5IWAC

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 55
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5iwaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5iwaC02
1IBLC 2CXCA 4DR5C 4X64C 1XNQC 4DUZC 1UKKA 1N36C 2VQEC 4X65C 2ASBA 1WF3A 4LF8C 2OPLB 4B3MC 1VLAA 4DR1C 2UUCC 4LFAC 3IEVA 5FLXD 3R9WA 1HNWC 5LMUC 4DUYC 4DV6C 1XMOC 4DR2C 4NOZA 2JMPA 5BR8C 4JI1C 4DR3C 1FJGC 4JI0C 4X66C 2XR1A 4LF5C 4MTNA 3J81D 2BJOA 4JI5C 4JYAC 2OPLA 1L2FA 4DCUA 2HJGA 4B3RC 3J80D 1IBKC 2E8CA 2UUAC 1KKGA 1PA4A 2E5LC 2E8EA 4JI7C 1IBMC 3T1YC 4JI4C 2YCBA 1HR0C 1MKYA 1J5EC 1NYEA 4DV1C 2F4VC 1N2FA 3OTOC 1USPB 3AF5A 4KHPC 4LFBC 4DV4C 4DR7C 4DV3C 4LF9C 2D7VA 1I94C 4JI6C 4DCVA 4X62C 3J7AD 4XX2A 2VQFC 2UXCC 1ML8A 4NXNC 3T1HC 4JI3C 4K0KC 4JI8C 1N33C 3R9XA 4GKJC 2CY1A 4JI2C 2PN2A 2E8FA 4DCTA 4LF4C 1USPA 4YHHC 4DV2C 2KZFA 1LQLA 1JOSA 3CJEA 4NXMC 4BSZA 1N34C 4DR4C 5LMNC 3JAMD 1XNRC 3IEUA 4LF6C 4JV5C 2PT7G 2ONFA 5A2QD 4LF7C 1HNZC 2E7GA 4B3SC 3AF6A 2UXBC 1WH9A 3EERA 2HHHC 4MH4A 4LFCC 1HH2P 4OX9C 1N32C 2ZM6C 3I07A 1XMQC 1K0RA 1ZB9A 2QL8A 4B3TC 2ATWA 1QWIA 1HNXC 2UUBC 4AQYC 4DV5C 2EGTA 4DCSA 4DV0C 4DR6C 1ZB8A 4DV7C 4YY3C 2UU9C 3LUSA 2DYJA 2UXDC 1EGAA 3GKUA 5IWAC 4GKKC 5IT9D
chains in the Genus database with same CATH superfamily
1P4EA 1XNQC 1YGTA 5A1IA 1XRBA 1WF3A 2D1RA 4LF8C 1XDXA 1XRCA 3IMLA 2PROA 4R1MA 5DV9A 2BH1X 5BSTA 3FCEA 2P2JA 4IZ6A 4DR2C 3LAXA 1XRAA 4JI1C 4DR3C 3NI2A 4RLQA 2BJOA 1MXBA 2OBVA 1L2FA 2HJGA 4B3RC 3J80D 2E8CA 2Y4OA 1PA4A 2E5LC 2DPLA 4JI7C 4NDNA 5GTDA 1IBMC 2D1TA 3GR0A 1MKYA 1NYEA 3VNQA 2D1QA 1PG3A 1PG4A 1M6XC 1XHJA 4I9GA 1TH5A 1LCIA 1ML8A 2AYAA 1O90A 3N54B 1N33C 1IB8A 4DCTA 1WCJA 4GXQA 4LF4C 1USPA 4DV2C 4OXIA 3UEBA 4WV3A 5LMNC 3A25A 5E7QA 2WD9A 2PT7G 1T5DX 2DHMA 3GPCA 3AF6A 2P02A 4I9FA 2HHHC 4MH4A 4ODJA 1HH2P 2P20A 3TR3A 4G37A 1XMQC 2QL8A 4FUQA 1O93A 1QWIA 1MD9A 1NY8A 5LCIA 4AQYC 2EGTA 3FM7A 4DCSA 4DV0C 4DR6C 4D56A 4L4QA 4R1LA 2UU9C 1ULTA 2DYJA 3CQ2A 4K0BA 2UXDC 1EGAA 2QVXX 3EQ6A 1O92A 5IWAC 1V60A 4PHTA 4DR5C 2V7BA 4X64C 1YJ7A 4X65C 3UZ0A 2OPLB 4B3MC 4OYCA 1VLAA 3IEVA 5FLXD 3K6RA 1HNWC 4G1IA 5LMUC 1P7LA 4DV6C 1V26A 3UOWA 2D27A 1XMOC 4BCAA 4ZJZA 2XR1A 4L2ZA 4WS9A 5KYTA 2NCLA 1KKGA 3T1YC 2YCBA 1J5EC 5BSWA 4DV1C 3RG2A 1PU1A 3R44A 3CQ3A 4DV4C 2D7VA 1I94C 3KXWA 3VNSA 4ISBA 2YWCA 3DHVA 4JI8C 1MDBA 2CY1A 5T8TA 4JI2C 2QVZX 1RY2A 2KZFA 1JOSA 1N34C 3PBKA 5A2QD 3O2EA 4RVOA 5BSUA 4B3SC 1WH9A 2MCQA 4OX9C 1N32C 2OO4A 4GS5A 1O9TA 4DG8A 4BC7A 1MXCA 5KYVA 1K0RA 3AY0A 2ATWA 1MXAA 2UUBC 4TPSB 3E7XA 1ZB8A 4DV7C 4YY3C 2YWBA 1RG9A 2WP0C 4GKKC 5A19A 1IBLC 2CXCA 4PUGA 4DUZC 1UKKA 3C5EA 2MM9A 1VEHA 4DR1C 2UUCC 2VZEA 5H9UA 3R9WA 4DUYC 3L8CA 2JNVA 2JMPA 5BR8C 5K85A 2PG1E 4JI0C 3UX3A 3H2TA 4LF5C 4MTNA 3J81D 5AE3A 2OPLA 4DCUA 3LNVA 3L95X 2UUAC 3CW9A 4JI4C 1GPMA 3B7WA 4PUHA 3UX2A 3TDEA 1N2FA 3OTOC 4GXRA 5BUQA 3AF5A 3ETCA 4LFBC 4DR7C 4LF9C 4RM3A 4DCVA 4X62C 2UXCC 2P2BA 3LGXA 4NXNC 3NYQA 5ADZA 3E7WA 2ZZMA 1P4EC 2PN2A 5A1GA 3A9UA 2M5OA 4YHHC 2Y27A 4DR4C 2CU6A 4RVNA 3JAMD 5CZXA 1XNRC 3CW8X 3IEUA 4LE5A 4LF6C 2ZZNA 4JV5C 4KTVA 4RM2A 2ONFA 4LF7C 3G7SA 4EATA 2Z51A 2UXBC 1MDFA 2QW0X 4LFCC 2Y4NA 2ZM6C 3I07A 4D57A 4B3TC 3IPLA 2P2MA 5K8FA 1FLOA 1XS3A 3CQ1A 1AMUA 1T5HX 4FTFA 3NYRA 1N36C 2VQEC 2ASBA 1V25A 4RMNA 3TQIA 4LFAC 3NPDA 1M6XA 4HPVA 4NOZA 5KEIA 5BSVA 1FJGC 2QVYX 2M5HA 4X66C 1QM4A 4DG9A 4R0MA 4JI5C 4JYAC 5CZVA 2D1SA 1IBKC 3RV2A 5JRHA 3FCCA 2E8EA 3N2QA 4D4GA 2ZTBA 1HR0C 3PESA 2YX1A 2F4VC 4BBYA 1USPB 5AE1A 2MMAB 4KHPC 2E0GA 4DV3C 4PZPA 4JI6C 3J7AD 4PROC 4XX2A 3PROC 3ETOA 2VQFC 1FUGA 3A9VA 3T1HC 4JI3C 4K0KC 3R9XA 4GKJC 2KZ0A 2E8FA 4ZLPA 2P2QA 3TUFA 5BSMA 4RLFA 1LQLA 3CJEA 3GR1A 4BSZA 4NXMC 3S82A 2KDNA 3VNRA 5T8SA 3A4IA 4G36A 1UWDA 3DAYA 1HNZC 2E7GA 3EERA 5IFIA 3A26A 5BUSA 4L7IA 3I08A 4BC9A 2VSQA 4FUTA 3SO4A 4IR7A 1ZB9A 5BSRA 3DLPX 4U5YD 2P2FA 1HNXC 3LNOA 4KTTA 4DV5C 4JM1A 3LUSA 5BURA 3GKUA 2D28C 4D4IA 5AE2A 4PUIA 5IT9D 1BA3A
chains in the Genus database with same CATH topology
1XNQC 5A1IA 1XRBA 1WF3A 2D1RA 4LF8C 1XRCA 3IMLA 2PROA 4R1MA 5DV9A 2BH1X 5BSTA 3FCEA 2P2JA 4IZ6A 4DR2C 3LAXA 1XRAA 4JI1C 4DR3C 3NI2A 4RLQA 2BJOA 1MXBA 2OBVA 1L2FA 2HJGA 4B3RC 3J80D 2E8CA 2Y4OA 1PA4A 2E5LC 2DPLA 4JI7C 4NDNA 5GTDA 1IBMC 2D1TA 3GR0A 1MKYA 1NYEA 3VNQA 2D1QA 1PG3A 1PG4A 4I9GA 1LCIA 1ML8A 2AYAA 1O90A 3N54B 1N33C 4DCTA 4GXQA 4LF4C 1USPA 4DV2C 4OXIA 4WV3A 5LMNC 5E7QA 2WD9A 2PT7G 1T5DX 3GPCA 3AF6A 2P02A 4I9FA 2HHHC 4MH4A 4ODJA 1HH2P 2P20A 4G37A 1XMQC 2QL8A 4FUQA 1O93A 1QWIA 1MD9A 4AQYC 2EGTA 4DCSA 4DV0C 4DR6C 4D56A 4L4QA 4R1LA 2UU9C 1ULTA 2DYJA 4K0BA 2UXDC 1EGAA 2QVXX 3EQ6A 1O92A 5IWAC 4PHTA 4DR5C 2V7BA 4X64C 1YJ7A 4X65C 3UZ0A 2OPLB 4B3MC 4OYCA 1VLAA 3IEVA 5FLXD 1HNWC 4G1IA 5LMUC 1P7LA 4DV6C 1V26A 3UOWA 2D27A 1XMOC 4BCAA 4ZJZA 2XR1A 4L2ZA 4WS9A 5KYTA 1KKGA 3T1YC 2YCBA 1J5EC 5BSWA 4DV1C 3RG2A 3R44A 4DV4C 2D7VA 1I94C 3KXWA 3VNSA 4ISBA 2YWCA 3DHVA 4JI8C 1MDBA 2CY1A 5T8TA 4JI2C 2QVZX 1RY2A 2KZFA 1JOSA 1N34C 3PBKA 5A2QD 4RVOA 5BSUA 4B3SC 1WH9A 4OX9C 1N32C 2OO4A 4GS5A 1O9TA 4DG8A 4BC7A 1MXCA 5KYVA 1K0RA 2ATWA 1MXAA 2UUBC 4TPSB 3E7XA 1ZB8A 4DV7C 4YY3C 2YWBA 1RG9A 2WP0C 4GKKC 5A19A 1IBLC 2CXCA 4DUZC 1UKKA 3C5EA 4DR1C 2UUCC 2VZEA 5H9UA 3R9WA 4DUYC 3L8CA 2JMPA 5BR8C 5K85A 4JI0C 3H2TA 4LF5C 4MTNA 3J81D 5AE3A 2OPLA 4DCUA 3LNVA 3L95X 2UUAC 3CW9A 4JI4C 1GPMA 3B7WA 3TDEA 1N2FA 3OTOC 4GXRA 5BUQA 3AF5A 3ETCA 4LFBC 4DR7C 4LF9C 4RM3A 4DCVA 4X62C 2UXCC 2P2BA 3LGXA 4NXNC 3NYQA 5ADZA 3E7WA 2PN2A 5A1GA 3A9UA 4YHHC 2Y27A 4DR4C 4RVNA 3JAMD 5CZXA 1XNRC 3CW8X 3IEUA 4LE5A 4LF6C 4JV5C 4KTVA 4RM2A 2ONFA 4LF7C 3G7SA 4EATA 2UXBC 1MDFA 2QW0X 4LFCC 2Y4NA 2ZM6C 3I07A 4D57A 4B3TC 3IPLA 2P2MA 5K8FA 1AMUA 1T5HX 4FTFA 3NYRA 1N36C 2VQEC 2ASBA 1V25A 4RMNA 3TQIA 4LFAC 3NPDA 4HPVA 4NOZA 5KEIA 5BSVA 1FJGC 2QVYX 4X66C 1QM4A 4DG9A 4R0MA 4JI5C 4JYAC 5CZVA 2D1SA 1IBKC 3RV2A 5JRHA 3FCCA 2E8EA 3N2QA 4D4GA 1HR0C 3PESA 2F4VC 4BBYA 1USPB 5AE1A 4KHPC 2E0GA 4DV3C 4PZPA 4JI6C 3J7AD 4PROC 4XX2A 3PROC 3ETOA 2VQFC 1FUGA 3A9VA 3T1HC 4JI3C 4K0KC 3R9XA 4GKJC 2E8FA 4ZLPA 2P2QA 3TUFA 5BSMA 4RLFA 1LQLA 3CJEA 3GR1A 4NXMC 3S82A 4BSZA 3VNRA 5T8SA 3A4IA 4G36A 3DAYA 1HNZC 2E7GA 3EERA 5IFIA 5BUSA 4L7IA 3I08A 4BC9A 2VSQA 4FUTA 3SO4A 4IR7A 1ZB9A 5BSRA 3DLPX 4U5YD 2P2FA 1HNXC 4KTTA 4DV5C 4JM1A 3LUSA 5BURA 3GKUA 2D28C 4D4IA 5AE2A 5IT9D 1BA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL C;  2CXC A;  4DR5 C;  4X64 C;  1XNQ C;  4DUZ C;  1UKK A;  1N36 C;  2VQE C;  4X65 C;  2ASB A;  1WF3 A;  4LF8 C;  2OPL B;  4B3M C;  1VLA A;  4DR1 C;  2UUC C;  4LFA C;  3IEV A;  5FLX D;  3R9W A;  1HNW C;  5LMU C;  4DUY C;  4DV6 C;  1XMO C;  4DR2 C;  4NOZ A;  2JMP A;  5BR8 C;  4JI1 C;  4DR3 C;  1FJG C;  4JI0 C;  4X66 C;  2XR1 A;  4LF5 C;  4MTN A;  3J81 D;  2BJO A;  4JI5 C;  4JYA C;  2OPL A;  1L2F A;  4DCU A;  2HJG A;  4B3R C;  3J80 D;  1IBK C;  2E8C A;  2UUA C;  1KKG A;  1PA4 A;  2E5L C;  2E8E A;  4JI7 C;  1IBM C;  3T1Y C;  4JI4 C;  2YCB A;  1HR0 C;  1MKY A;  1J5E C;  1NYE A;  4DV1 C;  2F4V C;  1N2F A;  3OTO C;  1USP B;  3AF5 A;  4KHP C;  4LFB C;  4DV4 C;  4DR7 C;  4DV3 C;  4LF9 C;  2D7V A;  1I94 C;  4JI6 C;  4DCV A;  4X62 C;  3J7A D;  4XX2 A;  2VQF C;  2UXC C;  1ML8 A;  4NXN C;  3T1H C;  4JI3 C;  4K0K C;  4JI8 C;  1N33 C;  3R9X A;  4GKJ C;  2CY1 A;  4JI2 C;  2PN2 A;  2E8F A;  4DCT A;  4LF4 C;  1USP A;  4YHH C;  4DV2 C;  2KZF A;  1LQL A;  1JOS A;  3CJE A;  4NXM C;  4BSZ A;  1N34 C;  4DR4 C;  5LMN C;  3JAM D;  1XNR C;  3IEU A;  4LF6 C;  4JV5 C;  2PT7 G;  2ONF A;  5A2Q D;  4LF7 C;  1HNZ C;  2E7G A;  4B3S C;  3AF6 A;  2UXB C;  1WH9 A;  3EER A;  2HHH C;  4MH4 A;  4LFC C;  1HH2 P;  4OX9 C;  1N32 C;  2ZM6 C;  3I07 A;  1XMQ C;  1K0R A;  1ZB9 A;  2QL8 A;  4B3T C;  2ATW A;  1QWI A;  1HNX C;  2UUB C;  4AQY C;  4DV5 C;  2EGT A;  4DCS A;  4DV0 C;  4DR6 C;  1ZB8 A;  4DV7 C;  4YY3 C;  2UU9 C;  3LUS A;  2DYJ A;  2UXD C;  1EGA A;  3GKU A;  5IWA C;  4GKK C;  5IT9 D; 
#chains in the Genus database with same CATH topology
 1P4E A;  1XNQ C;  1YGT A;  5A1I A;  1XRB A;  1WF3 A;  2D1R A;  4LF8 C;  1XDX A;  1XRC A;  3IML A;  2PRO A;  4R1M A;  5DV9 A;  2BH1 X;  5BST A;  3FCE A;  2P2J A;  4IZ6 A;  4DR2 C;  3LAX A;  1XRA A;  4JI1 C;  4DR3 C;  3NI2 A;  4RLQ A;  2BJO A;  1MXB A;  2OBV A;  1L2F A;  2HJG A;  4B3R C;  3J80 D;  2E8C A;  2Y4O A;  1PA4 A;  2E5L C;  2DPL A;  4JI7 C;  4NDN A;  5GTD A;  1IBM C;  2D1T A;  3GR0 A;  1MKY A;  1NYE A;  3VNQ A;  2D1Q A;  1PG3 A;  1PG4 A;  1M6X C;  1XHJ A;  4I9G A;  1TH5 A;  1LCI A;  1ML8 A;  2AYA A;  1O90 A;  3N54 B;  1N33 C;  1IB8 A;  4DCT A;  1WCJ A;  4GXQ A;  4LF4 C;  1USP A;  4DV2 C;  4OXI A;  3UEB A;  4WV3 A;  5LMN C;  3A25 A;  5E7Q A;  2WD9 A;  2PT7 G;  1T5D X;  2DHM A;  3GPC A;  3AF6 A;  2P02 A;  4I9F A;  2HHH C;  4MH4 A;  4ODJ A;  1HH2 P;  2P20 A;  3TR3 A;  4G37 A;  1XMQ C;  2QL8 A;  4FUQ A;  1O93 A;  1QWI A;  1MD9 A;  1NY8 A;  5LCI A;  4AQY C;  2EGT A;  3FM7 A;  4DCS A;  4DV0 C;  4DR6 C;  4D56 A;  4L4Q A;  4R1L A;  2UU9 C;  1ULT A;  2DYJ A;  3CQ2 A;  4K0B A;  2UXD C;  1EGA A;  2QVX X;  3EQ6 A;  1O92 A;  5IWA C;  1V60 A;  4PHT A;  4DR5 C;  2V7B A;  4X64 C;  1YJ7 A;  4X65 C;  3UZ0 A;  2OPL B;  4B3M C;  4OYC A;  1VLA A;  3IEV A;  5FLX D;  3K6R A;  1HNW C;  4G1I A;  5LMU C;  1P7L A;  4DV6 C;  1V26 A;  3UOW A;  2D27 A;  1XMO C;  4BCA A;  4ZJZ A;  2XR1 A;  4L2Z A;  4WS9 A;  5KYT A;  2NCL A;  1KKG A;  3T1Y C;  2YCB A;  1J5E C;  5BSW A;  4DV1 C;  3RG2 A;  1PU1 A;  3R44 A;  3CQ3 A;  4DV4 C;  2D7V A;  1I94 C;  3KXW A;  3VNS A;  4ISB A;  2YWC A;  3DHV A;  4JI8 C;  1MDB A;  2CY1 A;  5T8T A;  4JI2 C;  2QVZ X;  1RY2 A;  2KZF A;  1JOS A;  1N34 C;  3PBK A;  5A2Q D;  3O2E A;  4RVO A;  5BSU A;  4B3S C;  1WH9 A;  2MCQ A;  4OX9 C;  1N32 C;  2OO4 A;  4GS5 A;  1O9T A;  4DG8 A;  4BC7 A;  1MXC A;  5KYV A;  1K0R A;  3AY0 A;  2ATW A;  1MXA A;  2UUB C;  4TPS B;  3E7X A;  1ZB8 A;  4DV7 C;  4YY3 C;  2YWB A;  1RG9 A;  2WP0 C;  4GKK C;  5A19 A;  1IBL C;  2CXC A;  4PUG A;  4DUZ C;  1UKK A;  3C5E A;  2MM9 A;  1VEH A;  4DR1 C;  2UUC C;  2VZE A;  5H9U A;  3R9W A;  4DUY C;  3L8C A;  2JNV A;  2JMP A;  5BR8 C;  5K85 A;  2PG1 E;  4JI0 C;  3UX3 A;  3H2T A;  4LF5 C;  4MTN A;  3J81 D;  5AE3 A;  2OPL A;  4DCU A;  3LNV A;  3L95 X;  2UUA C;  3CW9 A;  4JI4 C;  1GPM A;  3B7W A;  4PUH A;  3UX2 A;  3TDE A;  1N2F A;  3OTO C;  4GXR A;  5BUQ A;  3AF5 A;  3ETC A;  4LFB C;  4DR7 C;  4LF9 C;  4RM3 A;  4DCV A;  4X62 C;  2UXC C;  2P2B A;  3LGX A;  4NXN C;  3NYQ A;  5ADZ A;  3E7W A;  2ZZM A;  1P4E C;  2PN2 A;  5A1G A;  3A9U A;  2M5O A;  4YHH C;  2Y27 A;  4DR4 C;  2CU6 A;  4RVN A;  3JAM D;  5CZX A;  1XNR C;  3CW8 X;  3IEU A;  4LE5 A;  4LF6 C;  2ZZN A;  4JV5 C;  4KTV A;  4RM2 A;  2ONF A;  4LF7 C;  3G7S A;  4EAT A;  2Z51 A;  2UXB C;  1MDF A;  2QW0 X;  4LFC C;  2Y4N A;  2ZM6 C;  3I07 A;  4D57 A;  4B3T C;  3IPL A;  2P2M A;  5K8F A;  1FLO A;  1XS3 A;  3CQ1 A;  1AMU A;  1T5H X;  4FTF A;  3NYR A;  1N36 C;  2VQE C;  2ASB A;  1V25 A;  4RMN A;  3TQI A;  4LFA C;  3NPD A;  1M6X A;  4HPV A;  4NOZ A;  5KEI A;  5BSV A;  1FJG C;  2QVY X;  2M5H A;  4X66 C;  1QM4 A;  4DG9 A;  4R0M A;  4JI5 C;  4JYA C;  5CZV A;  2D1S A;  1IBK C;  3RV2 A;  5JRH A;  3FCC A;  2E8E A;  3N2Q A;  4D4G A;  2ZTB A;  1HR0 C;  3PES A;  2YX1 A;  2F4V C;  4BBY A;  1USP B;  5AE1 A;  2MMA B;  4KHP C;  2E0G A;  4DV3 C;  4PZP A;  4JI6 C;  3J7A D;  4PRO C;  4XX2 A;  3PRO C;  3ETO A;  2VQF C;  1FUG A;  3A9V A;  3T1H C;  4JI3 C;  4K0K C;  3R9X A;  4GKJ C;  2KZ0 A;  2E8F A;  4ZLP A;  2P2Q A;  3TUF A;  5BSM A;  4RLF A;  1LQL A;  3CJE A;  3GR1 A;  4BSZ A;  4NXM C;  3S82 A;  2KDN A;  3VNR A;  5T8S A;  3A4I A;  4G36 A;  1UWD A;  3DAY A;  1HNZ C;  2E7G A;  3EER A;  5IFI A;  3A26 A;  5BUS A;  4L7I A;  3I08 A;  4BC9 A;  2VSQ A;  4FUT A;  3SO4 A;  4IR7 A;  1ZB9 A;  5BSR A;  3DLP X;  4U5Y D;  2P2F A;  1HNX C;  3LNO A;  4KTT A;  4DV5 C;  4JM1 A;  3LUS A;  5BUR A;  3GKU A;  2D28 C;  4D4I A;  5AE2 A;  4PUI A;  5IT9 D;  1BA3 A; 
#chains in the Genus database with same CATH homology
 1XNQ C;  5A1I A;  1XRB A;  1WF3 A;  2D1R A;  4LF8 C;  1XRC A;  3IML A;  2PRO A;  4R1M A;  5DV9 A;  2BH1 X;  5BST A;  3FCE A;  2P2J A;  4IZ6 A;  4DR2 C;  3LAX A;  1XRA A;  4JI1 C;  4DR3 C;  3NI2 A;  4RLQ A;  2BJO A;  1MXB A;  2OBV A;  1L2F A;  2HJG A;  4B3R C;  3J80 D;  2E8C A;  2Y4O A;  1PA4 A;  2E5L C;  2DPL A;  4JI7 C;  4NDN A;  5GTD A;  1IBM C;  2D1T A;  3GR0 A;  1MKY A;  1NYE A;  3VNQ A;  2D1Q A;  1PG3 A;  1PG4 A;  4I9G A;  1LCI A;  1ML8 A;  2AYA A;  1O90 A;  3N54 B;  1N33 C;  4DCT A;  4GXQ A;  4LF4 C;  1USP A;  4DV2 C;  4OXI A;  4WV3 A;  5LMN C;  5E7Q A;  2WD9 A;  2PT7 G;  1T5D X;  3GPC A;  3AF6 A;  2P02 A;  4I9F A;  2HHH C;  4MH4 A;  4ODJ A;  1HH2 P;  2P20 A;  4G37 A;  1XMQ C;  2QL8 A;  4FUQ A;  1O93 A;  1QWI A;  1MD9 A;  4AQY C;  2EGT A;  4DCS A;  4DV0 C;  4DR6 C;  4D56 A;  4L4Q A;  4R1L A;  2UU9 C;  1ULT A;  2DYJ A;  4K0B A;  2UXD C;  1EGA A;  2QVX X;  3EQ6 A;  1O92 A;  5IWA C;  4PHT A;  4DR5 C;  2V7B A;  4X64 C;  1YJ7 A;  4X65 C;  3UZ0 A;  2OPL B;  4B3M C;  4OYC A;  1VLA A;  3IEV A;  5FLX D;  1HNW C;  4G1I A;  5LMU C;  1P7L A;  4DV6 C;  1V26 A;  3UOW A;  2D27 A;  1XMO C;  4BCA A;  4ZJZ A;  2XR1 A;  4L2Z A;  4WS9 A;  5KYT A;  1KKG A;  3T1Y C;  2YCB A;  1J5E C;  5BSW A;  4DV1 C;  3RG2 A;  3R44 A;  4DV4 C;  2D7V A;  1I94 C;  3KXW A;  3VNS A;  4ISB A;  2YWC A;  3DHV A;  4JI8 C;  1MDB A;  2CY1 A;  5T8T A;  4JI2 C;  2QVZ X;  1RY2 A;  2KZF A;  1JOS A;  1N34 C;  3PBK A;  5A2Q D;  4RVO A;  5BSU A;  4B3S C;  1WH9 A;  4OX9 C;  1N32 C;  2OO4 A;  4GS5 A;  1O9T A;  4DG8 A;  4BC7 A;  1MXC A;  5KYV A;  1K0R A;  2ATW A;  1MXA A;  2UUB C;  4TPS B;  3E7X A;  1ZB8 A;  4DV7 C;  4YY3 C;  2YWB A;  1RG9 A;  2WP0 C;  4GKK C;  5A19 A;  1IBL C;  2CXC A;  4DUZ C;  1UKK A;  3C5E A;  4DR1 C;  2UUC C;  2VZE A;  5H9U A;  3R9W A;  4DUY C;  3L8C A;  2JMP A;  5BR8 C;  5K85 A;  4JI0 C;  3H2T A;  4LF5 C;  4MTN A;  3J81 D;  5AE3 A;  2OPL A;  4DCU A;  3LNV A;  3L95 X;  2UUA C;  3CW9 A;  4JI4 C;  1GPM A;  3B7W A;  3TDE A;  1N2F A;  3OTO C;  4GXR A;  5BUQ A;  3AF5 A;  3ETC A;  4LFB C;  4DR7 C;  4LF9 C;  4RM3 A;  4DCV A;  4X62 C;  2UXC C;  2P2B A;  3LGX A;  4NXN C;  3NYQ A;  5ADZ A;  3E7W A;  2PN2 A;  5A1G A;  3A9U A;  4YHH C;  2Y27 A;  4DR4 C;  4RVN A;  3JAM D;  5CZX A;  1XNR C;  3CW8 X;  3IEU A;  4LE5 A;  4LF6 C;  4JV5 C;  4KTV A;  4RM2 A;  2ONF A;  4LF7 C;  3G7S A;  4EAT A;  2UXB C;  1MDF A;  2QW0 X;  4LFC C;  2Y4N A;  2ZM6 C;  3I07 A;  4D57 A;  4B3T C;  3IPL A;  2P2M A;  5K8F A;  1AMU A;  1T5H X;  4FTF A;  3NYR A;  1N36 C;  2VQE C;  2ASB A;  1V25 A;  4RMN A;  3TQI A;  4LFA C;  3NPD A;  4HPV A;  4NOZ A;  5KEI A;  5BSV A;  1FJG C;  2QVY X;  4X66 C;  1QM4 A;  4DG9 A;  4R0M A;  4JI5 C;  4JYA C;  5CZV A;  2D1S A;  1IBK C;  3RV2 A;  5JRH A;  3FCC A;  2E8E A;  3N2Q A;  4D4G A;  1HR0 C;  3PES A;  2F4V C;  4BBY A;  1USP B;  5AE1 A;  4KHP C;  2E0G A;  4DV3 C;  4PZP A;  4JI6 C;  3J7A D;  4PRO C;  4XX2 A;  3PRO C;  3ETO A;  2VQF C;  1FUG A;  3A9V A;  3T1H C;  4JI3 C;  4K0K C;  3R9X A;  4GKJ C;  2E8F A;  4ZLP A;  2P2Q A;  3TUF A;  5BSM A;  4RLF A;  1LQL A;  3CJE A;  3GR1 A;  4NXM C;  3S82 A;  4BSZ A;  3VNR A;  5T8S A;  3A4I A;  4G36 A;  3DAY A;  1HNZ C;  2E7G A;  3EER A;  5IFI A;  5BUS A;  4L7I A;  3I08 A;  4BC9 A;  2VSQ A;  4FUT A;  3SO4 A;  4IR7 A;  1ZB9 A;  5BSR A;  3DLP X;  4U5Y D;  2P2F A;  1HNX C;  4KTT A;  4DV5 C;  4JM1 A;  3LUS A;  5BUR A;  3GKU A;  2D28 C;  4D4I A;  5AE2 A;  5IT9 D;  1BA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...