5IWAC

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 55
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5iwaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5iwaC02
2E8EA 3IEUA 4DR4C 1XNRC 3AF5A 4DV7C 1IBMC 4OX9C 2D7VA 1JOSA 3OTOC 1HNWC 1L2FA 3CJEA 1K0RA 2XR1A 4DV5C 4DV0C 2DYJA 4DR7C 1IBKC 1HNZC 2QL8A 4JI8C 4XX2A 1USPB 1USPA 4NOZA 4DCTA 4DV3C 1N32C 1WF3A 4DR5C 4DV4C 4DV2C 2ZM6C 1I94C 3J80D 4JV5C 2PT7G 5BR8C 2ONFA 4GKKC 3JAMD 2UXCC 3I07A 2VQFC 4DCVA 4B3TC 4DUYC 2CXCA 4DR3C 4DR6C 1WH9A 2E8CA 4MTNA 5A2QD 5IT9D 4JYAC 3IEVA 4JI2C 1UKKA 4JI6C 4X66C 5LMNC 1HH2P 1ZB8A 2ATWA 1N2FA 4YHHC 1N33C 2E8FA 1LQLA 4DV1C 1XMQC 3R9XA 4GKJC 3LUSA 4JI5C 3EERA 4YY3C 2CY1A 1IBLC 1XNQC 2ASBA 1PA4A 2KZFA 4DCUA 2UUBC 2UU9C 2EGTA 2HJGA 2VQEC 1FJGC 2PN2A 4LF4C 4BSZA 4LFCC 4NXNC 4B3SC 4K0KC 3R9WA 4LF8C 4B3MC 2HHHC 4DR1C 2E5LC 1N34C 2UXDC 1KKGA 4LF5C 4AQYC 2YCBA 2UXBC 3AF6A 2UUCC 2JMPA 4KHPC 1HR0C 4DCSA 1ML8A 1HNXC 2BJOA 5LMUC 1NYEA 4X64C 4JI7C 1QWIA 3J81D 1ZB9A 4MH4A 4LF6C 3T1YC 4JI3C 4DV6C 4LF9C 4NXMC 3GKUA 4JI1C 4DUZC 2UUAC 4JI0C 1EGAA 3T1HC 5FLXD 2F4VC 5IWAC 4DR2C 4LFBC 3J7AD 1MKYA 4X65C 1J5EC 1N36C 2E7GA 1VLAA 4JI4C 4X62C 1XMOC 4LF7C 4LFAC 4B3RC 2OPLB 2OPLA
chains in the Genus database with same CATH superfamily
2E8EA 4DV7C 2P2MA 5BUSA 4D4GA 1WCJA 3CW9A 1XS3A 2D7VA 1JOSA 3OTOC 3A9VA 3L95X 1L2FA 1T5DX 3CJEA 3FCEA 2DYJA 1IBKC 5K85A 1MXCA 3UX3A 3A25A 4DV4C 4DV2C 3NYQA 5KEIA 1I94C 3RV2A 2D28C 4K0BA 2PT7G 5GTDA 4GKKC 3LAXA 2QW0X 2P2JA 4G1IA 4B3TC 4DUYC 2YWCA 4DR3C 3LNVA 1WH9A 2E8CA 5A2QD 4RM3A 2ZZNA 3IEVA 1IB8A 4JI2C 1UKKA 3UEBA 4X66C 5AE3A 2D1SA 4BC9A 3LGXA 1LCIA 4ZJZA 3PESA 2M5OA 2QVYX 4RVNA 5H9UA 2D27A 4OXIA 1P4EA 2OO4A 3C5EA 1FJGC 2MM9A 4R0MA 3N2QA 1AMUA 4B3SC 2Y27A 4B3MC 4DR1C 1P4EC 3NYRA 4G36A 2UUCC 2JMPA 3PBKA 3J81D 2CU6A 4PZPA 3T1YC 4DV6C 3DHVA 4LF9C 4I9FA 1MXBA 3GKUA 2WP0C 4DUZC 4PROC 5BSUA 5FLXD 2F4VC 3GR1A 4LFBC 4ODJA 1MDFA 1MKYA 1J5EC 3KXWA 2E7GA 1PG3A 1VLAA 5BSWA 4X62C 1XMOC 4EATA 4ZLPA 5BUQA 3IEUA 1XRAA 1MD9A 4OX9C 3NPDA 1HNWC 2YX1A 1V25A 4RLQA 2XR1A 4DV5C 4DV0C 4GXQA 1N32C 5LCIA 2WD9A 4DR5C 3EQ6A 4PUGA 3J80D 2P2BA 4JV5C 2UXCC 4PUIA 4HPVA 1TH5A 2P2FA 4MTNA 4WS9A 3B7WA 4LE5A 2MCQA 5LMNC 5AE2A 1FLOA 1N33C 1LQLA 1XMQC 3LUSA 4WV3A 4L4QA 1IBLC 4KTVA 4BCAA 1XNQC 2ASBA 3I08A 4DCUA 5BURA 4GS5A 4RM2A 4NXNC 4LFCC 4DG8A 3TDEA 3R44A 3R9WA 2HHHC 2DHMA 2VZEA 1N34C 2UXDC 5DV9A 2BJOA 2P20A 1PU1A 4D57A 1O92A 2Z51A 3T1HC 3TQIA 4FTFA 3FCCA 3E7WA 4X65C 3LNOA 3DAYA 1N36C 5E7QA 1XRBA 4JI4C 3A9UA 1ULTA 2OBVA 4DR4C 4FUQA 1XNRC 3AF5A 3TUFA 2V7BA 3VNRA 1IBMC 5T8TA 5BSRA 4G37A 3A4IA 1K0RA 4DR7C 2Y4NA 4OYCA 1HNZC 2Y4OA 4JI8C 4U5YD 1USPB 3DLPX 4NOZA 2D1QA 4DV3C 4PUHA 3IMLA 3UZ0A 2OPLA 3CQ3A 4DG9A 5BR8C 4NDNA 2ONFA 1O93A 3TR3A 3JAMD 2VQFC 4PHTA 4DCVA 3N54B 4GXRA 4BC7A 5KYTA 2QVXX 4JYAC 2YWBA 3VNQA 1BA3A 1MDBA 5BSVA 2D1RA 1HH2P 1N2FA 2ZZMA 4YHHC 4DV1C 3UOWA 3R9XA 2NCLA 4FUTA 5T8SA 5JRHA 1PA4A 2KZFA 2UUBC 3IPLA 2UU9C 2HJGA 2VQEC 4ISBA 4IR7A 2PN2A 3L8CA 4LF8C 2P2QA 3RG2A 2E5LC 5A1IA 2KZ0A 1KKGA 4AQYC 2YCBA 3ETOA 5A1GA 2UXBC 1HR0C 4DCSA 1HNXC 5K8FA 3AY0A 4JI7C 1QWIA 1ZB9A 1YJ7A 1T5HX 4MH4A 4R1MA 3UX2A 4NXMC 5IFIA 2JNVA 1MXAA 4I9GA 2QVZX 4JI0C 1XHJA 4KTTA 2PROA 5BSMA 5BSTA 3J7AD 1QM4A 1O90A 1P7LA 3GPCA 3A26A 4IZ6A 4LFAC 2OPLB 1V26A 3K6RA 3CQ1A 5ADZA 3CW8X 4R1LA 2VSQA 3FM7A 2QL8A 4XX2A 1USPA 4DCTA 1WF3A 1RY2A 4D4IA 4L7IA 2D1TA 5A19A 2AYAA 2ZM6C 1RG9A 1YGTA 4BBYA 3I07A 2P02A 3S82A 4TPSB 2CXCA 4DR6C 5IT9D 4JI6C 5CZVA 2MMAB 2ZTBA 1ZB8A 2ATWA 2E8FA 1GPMA 1PG4A 3SO4A 4GKJC 5CZXA 4JI5C 3CQ2A 2DPLA 3EERA 4YY3C 2CY1A 3VNSA 2EGTA 3PROC 2PG1E 4D56A 4JM1A 4LF4C 4BSZA 4K0KC 3G7SA 3O2EA 1NY8A 4LF5C 3AF6A 2E0GA 4KHPC 2KDNA 1ML8A 2BH1X 3E7XA 5LMUC 1NYEA 1O9TA 1VEHA 4X64C 4LF6C 4JI3C 1FUGA 5KYVA 1UWDA 4L2ZA 5AE1A 4JI1C 1XDXA 2UUAC 1EGAA 5IWAC 4DR2C 3ETCA 1M6XA 2M5HA 4RLFA 1V60A 4RMNA 3NI2A 4RVOA 1XRCA 1M6XC 4LF7C 3GR0A 4B3RC 3H2TA
chains in the Genus database with same CATH topology
2E8EA 4DV7C 2P2MA 5BUSA 4D4GA 3CW9A 2D7VA 1JOSA 3OTOC 3A9VA 3L95X 1L2FA 1T5DX 3CJEA 3FCEA 2DYJA 1IBKC 5K85A 1MXCA 4DV4C 4DV2C 3NYQA 5KEIA 1I94C 3RV2A 2D28C 4K0BA 2PT7G 5GTDA 4GKKC 3LAXA 2QW0X 2P2JA 4G1IA 4B3TC 4DUYC 2YWCA 4DR3C 3LNVA 1WH9A 2E8CA 5A2QD 4RM3A 3IEVA 4JI2C 1UKKA 4X66C 5AE3A 2D1SA 4BC9A 3LGXA 1LCIA 4ZJZA 3PESA 2QVYX 4RVNA 5H9UA 2D27A 4OXIA 2OO4A 3C5EA 1FJGC 4R0MA 3N2QA 1AMUA 4B3SC 2Y27A 4B3MC 4DR1C 3NYRA 4G36A 2UUCC 2JMPA 3PBKA 3J81D 4PZPA 3T1YC 4DV6C 3DHVA 4LF9C 4I9FA 1MXBA 3GKUA 2WP0C 4DUZC 4PROC 5BSUA 5FLXD 2F4VC 3GR1A 4LFBC 4ODJA 1MDFA 1MKYA 1J5EC 3KXWA 2E7GA 1PG3A 1VLAA 5BSWA 4X62C 1XMOC 4EATA 4ZLPA 5BUQA 3IEUA 1XRAA 1MD9A 4OX9C 3NPDA 1HNWC 1V25A 4RLQA 2XR1A 4DV5C 4DV0C 4GXQA 1N32C 2WD9A 4DR5C 3EQ6A 3J80D 2P2BA 4JV5C 2UXCC 4HPVA 2P2FA 4MTNA 4WS9A 3B7WA 4LE5A 5LMNC 5AE2A 1N33C 1LQLA 1XMQC 3LUSA 4WV3A 4L4QA 1IBLC 4KTVA 4BCAA 1XNQC 2ASBA 3I08A 4DCUA 5BURA 4GS5A 4RM2A 4NXNC 4LFCC 4DG8A 3TDEA 3R44A 3R9WA 2HHHC 2VZEA 1N34C 2UXDC 5DV9A 2BJOA 2P20A 4D57A 1O92A 3T1HC 3TQIA 4FTFA 3FCCA 3E7WA 4X65C 3DAYA 1N36C 5E7QA 1XRBA 4JI4C 3A9UA 1ULTA 2OBVA 4DR4C 4FUQA 1XNRC 3AF5A 3TUFA 2V7BA 3VNRA 1IBMC 5T8TA 5BSRA 4G37A 3A4IA 1K0RA 4DR7C 2Y4NA 4OYCA 1HNZC 2Y4OA 4JI8C 4U5YD 1USPB 3DLPX 4NOZA 2D1QA 4DV3C 3IMLA 3UZ0A 2OPLA 4DG9A 5BR8C 4NDNA 2ONFA 1O93A 3JAMD 2VQFC 4PHTA 4DCVA 3N54B 4GXRA 4BC7A 5KYTA 2QVXX 4JYAC 2YWBA 3VNQA 1BA3A 1MDBA 5BSVA 2D1RA 1HH2P 1N2FA 4YHHC 4DV1C 3UOWA 3R9XA 4FUTA 5T8SA 5JRHA 1PA4A 2KZFA 2UUBC 3IPLA 2UU9C 2HJGA 2VQEC 4ISBA 4IR7A 2PN2A 3L8CA 4LF8C 2P2QA 3RG2A 2E5LC 5A1IA 1KKGA 4AQYC 2YCBA 3ETOA 5A1GA 2UXBC 1HR0C 4DCSA 1HNXC 5K8FA 4JI7C 1QWIA 1ZB9A 1YJ7A 1T5HX 4MH4A 4R1MA 4NXMC 5IFIA 1MXAA 4I9GA 2QVZX 4JI0C 4KTTA 2PROA 5BSMA 5BSTA 3J7AD 1QM4A 1O90A 1P7LA 3GPCA 4IZ6A 4LFAC 2OPLB 1V26A 5ADZA 3CW8X 4R1LA 2VSQA 2QL8A 4XX2A 1USPA 4DCTA 1WF3A 1RY2A 4D4IA 4L7IA 2D1TA 5A19A 2AYAA 2ZM6C 1RG9A 4BBYA 3I07A 2P02A 3S82A 4TPSB 2CXCA 4DR6C 5IT9D 4JI6C 5CZVA 1ZB8A 2ATWA 2E8FA 1GPMA 1PG4A 3SO4A 4GKJC 5CZXA 4JI5C 2DPLA 3EERA 4YY3C 2CY1A 3VNSA 2EGTA 3PROC 4D56A 4JM1A 4LF4C 4BSZA 4K0KC 3G7SA 4LF5C 3AF6A 2E0GA 4KHPC 1ML8A 2BH1X 3E7XA 5LMUC 1NYEA 1O9TA 4X64C 4LF6C 4JI3C 1FUGA 5KYVA 5AE1A 4L2ZA 4JI1C 2UUAC 1EGAA 5IWAC 4DR2C 3ETCA 4RLFA 4RMNA 3NI2A 4RVOA 1XRCA 4LF7C 3GR0A 4B3RC 3H2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8E A;  3IEU A;  4DR4 C;  1XNR C;  3AF5 A;  4DV7 C;  1IBM C;  4OX9 C;  2D7V A;  1JOS A;  3OTO C;  1HNW C;  1L2F A;  3CJE A;  1K0R A;  2XR1 A;  4DV5 C;  4DV0 C;  2DYJ A;  4DR7 C;  1IBK C;  1HNZ C;  2QL8 A;  4JI8 C;  4XX2 A;  1USP B;  1USP A;  4NOZ A;  4DCT A;  4DV3 C;  1N32 C;  1WF3 A;  4DR5 C;  4DV4 C;  4DV2 C;  2ZM6 C;  1I94 C;  3J80 D;  4JV5 C;  2PT7 G;  5BR8 C;  2ONF A;  4GKK C;  3JAM D;  2UXC C;  3I07 A;  2VQF C;  4DCV A;  4B3T C;  4DUY C;  2CXC A;  4DR3 C;  4DR6 C;  1WH9 A;  2E8C A;  4MTN A;  5A2Q D;  5IT9 D;  4JYA C;  3IEV A;  4JI2 C;  1UKK A;  4JI6 C;  4X66 C;  5LMN C;  1HH2 P;  1ZB8 A;  2ATW A;  1N2F A;  4YHH C;  1N33 C;  2E8F A;  1LQL A;  4DV1 C;  1XMQ C;  3R9X A;  4GKJ C;  3LUS A;  4JI5 C;  3EER A;  4YY3 C;  2CY1 A;  1IBL C;  1XNQ C;  2ASB A;  1PA4 A;  2KZF A;  4DCU A;  2UUB C;  2UU9 C;  2EGT A;  2HJG A;  2VQE C;  1FJG C;  2PN2 A;  4LF4 C;  4BSZ A;  4LFC C;  4NXN C;  4B3S C;  4K0K C;  3R9W A;  4LF8 C;  4B3M C;  2HHH C;  4DR1 C;  2E5L C;  1N34 C;  2UXD C;  1KKG A;  4LF5 C;  4AQY C;  2YCB A;  2UXB C;  3AF6 A;  2UUC C;  2JMP A;  4KHP C;  1HR0 C;  4DCS A;  1ML8 A;  1HNX C;  2BJO A;  5LMU C;  1NYE A;  4X64 C;  4JI7 C;  1QWI A;  3J81 D;  1ZB9 A;  4MH4 A;  4LF6 C;  3T1Y C;  4JI3 C;  4DV6 C;  4LF9 C;  4NXM C;  3GKU A;  4JI1 C;  4DUZ C;  2UUA C;  4JI0 C;  1EGA A;  3T1H C;  5FLX D;  2F4V C;  5IWA C;  4DR2 C;  4LFB C;  3J7A D;  1MKY A;  4X65 C;  1J5E C;  1N36 C;  2E7G A;  1VLA A;  4JI4 C;  4X62 C;  1XMO C;  4LF7 C;  4LFA C;  4B3R C;  2OPL B;  2OPL A; 
#chains in the Genus database with same CATH topology
 2E8E A;  4DV7 C;  2P2M A;  5BUS A;  4D4G A;  1WCJ A;  3CW9 A;  1XS3 A;  2D7V A;  1JOS A;  3OTO C;  3A9V A;  3L95 X;  1L2F A;  1T5D X;  3CJE A;  3FCE A;  2DYJ A;  1IBK C;  5K85 A;  1MXC A;  3UX3 A;  3A25 A;  4DV4 C;  4DV2 C;  3NYQ A;  5KEI A;  1I94 C;  3RV2 A;  2D28 C;  4K0B A;  2PT7 G;  5GTD A;  4GKK C;  3LAX A;  2QW0 X;  2P2J A;  4G1I A;  4B3T C;  4DUY C;  2YWC A;  4DR3 C;  3LNV A;  1WH9 A;  2E8C A;  5A2Q D;  4RM3 A;  2ZZN A;  3IEV A;  1IB8 A;  4JI2 C;  1UKK A;  3UEB A;  4X66 C;  5AE3 A;  2D1S A;  4BC9 A;  3LGX A;  1LCI A;  4ZJZ A;  3PES A;  2M5O A;  2QVY X;  4RVN A;  5H9U A;  2D27 A;  4OXI A;  1P4E A;  2OO4 A;  3C5E A;  1FJG C;  2MM9 A;  4R0M A;  3N2Q A;  1AMU A;  4B3S C;  2Y27 A;  4B3M C;  4DR1 C;  1P4E C;  3NYR A;  4G36 A;  2UUC C;  2JMP A;  3PBK A;  3J81 D;  2CU6 A;  4PZP A;  3T1Y C;  4DV6 C;  3DHV A;  4LF9 C;  4I9F A;  1MXB A;  3GKU A;  2WP0 C;  4DUZ C;  4PRO C;  5BSU A;  5FLX D;  2F4V C;  3GR1 A;  4LFB C;  4ODJ A;  1MDF A;  1MKY A;  1J5E C;  3KXW A;  2E7G A;  1PG3 A;  1VLA A;  5BSW A;  4X62 C;  1XMO C;  4EAT A;  4ZLP A;  5BUQ A;  3IEU A;  1XRA A;  1MD9 A;  4OX9 C;  3NPD A;  1HNW C;  2YX1 A;  1V25 A;  4RLQ A;  2XR1 A;  4DV5 C;  4DV0 C;  4GXQ A;  1N32 C;  5LCI A;  2WD9 A;  4DR5 C;  3EQ6 A;  4PUG A;  3J80 D;  2P2B A;  4JV5 C;  2UXC C;  4PUI A;  4HPV A;  1TH5 A;  2P2F A;  4MTN A;  4WS9 A;  3B7W A;  4LE5 A;  2MCQ A;  5LMN C;  5AE2 A;  1FLO A;  1N33 C;  1LQL A;  1XMQ C;  3LUS A;  4WV3 A;  4L4Q A;  1IBL C;  4KTV A;  4BCA A;  1XNQ C;  2ASB A;  3I08 A;  4DCU A;  5BUR A;  4GS5 A;  4RM2 A;  4NXN C;  4LFC C;  4DG8 A;  3TDE A;  3R44 A;  3R9W A;  2HHH C;  2DHM A;  2VZE A;  1N34 C;  2UXD C;  5DV9 A;  2BJO A;  2P20 A;  1PU1 A;  4D57 A;  1O92 A;  2Z51 A;  3T1H C;  3TQI A;  4FTF A;  3FCC A;  3E7W A;  4X65 C;  3LNO A;  3DAY A;  1N36 C;  5E7Q A;  1XRB A;  4JI4 C;  3A9U A;  1ULT A;  2OBV A;  4DR4 C;  4FUQ A;  1XNR C;  3AF5 A;  3TUF A;  2V7B A;  3VNR A;  1IBM C;  5T8T A;  5BSR A;  4G37 A;  3A4I A;  1K0R A;  4DR7 C;  2Y4N A;  4OYC A;  1HNZ C;  2Y4O A;  4JI8 C;  4U5Y D;  1USP B;  3DLP X;  4NOZ A;  2D1Q A;  4DV3 C;  4PUH A;  3IML A;  3UZ0 A;  2OPL A;  3CQ3 A;  4DG9 A;  5BR8 C;  4NDN A;  2ONF A;  1O93 A;  3TR3 A;  3JAM D;  2VQF C;  4PHT A;  4DCV A;  3N54 B;  4GXR A;  4BC7 A;  5KYT A;  2QVX X;  4JYA C;  2YWB A;  3VNQ A;  1BA3 A;  1MDB A;  5BSV A;  2D1R A;  1HH2 P;  1N2F A;  2ZZM A;  4YHH C;  4DV1 C;  3UOW A;  3R9X A;  2NCL A;  4FUT A;  5T8S A;  5JRH A;  1PA4 A;  2KZF A;  2UUB C;  3IPL A;  2UU9 C;  2HJG A;  2VQE C;  4ISB A;  4IR7 A;  2PN2 A;  3L8C A;  4LF8 C;  2P2Q A;  3RG2 A;  2E5L C;  5A1I A;  2KZ0 A;  1KKG A;  4AQY C;  2YCB A;  3ETO A;  5A1G A;  2UXB C;  1HR0 C;  4DCS A;  1HNX C;  5K8F A;  3AY0 A;  4JI7 C;  1QWI A;  1ZB9 A;  1YJ7 A;  1T5H X;  4MH4 A;  4R1M A;  3UX2 A;  4NXM C;  5IFI A;  2JNV A;  1MXA A;  4I9G A;  2QVZ X;  4JI0 C;  1XHJ A;  4KTT A;  2PRO A;  5BSM A;  5BST A;  3J7A D;  1QM4 A;  1O90 A;  1P7L A;  3GPC A;  3A26 A;  4IZ6 A;  4LFA C;  2OPL B;  1V26 A;  3K6R A;  3CQ1 A;  5ADZ A;  3CW8 X;  4R1L A;  2VSQ A;  3FM7 A;  2QL8 A;  4XX2 A;  1USP A;  4DCT A;  1WF3 A;  1RY2 A;  4D4I A;  4L7I A;  2D1T A;  5A19 A;  2AYA A;  2ZM6 C;  1RG9 A;  1YGT A;  4BBY A;  3I07 A;  2P02 A;  3S82 A;  4TPS B;  2CXC A;  4DR6 C;  5IT9 D;  4JI6 C;  5CZV A;  2MMA B;  2ZTB A;  1ZB8 A;  2ATW A;  2E8F A;  1GPM A;  1PG4 A;  3SO4 A;  4GKJ C;  5CZX A;  4JI5 C;  3CQ2 A;  2DPL A;  3EER A;  4YY3 C;  2CY1 A;  3VNS A;  2EGT A;  3PRO C;  2PG1 E;  4D56 A;  4JM1 A;  4LF4 C;  4BSZ A;  4K0K C;  3G7S A;  3O2E A;  1NY8 A;  4LF5 C;  3AF6 A;  2E0G A;  4KHP C;  2KDN A;  1ML8 A;  2BH1 X;  3E7X A;  5LMU C;  1NYE A;  1O9T A;  1VEH A;  4X64 C;  4LF6 C;  4JI3 C;  1FUG A;  5KYV A;  1UWD A;  4L2Z A;  5AE1 A;  4JI1 C;  1XDX A;  2UUA C;  1EGA A;  5IWA C;  4DR2 C;  3ETC A;  1M6X A;  2M5H A;  4RLF A;  1V60 A;  4RMN A;  3NI2 A;  4RVO A;  1XRC A;  1M6X C;  4LF7 C;  3GR0 A;  4B3R C;  3H2T A; 
#chains in the Genus database with same CATH homology
 2E8E A;  4DV7 C;  2P2M A;  5BUS A;  4D4G A;  3CW9 A;  2D7V A;  1JOS A;  3OTO C;  3A9V A;  3L95 X;  1L2F A;  1T5D X;  3CJE A;  3FCE A;  2DYJ A;  1IBK C;  5K85 A;  1MXC A;  4DV4 C;  4DV2 C;  3NYQ A;  5KEI A;  1I94 C;  3RV2 A;  2D28 C;  4K0B A;  2PT7 G;  5GTD A;  4GKK C;  3LAX A;  2QW0 X;  2P2J A;  4G1I A;  4B3T C;  4DUY C;  2YWC A;  4DR3 C;  3LNV A;  1WH9 A;  2E8C A;  5A2Q D;  4RM3 A;  3IEV A;  4JI2 C;  1UKK A;  4X66 C;  5AE3 A;  2D1S A;  4BC9 A;  3LGX A;  1LCI A;  4ZJZ A;  3PES A;  2QVY X;  4RVN A;  5H9U A;  2D27 A;  4OXI A;  2OO4 A;  3C5E A;  1FJG C;  4R0M A;  3N2Q A;  1AMU A;  4B3S C;  2Y27 A;  4B3M C;  4DR1 C;  3NYR A;  4G36 A;  2UUC C;  2JMP A;  3PBK A;  3J81 D;  4PZP A;  3T1Y C;  4DV6 C;  3DHV A;  4LF9 C;  4I9F A;  1MXB A;  3GKU A;  2WP0 C;  4DUZ C;  4PRO C;  5BSU A;  5FLX D;  2F4V C;  3GR1 A;  4LFB C;  4ODJ A;  1MDF A;  1MKY A;  1J5E C;  3KXW A;  2E7G A;  1PG3 A;  1VLA A;  5BSW A;  4X62 C;  1XMO C;  4EAT A;  4ZLP A;  5BUQ A;  3IEU A;  1XRA A;  1MD9 A;  4OX9 C;  3NPD A;  1HNW C;  1V25 A;  4RLQ A;  2XR1 A;  4DV5 C;  4DV0 C;  4GXQ A;  1N32 C;  2WD9 A;  4DR5 C;  3EQ6 A;  3J80 D;  2P2B A;  4JV5 C;  2UXC C;  4HPV A;  2P2F A;  4MTN A;  4WS9 A;  3B7W A;  4LE5 A;  5LMN C;  5AE2 A;  1N33 C;  1LQL A;  1XMQ C;  3LUS A;  4WV3 A;  4L4Q A;  1IBL C;  4KTV A;  4BCA A;  1XNQ C;  2ASB A;  3I08 A;  4DCU A;  5BUR A;  4GS5 A;  4RM2 A;  4NXN C;  4LFC C;  4DG8 A;  3TDE A;  3R44 A;  3R9W A;  2HHH C;  2VZE A;  1N34 C;  2UXD C;  5DV9 A;  2BJO A;  2P20 A;  4D57 A;  1O92 A;  3T1H C;  3TQI A;  4FTF A;  3FCC A;  3E7W A;  4X65 C;  3DAY A;  1N36 C;  5E7Q A;  1XRB A;  4JI4 C;  3A9U A;  1ULT A;  2OBV A;  4DR4 C;  4FUQ A;  1XNR C;  3AF5 A;  3TUF A;  2V7B A;  3VNR A;  1IBM C;  5T8T A;  5BSR A;  4G37 A;  3A4I A;  1K0R A;  4DR7 C;  2Y4N A;  4OYC A;  1HNZ C;  2Y4O A;  4JI8 C;  4U5Y D;  1USP B;  3DLP X;  4NOZ A;  2D1Q A;  4DV3 C;  3IML A;  3UZ0 A;  2OPL A;  4DG9 A;  5BR8 C;  4NDN A;  2ONF A;  1O93 A;  3JAM D;  2VQF C;  4PHT A;  4DCV A;  3N54 B;  4GXR A;  4BC7 A;  5KYT A;  2QVX X;  4JYA C;  2YWB A;  3VNQ A;  1BA3 A;  1MDB A;  5BSV A;  2D1R A;  1HH2 P;  1N2F A;  4YHH C;  4DV1 C;  3UOW A;  3R9X A;  4FUT A;  5T8S A;  5JRH A;  1PA4 A;  2KZF A;  2UUB C;  3IPL A;  2UU9 C;  2HJG A;  2VQE C;  4ISB A;  4IR7 A;  2PN2 A;  3L8C A;  4LF8 C;  2P2Q A;  3RG2 A;  2E5L C;  5A1I A;  1KKG A;  4AQY C;  2YCB A;  3ETO A;  5A1G A;  2UXB C;  1HR0 C;  4DCS A;  1HNX C;  5K8F A;  4JI7 C;  1QWI A;  1ZB9 A;  1YJ7 A;  1T5H X;  4MH4 A;  4R1M A;  4NXM C;  5IFI A;  1MXA A;  4I9G A;  2QVZ X;  4JI0 C;  4KTT A;  2PRO A;  5BSM A;  5BST A;  3J7A D;  1QM4 A;  1O90 A;  1P7L A;  3GPC A;  4IZ6 A;  4LFA C;  2OPL B;  1V26 A;  5ADZ A;  3CW8 X;  4R1L A;  2VSQ A;  2QL8 A;  4XX2 A;  1USP A;  4DCT A;  1WF3 A;  1RY2 A;  4D4I A;  4L7I A;  2D1T A;  5A19 A;  2AYA A;  2ZM6 C;  1RG9 A;  4BBY A;  3I07 A;  2P02 A;  3S82 A;  4TPS B;  2CXC A;  4DR6 C;  5IT9 D;  4JI6 C;  5CZV A;  1ZB8 A;  2ATW A;  2E8F A;  1GPM A;  1PG4 A;  3SO4 A;  4GKJ C;  5CZX A;  4JI5 C;  2DPL A;  3EER A;  4YY3 C;  2CY1 A;  3VNS A;  2EGT A;  3PRO C;  4D56 A;  4JM1 A;  4LF4 C;  4BSZ A;  4K0K C;  3G7S A;  4LF5 C;  3AF6 A;  2E0G A;  4KHP C;  1ML8 A;  2BH1 X;  3E7X A;  5LMU C;  1NYE A;  1O9T A;  4X64 C;  4LF6 C;  4JI3 C;  1FUG A;  5KYV A;  5AE1 A;  4L2Z A;  4JI1 C;  2UUA C;  1EGA A;  5IWA C;  4DR2 C;  3ETC A;  4RLF A;  4RMN A;  3NI2 A;  4RVO A;  1XRC A;  4LF7 C;  3GR0 A;  4B3R C;  3H2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...