVOA 2YCBA 2QW0X 3ETOA 4GKJC 1N33C 4DG8A 4DV6C 4DR2C 5AE2A 2PN2A 1MDFA 4NDNA 1QM4A 4AQYC 4JI4C 1HNWC 1O90A 2QL8A 3NYRA 3J80D 5AE1A 4NXNC 3B7WA 2HHHC 5IFIA 2UUBC 2F4VC 4D57A 3LAXA 4RMNA 3CJEA 4PZPA 4LFAC 3A9VA 2QVZX 4DV1C 2Y4NA 2UU9C 4DV5C 3FCEA 1WH9A 5GTDA 3KXWA 5BSRA 4D4GA 4JV5C 4DR1C 1XMOC 3GR0A 4OX9C 3L8CA 4X64C 4JI0C 2DPLA 2WD9A 1O93A 4DR6C 2E7GA 4JM1A 2EGTA 4BCAA 3UOWA 4YHHC 1IBMC 3IEVA 1EGAA 2Y27A 2YWCA 4RM2A 1PA4A 4LF9C 1UKKA 1WF3A 4DR7C 4B3RC 1HR0C 3AF5A 1LQLA 4JI1C 1O9TA 3NYQA 1VLAA 3VNRA 1HNZC 1T5HX 2VSQA 1ML8A 4ODJA 1ZB9A 1RY2A 5JRHA 2D1SA 1MD9A 1USPB 4LF4C 2HJGA 1XMQC 3C5EA 2D27A 3GPCA 1MXBA 3R44A 1FUGA 1N32C 3EERA 3TDEA 4BSZA 2OPLB 4X65C 3I07A 4DCUA 1HNXC 3L95X 4DV2C 1PG3A 2P2MA 4FUTA 4DR3C 2E8FA 4TPSB 4LF8C 3GKUA 4D4IA 3IPLA 3IMLA 3VNSA 4BBYA 2CXCA 4PROC 4RLQA 5DV9A 3IEUA 4DUYC 4DV4C 4MTNA 5BURA 4JI5C 1K0RA 2CY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 C;  4OX9 C;  1QWI A;  4X64 C;  4B3T C;  2D7V A;  4GKK C;  2ONF A;  4JI0 C;  1NYE A;  4NOZ A;  2E8C A;  5LMN C;  1IBL C;  1XNQ C;  4DR6 C;  2E7G A;  4DCS A;  4NXM C;  2EGT A;  4LF6 C;  4DCV A;  1XNR C;  4YHH C;  1IBM C;  4JI2 C;  3IEV A;  4LFB C;  1KKG A;  1EGA A;  2UXD C;  4LF5 C;  2E5L C;  4KHP C;  3J81 D;  2VQF C;  3T1Y C;  1USP A;  2ASB A;  1PA4 A;  4LF9 C;  1UKK A;  1WF3 A;  4DR7 C;  3T1H C;  4MH4 A;  3AF6 A;  1I94 C;  4K0K C;  4LFC C;  4B3R C;  4B3M C;  1HR0 C;  2UUA C;  3AF5 A;  4JYA C;  1LQL A;  1N2F A;  4JI1 C;  4DR4 C;  1VLA A;  2OPL A;  4DR1 C;  2YCB A;  4JI6 C;  3LUS A;  1HNZ C;  2JMP A;  4GKJ C;  4X66 C;  1ML8 A;  1N33 C;  1ZB9 A;  1N36 C;  4DV6 C;  4DR2 C;  5FLX D;  1HH2 P;  1USP B;  4LF4 C;  2HJG A;  3R9W A;  1XMQ C;  2PN2 A;  2ZM6 C;  1JOS A;  4LF7 C;  4AQY C;  2E8E A;  3OTO C;  4JI4 C;  1HNW C;  1L2F A;  2QL8 A;  4YY3 C;  4JI7 C;  1N32 C;  3EER A;  5A2Q D;  4BSZ A;  2VQE C;  2OPL B;  3J80 D;  4X65 C;  3I07 A;  4DCU A;  4NXN C;  4B3S C;  2UXB C;  2HHH C;  2UUB C;  1HNX C;  2F4V C;  4DV2 C;  2ATW A;  4DR3 C;  3CJE A;  2BJO A;  1ZB8 A;  2DYJ A;  4LFA C;  2E8F A;  4DUZ C;  4LF8 C;  3JAM D;  5BR8 C;  2UUC C;  3GKU A;  4DV1 C;  1N34 C;  1IBK C;  4DV3 C;  2UU9 C;  2KZF A;  2UXC C;  4DV5 C;  2XR1 A;  4JI8 C;  2PT7 G;  5LMU C;  3R9X A;  1WH9 A;  2CXC A;  5IWA C;  3IEU A;  4XX2 A;  4X62 C;  4DUY C;  4DV4 C;  1J5E C;  1FJG C;  4MTN A;  4JI3 C;  5IT9 D;  4JI5 C;  4JV5 C;  1K0R A;  2CY1 A;  3J7A D;  1MKY A;  4DR5 C;  4DV7 C;  4DCT A;  1XMO C; 
#chains in the Genus database with same CATH topology
 2P20 A;  2D1R A;  4G36 A;  5A19 A;  3UEB A;  2DHM A;  3A9U A;  2ONF A;  3H2T A;  1NYE A;  1V25 A;  2E8C A;  5LMN C;  1XNQ C;  4FUQ A;  4GXR A;  3NI2 A;  3G7S A;  4DCS A;  4I9G A;  4DCV A;  1FLO A;  4LFB C;  1KKG A;  3NPD A;  2E5L C;  3A25 A;  2MCQ A;  3J81 D;  5H9U A;  4LE5 A;  2WP0 C;  2AYA A;  2D28 C;  3AF6 A;  4LFC C;  2P02 A;  1XRA A;  3LGX A;  2OO4 A;  2P2Q A;  4L7I A;  1ULT A;  2YWB A;  3PES A;  3LUS A;  2JMP A;  2KZ0 A;  3O2E A;  2P2B A;  5A1G A;  1N36 C;  4R1M A;  2V7B A;  5FLX D;  3R9W A;  2Y4O A;  4I9F A;  1JOS A;  1P7L A;  1L2F A;  5BSM A;  1P4E C;  4R1L A;  5A2Q D;  3FCC A;  2VQE C;  3PRO C;  2MM9 A;  3A26 A;  4K0B A;  5BSW A;  5LCI A;  1GPM A;  5CZV A;  5KYT A;  2ATW A;  4PUG A;  3VNQ A;  2DYJ A;  4DUZ C;  5CZX A;  3UZ0 A;  1XRC A;  3JAM D;  4RLF A;  3CQ1 A;  4DV3 C;  2XR1 A;  2CU6 A;  3R9X A;  5BSV A;  4WS9 A;  1MXC A;  4XX2 A;  1T5D X;  2E0G A;  4JI3 C;  3LNO A;  4PUH A;  5IT9 D;  5AE3 A;  4G37 A;  4DR5 C;  4GXQ A;  4DCT A;  4DV0 C;  3E7X A;  3PBK A;  4U5Y D;  4NOZ A;  4IZ6 A;  1IBL C;  1XRB A;  3SO4 A;  1M6X A;  2BH1 X;  2ZZN A;  5ADZ A;  4NXM C;  5E7Q A;  5BST A;  5KEI A;  3N54 B;  2PRO A;  1PG4 A;  2NCL A;  3UX3 A;  1XDX A;  3TUF A;  1V60 A;  3S82 A;  1USP A;  2P2F A;  3RV2 A;  2ZTB A;  3E7W A;  4FTF A;  3T1H C;  4ZJZ A;  1I94 C;  4K0K C;  5T8S A;  4ISB A;  5K85 A;  3ETC A;  4DR4 C;  4IR7 A;  2VZE A;  3DAY A;  4BC9 A;  2OPL A;  4EAT A;  4L2Z A;  4JI6 C;  1MXA A;  1V26 A;  2OBV A;  4X66 C;  2P2J A;  1HH2 P;  1O92 A;  5BSU A;  1VEH A;  2ZM6 C;  4BC7 A;  5K8F A;  4LF7 C;  2E8E A;  4PUI A;  3OTO C;  2YX1 A;  4YY3 C;  4JI7 C;  3GR1 A;  4L4Q A;  1RG9 A;  1YGT A;  4B3S C;  2UXB C;  3DLP X;  3CW9 A;  5A1I A;  1WCJ A;  1XS3 A;  2D1Q A;  2BJO A;  1ZB8 A;  3EQ6 A;  2M5H A;  3CW8 X;  5BR8 C;  2UUC C;  4KTT A;  1N34 C;  2MMA B;  1IBK C;  4G1I A;  3LNV A;  2UXC C;  2KZF A;  4JI8 C;  1YJ7 A;  4RVN A;  2PT7 G;  5BUS A;  4DG9 A;  5LMU C;  4ZLP A;  4RM3 A;  5IWA C;  1J5E C;  4X62 C;  1FJG C;  4HPV A;  4KTV A;  3J7A D;  1MKY A;  3RG2 A;  4DV7 C;  5KYV A;  3UX2 A;  1QWI A;  4B3T C;  1AMU A;  2D7V A;  4OXI A;  4GKK C;  4R0M A;  1UWD A;  4PHT A;  2D1T A;  2QVY X;  1BA3 A;  5BUQ A;  3I08 A;  1P4E A;  5T8T A;  4GS5 A;  4LF6 C;  3DHV A;  1XNR C;  2QVX X;  4JI2 C;  3A4I A;  2UXD C;  4LF5 C;  4KHP C;  2KDN A;  3TQI A;  2VQF C;  3T1Y C;  2ASB A;  3N2Q A;  4MH4 A;  1MDB A;  4WV3 A;  4B3M C;  2UUA C;  4JYA C;  4D56 A;  1N2F A;  4OYC A;  1LCI A;  4RVO A;  2YCB A;  2QW0 X;  3ETO A;  4GKJ C;  3AY0 A;  2Z51 A;  1N33 C;  4DG8 A;  4DV6 C;  4DR2 C;  5AE2 A;  1IB8 A;  2PN2 A;  1MDF A;  2JNV A;  4NDN A;  1QM4 A;  4AQY C;  4JI4 C;  1XHJ A;  1HNW C;  1O90 A;  2QL8 A;  3NYR A;  3J80 D;  5AE1 A;  4NXN C;  3B7W A;  2HHH C;  5IFI A;  2UUB C;  2F4V C;  4D57 A;  3LAX A;  4RMN A;  3CJE A;  4PZP A;  4LFA C;  3A9V A;  2QVZ X;  4DV1 C;  2Y4N A;  2UU9 C;  4DV5 C;  3FCE A;  1WH9 A;  3FM7 A;  5GTD A;  2M5O A;  3CQ2 A;  3KXW A;  5BSR A;  4D4G A;  4JV5 C;  4DR1 C;  1XMO C;  3GR0 A;  4OX9 C;  3L8C A;  4X64 C;  4JI0 C;  3CQ3 A;  2DPL A;  2WD9 A;  1O93 A;  4DR6 C;  2E7G A;  4JM1 A;  2EGT A;  4BCA A;  3K6R A;  3UOW A;  4YHH C;  1IBM C;  2ZZM A;  3IEV A;  1EGA A;  2Y27 A;  2YWC A;  4RM2 A;  1PA4 A;  4LF9 C;  1UKK A;  1WF3 A;  1TH5 A;  4DR7 C;  1NY8 A;  4B3R C;  1HR0 C;  3AF5 A;  1LQL A;  4JI1 C;  1O9T A;  3NYQ A;  1VLA A;  3VNR A;  1HNZ C;  1T5H X;  2VSQ A;  1ML8 A;  4ODJ A;  1ZB9 A;  1RY2 A;  5JRH A;  2D1S A;  2PG1 E;  1MD9 A;  1USP B;  4LF4 C;  2HJG A;  1XMQ C;  3C5E A;  2D27 A;  3GPC A;  1M6X C;  1MXB A;  3R44 A;  1FUG A;  1N32 C;  3EER A;  3TDE A;  4BSZ A;  2OPL B;  4X65 C;  3I07 A;  4DCU A;  1HNX C;  1PU1 A;  3L95 X;  4DV2 C;  1PG3 A;  2P2M A;  4FUT A;  4DR3 C;  2E8F A;  4TPS B;  4LF8 C;  3GKU A;  4D4I A;  3IPL A;  3TR3 A;  3IML A;  3VNS A;  4BBY A;  2CXC A;  4PRO C;  4RLQ A;  5DV9 A;  3IEU A;  4DUY C;  4DV4 C;  4MTN A;  5BUR A;  4JI5 C;  1K0R A;  2CY1 A; 
#chains in the Genus database with same CATH homology
 2P20 A;  2D1R A;  4G36 A;  5A19 A;  3A9U A;  2ONF A;  3H2T A;  1NYE A;  1V25 A;  2E8C A;  5LMN C;  1XNQ C;  4FUQ A;  4GXR A;  3NI2 A;  3G7S A;  4DCS A;  4I9G A;  4DCV A;  4LFB C;  1KKG A;  3NPD A;  2E5L C;  3J81 D;  5H9U A;  4LE5 A;  2WP0 C;  2AYA A;  2D28 C;  3AF6 A;  4LFC C;  2P02 A;  1XRA A;  3LGX A;  2OO4 A;  2P2Q A;  4L7I A;  1ULT A;  2YWB A;  3PES A;  3LUS A;  2JMP A;  2P2B A;  5A1G A;  1N36 C;  4R1M A;  2V7B A;  5FLX D;  3R9W A;  2Y4O A;  4I9F A;  1JOS A;  1P7L A;  1L2F A;  5BSM A;  4R1L A;  5A2Q D;  3FCC A;  2VQE C;  3PRO C;  4K0B A;  5BSW A;  1GPM A;  5CZV A;  5KYT A;  2ATW A;  3VNQ A;  2DYJ A;  4DUZ C;  5CZX A;  3UZ0 A;  1XRC A;  3JAM D;  4RLF A;  4DV3 C;  2XR1 A;  3R9X A;  5BSV A;  4WS9 A;  1MXC A;  4XX2 A;  1T5D X;  2E0G A;  4JI3 C;  5IT9 D;  5AE3 A;  4G37 A;  4DR5 C;  4GXQ A;  4DCT A;  4DV0 C;  3E7X A;  3PBK A;  4U5Y D;  4NOZ A;  4IZ6 A;  1IBL C;  1XRB A;  3SO4 A;  2BH1 X;  5ADZ A;  4NXM C;  5E7Q A;  5BST A;  5KEI A;  3N54 B;  2PRO A;  1PG4 A;  3TUF A;  3S82 A;  1USP A;  2P2F A;  3RV2 A;  3E7W A;  4FTF A;  3T1H C;  4ZJZ A;  1I94 C;  4K0K C;  5T8S A;  4ISB A;  5K85 A;  3ETC A;  4DR4 C;  4IR7 A;  2VZE A;  3DAY A;  4BC9 A;  2OPL A;  4EAT A;  4L2Z A;  4JI6 C;  1MXA A;  1V26 A;  2OBV A;  4X66 C;  2P2J A;  1HH2 P;  1O92 A;  5BSU A;  2ZM6 C;  4BC7 A;  5K8F A;  4LF7 C;  2E8E A;  3OTO C;  4YY3 C;  4JI7 C;  3GR1 A;  4L4Q A;  1RG9 A;  4B3S C;  2UXB C;  3DLP X;  3CW9 A;  5A1I A;  2D1Q A;  2BJO A;  1ZB8 A;  3EQ6 A;  3CW8 X;  5BR8 C;  2UUC C;  4KTT A;  1N34 C;  1IBK C;  4G1I A;  3LNV A;  2UXC C;  2KZF A;  4JI8 C;  1YJ7 A;  4RVN A;  2PT7 G;  5BUS A;  4DG9 A;  5LMU C;  4ZLP A;  4RM3 A;  5IWA C;  1J5E C;  4X62 C;  1FJG C;  4HPV A;  4KTV A;  3J7A D;  1MKY A;  3RG2 A;  4DV7 C;  5KYV A;  1QWI A;  4B3T C;  1AMU A;  2D7V A;  4OXI A;  4GKK C;  4R0M A;  4PHT A;  2D1T A;  2QVY X;  1BA3 A;  5BUQ A;  3I08 A;  5T8T A;  4GS5 A;  4LF6 C;  3DHV A;  1XNR C;  2QVX X;  4JI2 C;  3A4I A;  2UXD C;  4LF5 C;  4KHP C;  3TQI A;  2VQF C;  3T1Y C;  2ASB A;  3N2Q A;  4MH4 A;  1MDB A;  4WV3 A;  4B3M C;  2UUA C;  4JYA C;  4D56 A;  1N2F A;  4OYC A;  1LCI A;  4RVO A;  2YCB A;  2QW0 X;  3ETO A;  4GKJ C;  1N33 C;  4DG8 A;  4DV6 C;  4DR2 C;  5AE2 A;  2PN2 A;  1MDF A;  4NDN A;  1QM4 A;  4AQY C;  4JI4 C;  1HNW C;  1O90 A;  2QL8 A;  3NYR A;  3J80 D;  5AE1 A;  4NXN C;  3B7W A;  2HHH C;  5IFI A;  2UUB C;  2F4V C;  4D57 A;  3LAX A;  4RMN A;  3CJE A;  4PZP A;  4LFA C;  3A9V A;  2QVZ X;  4DV1 C;  2Y4N A;  2UU9 C;  4DV5 C;  3FCE A;  1WH9 A;  5GTD A;  3KXW A;  5BSR A;  4D4G A;  4JV5 C;  4DR1 C;  1XMO C;  3GR0 A;  4OX9 C;  3L8C A;  4X64 C;  4JI0 C;  2DPL A;  2WD9 A;  1O93 A;  4DR6 C;  2E7G A;  4JM1 A;  2EGT A;  4BCA A;  3UOW A;  4YHH C;  1IBM C;  3IEV A;  1EGA A;  2Y27 A;  2YWC A;  4RM2 A;  1PA4 A;  4LF9 C;  1UKK A;  1WF3 A;  4DR7 C;  4B3R C;  1HR0 C;  3AF5 A;  1LQL A;  4JI1 C;  1O9T A;  3NYQ A;  1VLA A;  3VNR A;  1HNZ C;  1T5H X;  2VSQ A;  1ML8 A;  4ODJ A;  1ZB9 A;  1RY2 A;  5JRH A;  2D1S A;  1MD9 A;  1USP B;  4LF4 C;  2HJG A;  1XMQ C;  3C5E A;  2D27 A;  3GPC A;  1MXB A;  3R44 A;  1FUG A;  1N32 C;  3EER A;  3TDE A;  4BSZ A;  2OPL B;  4X65 C;  3I07 A;  4DCU A;  1HNX C;  3L95 X;  4DV2 C;  1PG3 A;  2P2M A;  4FUT A;  4DR3 C;  2E8F A;  4TPS B;  4LF8 C;  3GKU A;  4D4I A;  3IPL A;  3IML A;  3VNS A;  4BBY A;  2CXC A;  4PRO C;  4RLQ A;  5DV9 A;  3IEU A;  4DUY C;  4DV4 C;  4MTN A;  5BUR A;  4JI5 C;  1K0R A;  2CY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...