5IWAC

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 55
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5iwaC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 5iwaC02
4LF6C 1IBLC 1QWIA 4LF5C 2E8CA 1JOSA 2VQFC 2UUAC 1HR0C 4JI5C 3GKUA 3AF6A 3AF5A 4DV4C 4NXNC 1IBMC 4JI7C 4JI2C 4AQYC 4DV6C 2E8EA 4DCTA 2BJOA 1UKKA 4DV2C 4GKKC 1HNZC 4MTNA 1HH2P 1N2FA 5IWAC 3J81D 4LF4C 4DV7C 5FLXD 4DV5C 1N36C 2KZFA 1HNWC 4LF7C 4DUYC 4B3MC 4DCUA 2CY1A 4DR2C 2ATWA 2UU9C 1WF3A 4DR4C 4DR3C 3J80D 4NOZA 1K0RA 4DV3C 1LQLA 4DR1C 4X66C 1XNQC 2UXBC 2CXCA 4JI4C 4LFAC 2E5LC 2YCBA 2JMPA 3I07A 3JAMD 5IT9D 2UUCC 1NYEA 4JI0C 4DCSA 5LMNC 1XNRC 2PT7G 4NXMC 1N34C 1IBKC 4JI1C 1VLAA 1USPA 4JV5C 2ZM6C 4K0KC 1WH9A 1PA4A 4BSZA 3R9WA 4B3RC 3LUSA 4XX2A 2QL8A 3OTOC 4B3TC 4LF9C 1USPB 1L2FA 2EGTA 1ZB8A 2E8FA 3T1HC 2ASBA 4JYAC 4DR7C 2OPLB 4X62C 5BR8C 4JI6C 1N32C 1FJGC 1ZB9A 4OX9C 4MH4A 1N33C 2UUBC 4JI3C 2HHHC 5A2QD 2XR1A 4LFCC 1HNXC 1KKGA 1XMQC 2OPLA 2DYJA 4LFBC 3T1YC 4DV1C 2D7VA 4GKJC 2UXDC 4LF8C 2PN2A 1MKYA 3IEUA 1ML8A 1XMOC 3CJEA 4JI8C 1I94C 2E7GA 4X65C 1J5EC 2VQEC 4B3SC 4YHHC 2F4VC 3IEVA 2HJGA 2ONFA 3R9XA 4DV0C 4KHPC 3J7AD 2UXCC 4X64C 4DCVA 4YY3C 4DUZC 1EGAA 4DR5C 3EERA 4DR6C 5LMUC
chains in the Genus database with same CATH superfamily
4LF6C 1IBLC 2E8CA 4PUHA 3C5EA 4NXNC 3KXWA 4DV6C 2E8EA 4BCAA 4DCTA 1MXCA 1UKKA 4MTNA 4RLFA 3ETCA 4DV7C 4LF7C 2CY1A 5H9UA 3LAXA 4HPVA 5AE1A 5A1GA 2CU6A 4WS9A 2QW0X 4NOZA 1IB8A 3PROC 1YGTA 2UXBC 3GPCA 4EATA 2E5LC 5IT9D 2UUCC 5BSUA 3PESA 2PT7G 1MXAA 3UOWA 4JI1C 3FCEA 1USPA 2ZM6C 5A1IA 4BSZA 2KZ0A 4XX2A 2QL8A 3OTOC 1ZB8A 2E8FA 4JYAC 4ZLPA 4DR7C 2P02A 4X62C 1O90A 4TPSB 3B7WA 5KYTA 4PUIA 5KYVA 3O2EA 5AE3A 3CW8X 5K85A 1NY8A 4I9GA 3LNVA 2D7VA 4OYCA 1ML8A 1MDFA 4JI8C 4X65C 3IEVA 2WP0C 2UXCC 2M5OA 2Y4NA 4YY3C 1RY2A 1V25A 4G36A 1QWIA 5LCIA 2VQFC 4JI5C 3CQ2A 3AF5A 5JRHA 3H2TA 3TUFA 4AQYC 2QVZX 3VNRA 2BJOA 4DV2C 1HNZC 3N2QA 2QVXX 1HH2P 5IWAC 3J81D 4LF4C 2MM9A 2OBVA 4DUYC 3L8CA 3CW9A 1T5HX 4U5YD 4DR4C 1XRAA 1M6XA 4R1LA 3UZ0A 1XNQC 3EQ6A 3A4IA 4JI4C 1V60A 3I07A 4JI0C 3VNQA 1N34C 4JV5C 1WH9A 4D56A 2JNVA 2D1RA 4FUQA 2YWCA 1RG9A 4LF9C 1USPB 1QM4A 4I9FA 2YX1A 4BC7A 5BSWA 4RM2A 2E0GA 1N32C 2D27A 2D1SA 3CQ3A 1ZB9A 2UUBC 2ZZMA 2Y4OA 2P2BA 3GR0A 4LE5A 2XR1A 2D28C 1HNXC 1XMQC 2OPLA 4K0BA 2P2QA 3TQIA 4LFBC 1O93A 3T1YC 4GKJC 1ULTA 4LF8C 1MKYA 5CZVA 3CJEA 3SO4A 2F4VC 5DV9A 1XDXA 2ONFA 3J7AD 1M6XC 5BUQA 4X64C 1O9TA 3A26A 3DHVA 5BSTA 5K8FA 1XRBA 2NCLA 3GKUA 3AF6A 4RVNA 3DLPX 4DV4C 1MDBA 2D1TA 2PG1E 4KTTA 4OXIA 5FLXD 2DHMA 4B3MC 5BUSA 3RV2A 4DR2C 4PZPA 1XHJA 3R44A 1WF3A 1TH5A 4IR7A 2M5HA 2ZTBA 5GTDA 1BA3A 3GR1A 4RVOA 1V26A 4DR1C 3PBKA 2CXCA 5ADZA 1T5DX 1PU1A 3N54B 2Z51A 4LFAC 5CZXA 2YCBA 3JAMD 1NYEA 4DCSA 5LMNC 2YWBA 3ETOA 4L4QA 3K6RA 1MXBA 4PUGA 1O92A 1PG3A 4G37A 4K0KC 4B3RC 1P7LA 1XS3A 3LUSA 4GXQA 4B3TC 2PROA 2P2MA 2VSQA 4D4GA 1VEHA 3UEBA 3T1HC 3DAYA 5BR8C 2P2JA 2OO4A 4NDNA 1N33C 3A9VA 4MH4A 2HHHC 4G1IA 3NYRA 5A2QD 5A19A 4GS5A 1KKGA 4JM1A 2DPLA 4D57A 2PN2A 3G7SA 3IEUA 1AMUA 1XMOC 1I94C 4WV3A 1J5EC 2VQEC 4B3SC 4YHHC 4ISBA 4RM3A 2Y27A 4BBYA 3R9XA 4DV0C 4GXRA 1MD9A 4R1MA 4RLQA 4DR5C 3EERA 4DR6C 2KZFA 5E7QA 4LF5C 2UUAC 1JOSA 1HR0C 3NYQA 1IBMC 4DG9A 1YJ7A 4JI2C 4JI7C 3TR3A 4ZJZA 3NPDA 4GKKC 3E7XA 3I08A 3S82A 4L7IA 1N2FA 2P2FA 5T8SA 4DV5C 2BH1X 1N36C 1HNWC 4BC9A 2D1QA 3A25A 5IFIA 4DCUA 1GPMA 4PHTA 2ATWA 2UU9C 4DR3C 3J80D 2AYAA 4RMNA 1K0RA 2KDNA 4DV3C 1LQLA 3UX3A 2V7BA 3LNOA 4PROC 4X66C 3A9UA 2MCQA 5T8TA 1XRCA 2JMPA 3RG2A 1P4EC 1FUGA 1XNRC 1UWDA 5BURA 1LCIA 4NXMC 1IBKC 4ODJA 4DG8A 1VLAA 3FCCA 1FLOA 2ZZNA 3UX2A 1PA4A 3R9WA 3CQ1A 3IMLA 4R0MA 1WCJA 1L2FA 2EGTA 2P20A 2ASBA 3IPLA 2OPLB 4FTFA 4JI6C 5BSRA 1FJGC 3E7WA 3LGXA 4IZ6A 4OX9C 5KEIA 4JI3C 3AY0A 3NI2A 5BSVA 5AE2A 4LFCC 3VNSA 2WD9A 4D4IA 2DYJA 4L2ZA 2QVYX 4FUTA 4DV1C 2UXDC 2MMAB 3L95X 1P4EA 4KTVA 2E7GA 3FM7A 2HJGA 3TDEA 2VZEA 4KHPC 1PG4A 5BSMA 4DCVA 4DUZC 1EGAA 5LMUC
chains in the Genus database with same CATH topology
4LF6C 1IBLC 2E8CA 3C5EA 4NXNC 3KXWA 4DV6C 2E8EA 4BCAA 4DCTA 1MXCA 1UKKA 4MTNA 4RLFA 3ETCA 4DV7C 4LF7C 2CY1A 5H9UA 3LAXA 4HPVA 5AE1A 5A1GA 4WS9A 2QW0X 4NOZA 3PROC 2UXBC 3GPCA 4EATA 2E5LC 5IT9D 2UUCC 5BSUA 3PESA 2PT7G 1MXAA 3UOWA 4JI1C 3FCEA 1USPA 2ZM6C 5A1IA 4BSZA 4XX2A 2QL8A 3OTOC 1ZB8A 2E8FA 4JYAC 4ZLPA 4DR7C 2P02A 4X62C 1O90A 4TPSB 3B7WA 5KYTA 5KYVA 5AE3A 3CW8X 5K85A 4I9GA 3LNVA 2D7VA 4OYCA 1ML8A 1MDFA 4JI8C 4X65C 3IEVA 2WP0C 2UXCC 2Y4NA 4YY3C 1RY2A 1V25A 4G36A 1QWIA 2VQFC 4JI5C 3AF5A 5JRHA 3H2TA 3TUFA 4AQYC 2QVZX 3VNRA 2BJOA 4DV2C 1HNZC 3N2QA 2QVXX 1HH2P 5IWAC 3J81D 4LF4C 2OBVA 4DUYC 3L8CA 3CW9A 1T5HX 4U5YD 4DR4C 1XRAA 4R1LA 3UZ0A 1XNQC 3EQ6A 3A4IA 4JI4C 3I07A 4JI0C 3VNQA 1N34C 4JV5C 1WH9A 4D56A 2D1RA 4FUQA 2YWCA 1RG9A 4LF9C 1USPB 1QM4A 4I9FA 4BC7A 5BSWA 4RM2A 2E0GA 1N32C 2D27A 2D1SA 1ZB9A 2UUBC 2Y4OA 2P2BA 3GR0A 4LE5A 2XR1A 2D28C 1HNXC 1XMQC 2OPLA 4K0BA 2P2QA 3TQIA 4LFBC 1O93A 3T1YC 4GKJC 4LF8C 1ULTA 1MKYA 5CZVA 3CJEA 3SO4A 2F4VC 5DV9A 2ONFA 3J7AD 5BUQA 4X64C 1O9TA 3DHVA 5BSTA 5K8FA 1XRBA 3GKUA 3AF6A 4RVNA 3DLPX 4DV4C 1MDBA 2D1TA 4KTTA 4OXIA 5FLXD 4B3MC 5BUSA 3RV2A 4DR2C 4PZPA 3R44A 1WF3A 4IR7A 5GTDA 1BA3A 3GR1A 4RVOA 1V26A 4DR1C 3PBKA 2CXCA 5ADZA 1T5DX 3N54B 4LFAC 5CZXA 2YCBA 3JAMD 1NYEA 4DCSA 5LMNC 2YWBA 3ETOA 4L4QA 1MXBA 1O92A 1PG3A 4G37A 4K0KC 4B3RC 1P7LA 3LUSA 4GXQA 4B3TC 2PROA 2P2MA 2VSQA 4D4GA 3T1HC 3DAYA 5BR8C 2P2JA 2OO4A 4NDNA 1N33C 3A9VA 4MH4A 2HHHC 4G1IA 3NYRA 5A2QD 5A19A 4GS5A 1KKGA 4JM1A 2DPLA 4D57A 2PN2A 3G7SA 3IEUA 1AMUA 1XMOC 1I94C 4WV3A 1J5EC 2VQEC 4B3SC 4YHHC 4ISBA 4RM3A 2Y27A 4BBYA 3R9XA 4DV0C 4GXRA 1MD9A 4R1MA 4RLQA 4DR5C 3EERA 4DR6C 2KZFA 5E7QA 4LF5C 2UUAC 1JOSA 1HR0C 3NYQA 1IBMC 4DG9A 1YJ7A 4JI2C 4JI7C 4ZJZA 3NPDA 4GKKC 3E7XA 3I08A 3S82A 4L7IA 1N2FA 2P2FA 5T8SA 4DV5C 2BH1X 1N36C 1HNWC 4BC9A 2D1QA 5IFIA 4DCUA 1GPMA 4PHTA 2ATWA 2UU9C 4DR3C 3J80D 2AYAA 4RMNA 1K0RA 4DV3C 1LQLA 2V7BA 4PROC 4X66C 3A9UA 5T8TA 1XRCA 2JMPA 3RG2A 1FUGA 1XNRC 5BURA 1LCIA 4NXMC 1IBKC 4ODJA 1VLAA 4DG8A 3FCCA 1PA4A 3R9WA 3IMLA 4R0MA 1L2FA 2EGTA 2P20A 2ASBA 3IPLA 2OPLB 4FTFA 4JI6C 5BSRA 1FJGC 3E7WA 3LGXA 4IZ6A 4OX9C 5KEIA 4JI3C 3NI2A 5BSVA 5AE2A 4LFCC 3VNSA 2WD9A 4D4IA 2DYJA 4L2ZA 2QVYX 4FUTA 4DV1C 2UXDC 3L95X 4KTVA 2E7GA 2HJGA 3TDEA 2VZEA 4KHPC 1PG4A 5BSMA 4DCVA 4DUZC 1EGAA 5LMUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 C;  1IBL C;  1QWI A;  4LF5 C;  2E8C A;  1JOS A;  2VQF C;  2UUA C;  1HR0 C;  4JI5 C;  3GKU A;  3AF6 A;  3AF5 A;  4DV4 C;  4NXN C;  1IBM C;  4JI7 C;  4JI2 C;  4AQY C;  4DV6 C;  2E8E A;  4DCT A;  2BJO A;  1UKK A;  4DV2 C;  4GKK C;  1HNZ C;  4MTN A;  1HH2 P;  1N2F A;  5IWA C;  3J81 D;  4LF4 C;  4DV7 C;  5FLX D;  4DV5 C;  1N36 C;  2KZF A;  1HNW C;  4LF7 C;  4DUY C;  4B3M C;  4DCU A;  2CY1 A;  4DR2 C;  2ATW A;  2UU9 C;  1WF3 A;  4DR4 C;  4DR3 C;  3J80 D;  4NOZ A;  1K0R A;  4DV3 C;  1LQL A;  4DR1 C;  4X66 C;  1XNQ C;  2UXB C;  2CXC A;  4JI4 C;  4LFA C;  2E5L C;  2YCB A;  2JMP A;  3I07 A;  3JAM D;  5IT9 D;  2UUC C;  1NYE A;  4JI0 C;  4DCS A;  5LMN C;  1XNR C;  2PT7 G;  4NXM C;  1N34 C;  1IBK C;  4JI1 C;  1VLA A;  1USP A;  4JV5 C;  2ZM6 C;  4K0K C;  1WH9 A;  1PA4 A;  4BSZ A;  3R9W A;  4B3R C;  3LUS A;  4XX2 A;  2QL8 A;  3OTO C;  4B3T C;  4LF9 C;  1USP B;  1L2F A;  2EGT A;  1ZB8 A;  2E8F A;  3T1H C;  2ASB A;  4JYA C;  4DR7 C;  2OPL B;  4X62 C;  5BR8 C;  4JI6 C;  1N32 C;  1FJG C;  1ZB9 A;  4OX9 C;  4MH4 A;  1N33 C;  2UUB C;  4JI3 C;  2HHH C;  5A2Q D;  2XR1 A;  4LFC C;  1HNX C;  1KKG A;  1XMQ C;  2OPL A;  2DYJ A;  4LFB C;  3T1Y C;  4DV1 C;  2D7V A;  4GKJ C;  2UXD C;  4LF8 C;  2PN2 A;  1MKY A;  3IEU A;  1ML8 A;  1XMO C;  3CJE A;  4JI8 C;  1I94 C;  2E7G A;  4X65 C;  1J5E C;  2VQE C;  4B3S C;  4YHH C;  2F4V C;  3IEV A;  2HJG A;  2ONF A;  3R9X A;  4DV0 C;  4KHP C;  3J7A D;  2UXC C;  4X64 C;  4DCV A;  4YY3 C;  4DUZ C;  1EGA A;  4DR5 C;  3EER A;  4DR6 C;  5LMU C; 
#chains in the Genus database with same CATH topology
 4LF6 C;  1IBL C;  2E8C A;  4PUH A;  3C5E A;  4NXN C;  3KXW A;  4DV6 C;  2E8E A;  4BCA A;  4DCT A;  1MXC A;  1UKK A;  4MTN A;  4RLF A;  3ETC A;  4DV7 C;  4LF7 C;  2CY1 A;  5H9U A;  3LAX A;  4HPV A;  5AE1 A;  5A1G A;  2CU6 A;  4WS9 A;  2QW0 X;  4NOZ A;  1IB8 A;  3PRO C;  1YGT A;  2UXB C;  3GPC A;  4EAT A;  2E5L C;  5IT9 D;  2UUC C;  5BSU A;  3PES A;  2PT7 G;  1MXA A;  3UOW A;  4JI1 C;  3FCE A;  1USP A;  2ZM6 C;  5A1I A;  4BSZ A;  2KZ0 A;  4XX2 A;  2QL8 A;  3OTO C;  1ZB8 A;  2E8F A;  4JYA C;  4ZLP A;  4DR7 C;  2P02 A;  4X62 C;  1O90 A;  4TPS B;  3B7W A;  5KYT A;  4PUI A;  5KYV A;  3O2E A;  5AE3 A;  3CW8 X;  5K85 A;  1NY8 A;  4I9G A;  3LNV A;  2D7V A;  4OYC A;  1ML8 A;  1MDF A;  4JI8 C;  4X65 C;  3IEV A;  2WP0 C;  2UXC C;  2M5O A;  2Y4N A;  4YY3 C;  1RY2 A;  1V25 A;  4G36 A;  1QWI A;  5LCI A;  2VQF C;  4JI5 C;  3CQ2 A;  3AF5 A;  5JRH A;  3H2T A;  3TUF A;  4AQY C;  2QVZ X;  3VNR A;  2BJO A;  4DV2 C;  1HNZ C;  3N2Q A;  2QVX X;  1HH2 P;  5IWA C;  3J81 D;  4LF4 C;  2MM9 A;  2OBV A;  4DUY C;  3L8C A;  3CW9 A;  1T5H X;  4U5Y D;  4DR4 C;  1XRA A;  1M6X A;  4R1L A;  3UZ0 A;  1XNQ C;  3EQ6 A;  3A4I A;  4JI4 C;  1V60 A;  3I07 A;  4JI0 C;  3VNQ A;  1N34 C;  4JV5 C;  1WH9 A;  4D56 A;  2JNV A;  2D1R A;  4FUQ A;  2YWC A;  1RG9 A;  4LF9 C;  1USP B;  1QM4 A;  4I9F A;  2YX1 A;  4BC7 A;  5BSW A;  4RM2 A;  2E0G A;  1N32 C;  2D27 A;  2D1S A;  3CQ3 A;  1ZB9 A;  2UUB C;  2ZZM A;  2Y4O A;  2P2B A;  3GR0 A;  4LE5 A;  2XR1 A;  2D28 C;  1HNX C;  1XMQ C;  2OPL A;  4K0B A;  2P2Q A;  3TQI A;  4LFB C;  1O93 A;  3T1Y C;  4GKJ C;  1ULT A;  4LF8 C;  1MKY A;  5CZV A;  3CJE A;  3SO4 A;  2F4V C;  5DV9 A;  1XDX A;  2ONF A;  3J7A D;  1M6X C;  5BUQ A;  4X64 C;  1O9T A;  3A26 A;  3DHV A;  5BST A;  5K8F A;  1XRB A;  2NCL A;  3GKU A;  3AF6 A;  4RVN A;  3DLP X;  4DV4 C;  1MDB A;  2D1T A;  2PG1 E;  4KTT A;  4OXI A;  5FLX D;  2DHM A;  4B3M C;  5BUS A;  3RV2 A;  4DR2 C;  4PZP A;  1XHJ A;  3R44 A;  1WF3 A;  1TH5 A;  4IR7 A;  2M5H A;  2ZTB A;  5GTD A;  1BA3 A;  3GR1 A;  4RVO A;  1V26 A;  4DR1 C;  3PBK A;  2CXC A;  5ADZ A;  1T5D X;  1PU1 A;  3N54 B;  2Z51 A;  4LFA C;  5CZX A;  2YCB A;  3JAM D;  1NYE A;  4DCS A;  5LMN C;  2YWB A;  3ETO A;  4L4Q A;  3K6R A;  1MXB A;  4PUG A;  1O92 A;  1PG3 A;  4G37 A;  4K0K C;  4B3R C;  1P7L A;  1XS3 A;  3LUS A;  4GXQ A;  4B3T C;  2PRO A;  2P2M A;  2VSQ A;  4D4G A;  1VEH A;  3UEB A;  3T1H C;  3DAY A;  5BR8 C;  2P2J A;  2OO4 A;  4NDN A;  1N33 C;  3A9V A;  4MH4 A;  2HHH C;  4G1I A;  3NYR A;  5A2Q D;  5A19 A;  4GS5 A;  1KKG A;  4JM1 A;  2DPL A;  4D57 A;  2PN2 A;  3G7S A;  3IEU A;  1AMU A;  1XMO C;  1I94 C;  4WV3 A;  1J5E C;  2VQE C;  4B3S C;  4YHH C;  4ISB A;  4RM3 A;  2Y27 A;  4BBY A;  3R9X A;  4DV0 C;  4GXR A;  1MD9 A;  4R1M A;  4RLQ A;  4DR5 C;  3EER A;  4DR6 C;  2KZF A;  5E7Q A;  4LF5 C;  2UUA C;  1JOS A;  1HR0 C;  3NYQ A;  1IBM C;  4DG9 A;  1YJ7 A;  4JI2 C;  4JI7 C;  3TR3 A;  4ZJZ A;  3NPD A;  4GKK C;  3E7X A;  3I08 A;  3S82 A;  4L7I A;  1N2F A;  2P2F A;  5T8S A;  4DV5 C;  2BH1 X;  1N36 C;  1HNW C;  4BC9 A;  2D1Q A;  3A25 A;  5IFI A;  4DCU A;  1GPM A;  4PHT A;  2ATW A;  2UU9 C;  4DR3 C;  3J80 D;  2AYA A;  4RMN A;  1K0R A;  2KDN A;  4DV3 C;  1LQL A;  3UX3 A;  2V7B A;  3LNO A;  4PRO C;  4X66 C;  3A9U A;  2MCQ A;  5T8T A;  1XRC A;  2JMP A;  3RG2 A;  1P4E C;  1FUG A;  1XNR C;  1UWD A;  5BUR A;  1LCI A;  4NXM C;  1IBK C;  4ODJ A;  4DG8 A;  1VLA A;  3FCC A;  1FLO A;  2ZZN A;  3UX2 A;  1PA4 A;  3R9W A;  3CQ1 A;  3IML A;  4R0M A;  1WCJ A;  1L2F A;  2EGT A;  2P20 A;  2ASB A;  3IPL A;  2OPL B;  4FTF A;  4JI6 C;  5BSR A;  1FJG C;  3E7W A;  3LGX A;  4IZ6 A;  4OX9 C;  5KEI A;  4JI3 C;  3AY0 A;  3NI2 A;  5BSV A;  5AE2 A;  4LFC C;  3VNS A;  2WD9 A;  4D4I A;  2DYJ A;  4L2Z A;  2QVY X;  4FUT A;  4DV1 C;  2UXD C;  2MMA B;  3L95 X;  1P4E A;  4KTV A;  2E7G A;  3FM7 A;  2HJG A;  3TDE A;  2VZE A;  4KHP C;  1PG4 A;  5BSM A;  4DCV A;  4DUZ C;  1EGA A;  5LMU C; 
#chains in the Genus database with same CATH homology
 4LF6 C;  1IBL C;  2E8C A;  3C5E A;  4NXN C;  3KXW A;  4DV6 C;  2E8E A;  4BCA A;  4DCT A;  1MXC A;  1UKK A;  4MTN A;  4RLF A;  3ETC A;  4DV7 C;  4LF7 C;  2CY1 A;  5H9U A;  3LAX A;  4HPV A;  5AE1 A;  5A1G A;  4WS9 A;  2QW0 X;  4NOZ A;  3PRO C;  2UXB C;  3GPC A;  4EAT A;  2E5L C;  5IT9 D;  2UUC C;  5BSU A;  3PES A;  2PT7 G;  1MXA A;  3UOW A;  4JI1 C;  3FCE A;  1USP A;  2ZM6 C;  5A1I A;  4BSZ A;  4XX2 A;  2QL8 A;  3OTO C;  1ZB8 A;  2E8F A;  4JYA C;  4ZLP A;  4DR7 C;  2P02 A;  4X62 C;  1O90 A;  4TPS B;  3B7W A;  5KYT A;  5KYV A;  5AE3 A;  3CW8 X;  5K85 A;  4I9G A;  3LNV A;  2D7V A;  4OYC A;  1ML8 A;  1MDF A;  4JI8 C;  4X65 C;  3IEV A;  2WP0 C;  2UXC C;  2Y4N A;  4YY3 C;  1RY2 A;  1V25 A;  4G36 A;  1QWI A;  2VQF C;  4JI5 C;  3AF5 A;  5JRH A;  3H2T A;  3TUF A;  4AQY C;  2QVZ X;  3VNR A;  2BJO A;  4DV2 C;  1HNZ C;  3N2Q A;  2QVX X;  1HH2 P;  5IWA C;  3J81 D;  4LF4 C;  2OBV A;  4DUY C;  3L8C A;  3CW9 A;  1T5H X;  4U5Y D;  4DR4 C;  1XRA A;  4R1L A;  3UZ0 A;  1XNQ C;  3EQ6 A;  3A4I A;  4JI4 C;  3I07 A;  4JI0 C;  3VNQ A;  1N34 C;  4JV5 C;  1WH9 A;  4D56 A;  2D1R A;  4FUQ A;  2YWC A;  1RG9 A;  4LF9 C;  1USP B;  1QM4 A;  4I9F A;  4BC7 A;  5BSW A;  4RM2 A;  2E0G A;  1N32 C;  2D27 A;  2D1S A;  1ZB9 A;  2UUB C;  2Y4O A;  2P2B A;  3GR0 A;  4LE5 A;  2XR1 A;  2D28 C;  1HNX C;  1XMQ C;  2OPL A;  4K0B A;  2P2Q A;  3TQI A;  4LFB C;  1O93 A;  3T1Y C;  4GKJ C;  4LF8 C;  1ULT A;  1MKY A;  5CZV A;  3CJE A;  3SO4 A;  2F4V C;  5DV9 A;  2ONF A;  3J7A D;  5BUQ A;  4X64 C;  1O9T A;  3DHV A;  5BST A;  5K8F A;  1XRB A;  3GKU A;  3AF6 A;  4RVN A;  3DLP X;  4DV4 C;  1MDB A;  2D1T A;  4KTT A;  4OXI A;  5FLX D;  4B3M C;  5BUS A;  3RV2 A;  4DR2 C;  4PZP A;  3R44 A;  1WF3 A;  4IR7 A;  5GTD A;  1BA3 A;  3GR1 A;  4RVO A;  1V26 A;  4DR1 C;  3PBK A;  2CXC A;  5ADZ A;  1T5D X;  3N54 B;  4LFA C;  5CZX A;  2YCB A;  3JAM D;  1NYE A;  4DCS A;  5LMN C;  2YWB A;  3ETO A;  4L4Q A;  1MXB A;  1O92 A;  1PG3 A;  4G37 A;  4K0K C;  4B3R C;  1P7L A;  3LUS A;  4GXQ A;  4B3T C;  2PRO A;  2P2M A;  2VSQ A;  4D4G A;  3T1H C;  3DAY A;  5BR8 C;  2P2J A;  2OO4 A;  4NDN A;  1N33 C;  3A9V A;  4MH4 A;  2HHH C;  4G1I A;  3NYR A;  5A2Q D;  5A19 A;  4GS5 A;  1KKG A;  4JM1 A;  2DPL A;  4D57 A;  2PN2 A;  3G7S A;  3IEU A;  1AMU A;  1XMO C;  1I94 C;  4WV3 A;  1J5E C;  2VQE C;  4B3S C;  4YHH C;  4ISB A;  4RM3 A;  2Y27 A;  4BBY A;  3R9X A;  4DV0 C;  4GXR A;  1MD9 A;  4R1M A;  4RLQ A;  4DR5 C;  3EER A;  4DR6 C;  2KZF A;  5E7Q A;  4LF5 C;  2UUA C;  1JOS A;  1HR0 C;  3NYQ A;  1IBM C;  4DG9 A;  1YJ7 A;  4JI2 C;  4JI7 C;  4ZJZ A;  3NPD A;  4GKK C;  3E7X A;  3I08 A;  3S82 A;  4L7I A;  1N2F A;  2P2F A;  5T8S A;  4DV5 C;  2BH1 X;  1N36 C;  1HNW C;  4BC9 A;  2D1Q A;  5IFI A;  4DCU A;  1GPM A;  4PHT A;  2ATW A;  2UU9 C;  4DR3 C;  3J80 D;  2AYA A;  4RMN A;  1K0R A;  4DV3 C;  1LQL A;  2V7B A;  4PRO C;  4X66 C;  3A9U A;  5T8T A;  1XRC A;  2JMP A;  3RG2 A;  1FUG A;  1XNR C;  5BUR A;  1LCI A;  4NXM C;  1IBK C;  4ODJ A;  1VLA A;  4DG8 A;  3FCC A;  1PA4 A;  3R9W A;  3IML A;  4R0M A;  1L2F A;  2EGT A;  2P20 A;  2ASB A;  3IPL A;  2OPL B;  4FTF A;  4JI6 C;  5BSR A;  1FJG C;  3E7W A;  3LGX A;  4IZ6 A;  4OX9 C;  5KEI A;  4JI3 C;  3NI2 A;  5BSV A;  5AE2 A;  4LFC C;  3VNS A;  2WD9 A;  4D4I A;  2DYJ A;  4L2Z A;  2QVY X;  4FUT A;  4DV1 C;  2UXD C;  3L95 X;  4KTV A;  2E7G A;  2HJG A;  3TDE A;  2VZE A;  4KHP C;  1PG4 A;  5BSM A;  4DCV A;  4DUZ C;  1EGA A;  5LMU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...