4B3SC

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3sC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3sC02
2D7VA 2ZM6C 4DR3C 2VQEC 3IEVA 2OPLA 4KHPC 1HNXC 4JV5C 2UUAC 1N33C 4DV2C 2PT7G 4JI1C 4DV0C 4YHHC 1ML8A 4DR6C 2EGTA 1N32C 3J81D 4NXNC 4DR2C 5LMUC 3JAMD 1XMQC 4DR5C 2HHHC 1N36C 4JI7C 2XR1A 3AF6A 1ZB9A 1K0RA 3OTOC 1NYEA 1IBKC 1KKGA 4X65C 1HR0C 4JI0C 4MH4A 3T1HC 2E7GA 4DV1C 4X64C 5FLXD 4LF6C 4DV7C 4XX2A 2HJGA 1N34C 2F4VC 2UXCC 2YCBA 4DV5C 2OPLB 2BJOA 2CY1A 4OX9C 4JI5C 4LFCC 3CJEA 5IT9D 2ONFA 4JI8C 3J7AD 2UU9C 1EGAA 2KZFA 2E8EA 4DCSA 4B3TC 4DR4C 4DV6C 1XMOC 1QWIA 3AF5A 1N2FA 1FJGC 1L2FA 1HNWC 1WF3A 2UUCC 5LMNC 3EERA 5IWAC 3R9WA 3R9XA 4MTNA 1J5EC 4LFBC 1HH2P 5A2QD 2QL8A 1PA4A 4K0KC 4DCTA 1XNRC 1IBMC 1WH9A 4BSZA 4X62C 4DV3C 1IBLC 4LF7C 3I07A 2JMPA 2E8CA 4LF8C 4JYAC 4JI2C 4DCUA 1ZB8A 4NXMC 1USPA 4DV4C 3T1YC 4DUZC 4DCVA 3J80D 2DYJA 4B3RC 4LF5C 4LF9C 1JOSA 4JI4C 4LF4C 1VLAA 2E8FA 2E5LC 4JI3C 4LFAC 2PN2A 4DR7C 1LQLA 4GKKC 1HNZC 2UUBC 1XNQC 5BR8C 4GKJC 1UKKA 2UXBC 4DR1C 3IEUA 4DUYC 4AQYC 1I94C 2ASBA 1MKYA 2CXCA 3GKUA 2VQFC 4B3MC 4JI6C 2ATWA 4YY3C 3LUSA 4NOZA 2UXDC 1USPB 4X66C 4B3SC
chains in the Genus database with same CATH superfamily
3H2TA 3GR1A 4PUIA 2OPLA 2BH1X 2PT7G 4DV0C 4DR6C 1GPMA 2YWCA 2PG1E 4KTTA 1YGTA 3UX2A 2YWBA 1XRCA 5AE1A 1MXCA 1MDBA 3N54B 4LF6C 3K6RA 4DV5C 5LCIA 2MM9A 3EQ6A 3A26A 4JI8C 2V7BA 4DR4C 4DV6C 3TQIA 4BC7A 5A1GA 3EERA 2P2FA 5IWAC 3L8CA 3AY0A 3FCCA 3A25A 4RLQA 1J5EC 3PROC 4BCAA 1PA4A 3ETOA 4DCTA 1XNRC 1WH9A 4L4QA 4X62C 4DV3C 5K8FA 4B3SC 3CQ1A 2CU6A 4JI2C 4DCUA 2NCLA 3RV2A 4RM2A 1VLAA 2E5LC 3TDEA 1M6XA 4GXQA 3S82A 4LFAC 4DR7C 2VZEA 4R1LA 5BURA 2D1RA 1O92A 1MXBA 4AQYC 2QVYX 4BC9A 4DG8A 2D1SA 4D56A 1USPB 1P4EA 5BSVA 4X66C 2D7VA 3NYRA 2VQEC 4D4IA 4KTVA 3IEVA 2P2JA 3N2QA 1TH5A 4JV5C 4EATA 1QM4A 1ML8A 1YJ7A 3PBKA 1WCJA 2EGTA 4RMNA 3J81D 4PROC 1XS3A 4DR2C 5H9UA 4ODJA 3A4IA 4DR5C 1N36C 2XR1A 3LNVA 4G1IA 2D27A 1HR0C 3T1HC 2E7GA 4R1MA 1NY8A 4X64C 1PU1A 1N34C 2HJGA 4PUHA 2UU9C 4JM1A 1AMUA 4DG9A 3E7WA 1QWIA 4WS9A 1FJGC 5IFIA 1L2FA 4ZJZA 2UUCC 5LMNC 3I08A 4LE5A 3R9WA 1PG3A 3R9XA 2VSQA 4LFBC 5K85A 1O90A 2QL8A 5T8SA 4K0KC 4RLFA 2KDNA 1T5DX 4IZ6A 2P2BA 1PG4A 2E8CA 4LF8C 3NYQA 1M6XC 5T8TA 1ZB8A 2Y27A 4DV4C 1XHJA 2DYJA 4B3RC 4LF5C 4LF9C 4JI4C 4OXIA 3CQ2A 4JI3C 5KYTA 1ULTA 1XRBA 1P4EC 5BR8C 4DR1C 2JNVA 3IEUA 3CQ3A 1MKYA 2VQFC 4B3MC 4L7IA 5BSWA 2UXDC 1FLOA 2OO4A 3G7SA 2ZM6C 4KHPC 1HNXC 2UUAC 1N33C 4DV2C 2P2QA 4YHHC 1N32C 3KXWA 4NXNC 3L95X 2D1QA 5LMUC 3JAMD 1XMQC 2HHHC 4WV3A 4RVOA 4ISBA 4K0BA 1XDXA 1RG9A 2Y4OA 3NPDA 4JI0C 1MD9A 3NI2A 4DV7C 4XX2A 2F4VC 2UXCC 2YCBA 2ZTBA 2OPLB 2BJOA 2CY1A 4OX9C 3TUFA 4JI5C 4LFCC 2AYAA 4G37A 1T5HX 1EGAA 2KZFA 1UWDA 4B3TC 4D57A 2WP0C 3SO4A 1P7LA 1IB8A 5KEIA 3AF5A 3UEBA 1LCIA 3RG2A 3TR3A 1HNWC 3CW8X 5E7QA 2D1TA 3LGXA 1HH2P 5A2QD 2D28C 5CZXA 5A19A 1IBLC 4LF7C 4I9FA 3I07A 2JMPA 3DHVA 5JRHA 1V26A 1XRAA 4NXMC 3C5EA 1USPA 3UOWA 4DCVA 4OYCA 2P02A 3J80D 2DHMA 4BBYA 1JOSA 2E8FA 2PN2A 1MDFA 4FUQA 2UUBC 4GS5A 2YX1A 1XNQC 3UZ0A 1MXAA 3E7XA 1UKKA 3R44A 3DLPX 3IMLA 2MCQA 5BSRA 1I94C 3GKUA 3VNQA 4YY3C 4FTFA 4DR3C 2E0GA 4JI1C 5CZVA 3FM7A 5A1IA 3GR0A 2KZ0A 3VNSA 1O9TA 2Y4NA 3A9UA 4JI7C 3AF6A 1ZB9A 1K0RA 2Z51A 3OTOC 1NYEA 1IBKC 1KKGA 4X65C 4MH4A 1RY2A 2QVZX 4DV1C 3B7WA 3IPLA 5FLXD 5DV9A 2P2MA 5KYVA 5AE3A 4GXRA 5BSMA 3CJEA 5IT9D 2ONFA 4FUTA 3J7AD 2PROA 3UX3A 2E8EA 4DCSA 4RVNA 4R0MA 1V60A 1XMOC 2MMAB 3LAXA 4RM3A 2ZZMA 1N2FA 3ETCA 1WF3A 2ZZNA 2M5HA 3LNOA 2OBVA 4D4GA 4MTNA 4ZLPA 4HPVA 1VEHA 1IBMC 4BSZA 2QVXX 5ADZA 3VNRA 5BUQA 1BA3A 3CW9A 3FCEA 5BSUA 3DAYA 5BUSA 4PZPA 4JYAC 4TPSB 3O2EA 1V25A 3T1YC 1FUGA 4DUZC 5BSTA 2M5OA 1O93A 2QW0X 3GPCA 4LF4C 2DPLA 3A9VA 1LQLA 4GKKC 1HNZC 4GKJC 2P20A 4I9GA 2UXBC 4L2ZA 4PHTA 4PUGA 4DUYC 4NDNA 2WD9A 2ASBA 5AE2A 2CXCA 4JI6C 4G36A 3PESA 2ATWA 3LUSA 4NOZA 5GTDA 4U5YD 4IR7A
chains in the Genus database with same CATH topology
3H2TA 3GR1A 2OPLA 2BH1X 2PT7G 4DV0C 4DR6C 1GPMA 2YWCA 4KTTA 2YWBA 1XRCA 5AE1A 1MXCA 1MDBA 3N54B 4LF6C 4DV5C 3EQ6A 4JI8C 2V7BA 4DR4C 4DV6C 3TQIA 4BC7A 5A1GA 3EERA 2P2FA 5IWAC 3L8CA 3FCCA 4RLQA 1J5EC 3PROC 4BCAA 1PA4A 3ETOA 4DCTA 1XNRC 1WH9A 4L4QA 4X62C 4DV3C 5K8FA 4B3SC 4JI2C 4DCUA 3RV2A 4RM2A 1VLAA 2E5LC 3TDEA 4LFAC 4GXQA 3S82A 4DR7C 2VZEA 4R1LA 5BURA 2D1RA 1O92A 1MXBA 4AQYC 2QVYX 4BC9A 4DG8A 2D1SA 4D56A 1USPB 5BSVA 4X66C 2D7VA 3NYRA 2VQEC 4D4IA 4KTVA 3IEVA 2P2JA 3N2QA 4JV5C 4EATA 1QM4A 1ML8A 1YJ7A 3PBKA 2EGTA 4RMNA 3J81D 4PROC 4DR2C 5H9UA 4ODJA 3A4IA 4DR5C 1N36C 2XR1A 3LNVA 4G1IA 2D27A 1HR0C 3T1HC 2E7GA 4R1MA 4X64C 1N34C 2HJGA 2UU9C 4JM1A 1AMUA 4DG9A 3E7WA 1QWIA 4WS9A 1FJGC 5IFIA 1L2FA 4ZJZA 2UUCC 5LMNC 3I08A 4LE5A 3R9WA 1PG3A 3R9XA 2VSQA 4LFBC 5K85A 1O90A 2QL8A 5T8SA 4K0KC 4RLFA 1T5DX 4IZ6A 2P2BA 1PG4A 2E8CA 4LF8C 3NYQA 5T8TA 1ZB8A 2Y27A 4DV4C 2DYJA 4B3RC 4LF5C 4LF9C 4JI4C 4OXIA 4JI3C 5KYTA 1ULTA 1XRBA 5BR8C 4DR1C 3IEUA 1MKYA 2VQFC 4B3MC 4L7IA 5BSWA 2UXDC 2OO4A 3G7SA 2ZM6C 4KHPC 1HNXC 2UUAC 1N33C 4DV2C 2P2QA 4YHHC 1N32C 3KXWA 4NXNC 3L95X 2D1QA 5LMUC 3JAMD 1XMQC 2HHHC 4WV3A 4RVOA 4ISBA 4K0BA 1RG9A 2Y4OA 3NPDA 4JI0C 1MD9A 3NI2A 4DV7C 4XX2A 2F4VC 2UXCC 2YCBA 2OPLB 2BJOA 2CY1A 4OX9C 3TUFA 4JI5C 4LFCC 2AYAA 4G37A 1T5HX 1EGAA 2KZFA 4B3TC 4D57A 2WP0C 3SO4A 1P7LA 5KEIA 3AF5A 1LCIA 3RG2A 1HNWC 3CW8X 5E7QA 2D1TA 3LGXA 1HH2P 5A2QD 2D28C 5CZXA 5A19A 1IBLC 4LF7C 4I9FA 3I07A 2JMPA 3DHVA 1V26A 1XRAA 4NXMC 5JRHA 3C5EA 1USPA 3UOWA 4DCVA 4OYCA 2P02A 3J80D 4BBYA 1JOSA 2E8FA 2PN2A 1MDFA 4FUQA 2UUBC 4GS5A 1XNQC 3UZ0A 1MXAA 3E7XA 1UKKA 3R44A 3DLPX 3IMLA 5BSRA 1I94C 3GKUA 3VNQA 4YY3C 4FTFA 4DR3C 2E0GA 4JI1C 5CZVA 5A1IA 3GR0A 3VNSA 1O9TA 2Y4NA 3A9UA 4JI7C 3AF6A 1ZB9A 1K0RA 3OTOC 1NYEA 1IBKC 1KKGA 4X65C 4MH4A 1RY2A 2QVZX 4DV1C 3B7WA 3IPLA 5FLXD 5DV9A 2P2MA 5KYVA 5AE3A 4GXRA 5BSMA 3CJEA 5IT9D 2ONFA 4FUTA 3J7AD 2PROA 2E8EA 4DCSA 4RVNA 4R0MA 1XMOC 3LAXA 4RM3A 1N2FA 3ETCA 1WF3A 2OBVA 4D4GA 4MTNA 4ZLPA 4HPVA 1IBMC 4BSZA 2QVXX 5ADZA 3VNRA 5BUQA 1BA3A 3CW9A 3FCEA 5BSUA 3DAYA 5BUSA 4PZPA 4JYAC 4TPSB 1V25A 3T1YC 1FUGA 4DUZC 5BSTA 1O93A 2QW0X 3GPCA 4LF4C 2DPLA 3A9VA 1LQLA 4GKKC 1HNZC 4GKJC 2P20A 4I9GA 2UXBC 4L2ZA 4PHTA 4DUYC 4NDNA 2WD9A 2ASBA 5AE2A 2CXCA 4JI6C 4G36A 3PESA 2ATWA 3LUSA 4NOZA 5GTDA 4U5YD 4IR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7V A;  2ZM6 C;  4DR3 C;  2VQE C;  3IEV A;  2OPL A;  4KHP C;  1HNX C;  4JV5 C;  2UUA C;  1N33 C;  4DV2 C;  2PT7 G;  4JI1 C;  4DV0 C;  4YHH C;  1ML8 A;  4DR6 C;  2EGT A;  1N32 C;  3J81 D;  4NXN C;  4DR2 C;  5LMU C;  3JAM D;  1XMQ C;  4DR5 C;  2HHH C;  1N36 C;  4JI7 C;  2XR1 A;  3AF6 A;  1ZB9 A;  1K0R A;  3OTO C;  1NYE A;  1IBK C;  1KKG A;  4X65 C;  1HR0 C;  4JI0 C;  4MH4 A;  3T1H C;  2E7G A;  4DV1 C;  4X64 C;  5FLX D;  4LF6 C;  4DV7 C;  4XX2 A;  2HJG A;  1N34 C;  2F4V C;  2UXC C;  2YCB A;  4DV5 C;  2OPL B;  2BJO A;  2CY1 A;  4OX9 C;  4JI5 C;  4LFC C;  3CJE A;  5IT9 D;  2ONF A;  4JI8 C;  3J7A D;  2UU9 C;  1EGA A;  2KZF A;  2E8E A;  4DCS A;  4B3T C;  4DR4 C;  4DV6 C;  1XMO C;  1QWI A;  3AF5 A;  1N2F A;  1FJG C;  1L2F A;  1HNW C;  1WF3 A;  2UUC C;  5LMN C;  3EER A;  5IWA C;  3R9W A;  3R9X A;  4MTN A;  1J5E C;  4LFB C;  1HH2 P;  5A2Q D;  2QL8 A;  1PA4 A;  4K0K C;  4DCT A;  1XNR C;  1IBM C;  1WH9 A;  4BSZ A;  4X62 C;  4DV3 C;  1IBL C;  4LF7 C;  3I07 A;  2JMP A;  2E8C A;  4LF8 C;  4JYA C;  4JI2 C;  4DCU A;  1ZB8 A;  4NXM C;  1USP A;  4DV4 C;  3T1Y C;  4DUZ C;  4DCV A;  3J80 D;  2DYJ A;  4B3R C;  4LF5 C;  4LF9 C;  1JOS A;  4JI4 C;  4LF4 C;  1VLA A;  2E8F A;  2E5L C;  4JI3 C;  4LFA C;  2PN2 A;  4DR7 C;  1LQL A;  4GKK C;  1HNZ C;  2UUB C;  1XNQ C;  5BR8 C;  4GKJ C;  1UKK A;  2UXB C;  4DR1 C;  3IEU A;  4DUY C;  4AQY C;  1I94 C;  2ASB A;  1MKY A;  2CXC A;  3GKU A;  2VQF C;  4B3M C;  4JI6 C;  2ATW A;  4YY3 C;  3LUS A;  4NOZ A;  2UXD C;  1USP B;  4X66 C;  4B3S C; 
#chains in the Genus database with same CATH topology
 3H2T A;  3GR1 A;  4PUI A;  2OPL A;  2BH1 X;  2PT7 G;  4DV0 C;  4DR6 C;  1GPM A;  2YWC A;  2PG1 E;  4KTT A;  1YGT A;  3UX2 A;  2YWB A;  1XRC A;  5AE1 A;  1MXC A;  1MDB A;  3N54 B;  4LF6 C;  3K6R A;  4DV5 C;  5LCI A;  2MM9 A;  3EQ6 A;  3A26 A;  4JI8 C;  2V7B A;  4DR4 C;  4DV6 C;  3TQI A;  4BC7 A;  5A1G A;  3EER A;  2P2F A;  5IWA C;  3L8C A;  3AY0 A;  3FCC A;  3A25 A;  4RLQ A;  1J5E C;  3PRO C;  4BCA A;  1PA4 A;  3ETO A;  4DCT A;  1XNR C;  1WH9 A;  4L4Q A;  4X62 C;  4DV3 C;  5K8F A;  4B3S C;  3CQ1 A;  2CU6 A;  4JI2 C;  4DCU A;  2NCL A;  3RV2 A;  4RM2 A;  1VLA A;  2E5L C;  3TDE A;  1M6X A;  4GXQ A;  3S82 A;  4LFA C;  4DR7 C;  2VZE A;  4R1L A;  5BUR A;  2D1R A;  1O92 A;  1MXB A;  4AQY C;  2QVY X;  4BC9 A;  4DG8 A;  2D1S A;  4D56 A;  1USP B;  1P4E A;  5BSV A;  4X66 C;  2D7V A;  3NYR A;  2VQE C;  4D4I A;  4KTV A;  3IEV A;  2P2J A;  3N2Q A;  1TH5 A;  4JV5 C;  4EAT A;  1QM4 A;  1ML8 A;  1YJ7 A;  3PBK A;  1WCJ A;  2EGT A;  4RMN A;  3J81 D;  4PRO C;  1XS3 A;  4DR2 C;  5H9U A;  4ODJ A;  3A4I A;  4DR5 C;  1N36 C;  2XR1 A;  3LNV A;  4G1I A;  2D27 A;  1HR0 C;  3T1H C;  2E7G A;  4R1M A;  1NY8 A;  4X64 C;  1PU1 A;  1N34 C;  2HJG A;  4PUH A;  2UU9 C;  4JM1 A;  1AMU A;  4DG9 A;  3E7W A;  1QWI A;  4WS9 A;  1FJG C;  5IFI A;  1L2F A;  4ZJZ A;  2UUC C;  5LMN C;  3I08 A;  4LE5 A;  3R9W A;  1PG3 A;  3R9X A;  2VSQ A;  4LFB C;  5K85 A;  1O90 A;  2QL8 A;  5T8S A;  4K0K C;  4RLF A;  2KDN A;  1T5D X;  4IZ6 A;  2P2B A;  1PG4 A;  2E8C A;  4LF8 C;  3NYQ A;  1M6X C;  5T8T A;  1ZB8 A;  2Y27 A;  4DV4 C;  1XHJ A;  2DYJ A;  4B3R C;  4LF5 C;  4LF9 C;  4JI4 C;  4OXI A;  3CQ2 A;  4JI3 C;  5KYT A;  1ULT A;  1XRB A;  1P4E C;  5BR8 C;  4DR1 C;  2JNV A;  3IEU A;  3CQ3 A;  1MKY A;  2VQF C;  4B3M C;  4L7I A;  5BSW A;  2UXD C;  1FLO A;  2OO4 A;  3G7S A;  2ZM6 C;  4KHP C;  1HNX C;  2UUA C;  1N33 C;  4DV2 C;  2P2Q A;  4YHH C;  1N32 C;  3KXW A;  4NXN C;  3L95 X;  2D1Q A;  5LMU C;  3JAM D;  1XMQ C;  2HHH C;  4WV3 A;  4RVO A;  4ISB A;  4K0B A;  1XDX A;  1RG9 A;  2Y4O A;  3NPD A;  4JI0 C;  1MD9 A;  3NI2 A;  4DV7 C;  4XX2 A;  2F4V C;  2UXC C;  2YCB A;  2ZTB A;  2OPL B;  2BJO A;  2CY1 A;  4OX9 C;  3TUF A;  4JI5 C;  4LFC C;  2AYA A;  4G37 A;  1T5H X;  1EGA A;  2KZF A;  1UWD A;  4B3T C;  4D57 A;  2WP0 C;  3SO4 A;  1P7L A;  1IB8 A;  5KEI A;  3AF5 A;  3UEB A;  1LCI A;  3RG2 A;  3TR3 A;  1HNW C;  3CW8 X;  5E7Q A;  2D1T A;  3LGX A;  1HH2 P;  5A2Q D;  2D28 C;  5CZX A;  5A19 A;  1IBL C;  4LF7 C;  4I9F A;  3I07 A;  2JMP A;  3DHV A;  5JRH A;  1V26 A;  1XRA A;  4NXM C;  3C5E A;  1USP A;  3UOW A;  4DCV A;  4OYC A;  2P02 A;  3J80 D;  2DHM A;  4BBY A;  1JOS A;  2E8F A;  2PN2 A;  1MDF A;  4FUQ A;  2UUB C;  4GS5 A;  2YX1 A;  1XNQ C;  3UZ0 A;  1MXA A;  3E7X A;  1UKK A;  3R44 A;  3DLP X;  3IML A;  2MCQ A;  5BSR A;  1I94 C;  3GKU A;  3VNQ A;  4YY3 C;  4FTF A;  4DR3 C;  2E0G A;  4JI1 C;  5CZV A;  3FM7 A;  5A1I A;  3GR0 A;  2KZ0 A;  3VNS A;  1O9T A;  2Y4N A;  3A9U A;  4JI7 C;  3AF6 A;  1ZB9 A;  1K0R A;  2Z51 A;  3OTO C;  1NYE A;  1IBK C;  1KKG A;  4X65 C;  4MH4 A;  1RY2 A;  2QVZ X;  4DV1 C;  3B7W A;  3IPL A;  5FLX D;  5DV9 A;  2P2M A;  5KYV A;  5AE3 A;  4GXR A;  5BSM A;  3CJE A;  5IT9 D;  2ONF A;  4FUT A;  3J7A D;  2PRO A;  3UX3 A;  2E8E A;  4DCS A;  4RVN A;  4R0M A;  1V60 A;  1XMO C;  2MMA B;  3LAX A;  4RM3 A;  2ZZM A;  1N2F A;  3ETC A;  1WF3 A;  2ZZN A;  2M5H A;  3LNO A;  2OBV A;  4D4G A;  4MTN A;  4ZLP A;  4HPV A;  1VEH A;  1IBM C;  4BSZ A;  2QVX X;  5ADZ A;  3VNR A;  5BUQ A;  1BA3 A;  3CW9 A;  3FCE A;  5BSU A;  3DAY A;  5BUS A;  4PZP A;  4JYA C;  4TPS B;  3O2E A;  1V25 A;  3T1Y C;  1FUG A;  4DUZ C;  5BST A;  2M5O A;  1O93 A;  2QW0 X;  3GPC A;  4LF4 C;  2DPL A;  3A9V A;  1LQL A;  4GKK C;  1HNZ C;  4GKJ C;  2P20 A;  4I9G A;  2UXB C;  4L2Z A;  4PHT A;  4PUG A;  4DUY C;  4NDN A;  2WD9 A;  2ASB A;  5AE2 A;  2CXC A;  4JI6 C;  4G36 A;  3PES A;  2ATW A;  3LUS A;  4NOZ A;  5GTD A;  4U5Y D;  4IR7 A; 
#chains in the Genus database with same CATH homology
 3H2T A;  3GR1 A;  2OPL A;  2BH1 X;  2PT7 G;  4DV0 C;  4DR6 C;  1GPM A;  2YWC A;  4KTT A;  2YWB A;  1XRC A;  5AE1 A;  1MXC A;  1MDB A;  3N54 B;  4LF6 C;  4DV5 C;  3EQ6 A;  4JI8 C;  2V7B A;  4DR4 C;  4DV6 C;  3TQI A;  4BC7 A;  5A1G A;  3EER A;  2P2F A;  5IWA C;  3L8C A;  3FCC A;  4RLQ A;  1J5E C;  3PRO C;  4BCA A;  1PA4 A;  3ETO A;  4DCT A;  1XNR C;  1WH9 A;  4L4Q A;  4X62 C;  4DV3 C;  5K8F A;  4B3S C;  4JI2 C;  4DCU A;  3RV2 A;  4RM2 A;  1VLA A;  2E5L C;  3TDE A;  4LFA C;  4GXQ A;  3S82 A;  4DR7 C;  2VZE A;  4R1L A;  5BUR A;  2D1R A;  1O92 A;  1MXB A;  4AQY C;  2QVY X;  4BC9 A;  4DG8 A;  2D1S A;  4D56 A;  1USP B;  5BSV A;  4X66 C;  2D7V A;  3NYR A;  2VQE C;  4D4I A;  4KTV A;  3IEV A;  2P2J A;  3N2Q A;  4JV5 C;  4EAT A;  1QM4 A;  1ML8 A;  1YJ7 A;  3PBK A;  2EGT A;  4RMN A;  3J81 D;  4PRO C;  4DR2 C;  5H9U A;  4ODJ A;  3A4I A;  4DR5 C;  1N36 C;  2XR1 A;  3LNV A;  4G1I A;  2D27 A;  1HR0 C;  3T1H C;  2E7G A;  4R1M A;  4X64 C;  1N34 C;  2HJG A;  2UU9 C;  4JM1 A;  1AMU A;  4DG9 A;  3E7W A;  1QWI A;  4WS9 A;  1FJG C;  5IFI A;  1L2F A;  4ZJZ A;  2UUC C;  5LMN C;  3I08 A;  4LE5 A;  3R9W A;  1PG3 A;  3R9X A;  2VSQ A;  4LFB C;  5K85 A;  1O90 A;  2QL8 A;  5T8S A;  4K0K C;  4RLF A;  1T5D X;  4IZ6 A;  2P2B A;  1PG4 A;  2E8C A;  4LF8 C;  3NYQ A;  5T8T A;  1ZB8 A;  2Y27 A;  4DV4 C;  2DYJ A;  4B3R C;  4LF5 C;  4LF9 C;  4JI4 C;  4OXI A;  4JI3 C;  5KYT A;  1ULT A;  1XRB A;  5BR8 C;  4DR1 C;  3IEU A;  1MKY A;  2VQF C;  4B3M C;  4L7I A;  5BSW A;  2UXD C;  2OO4 A;  3G7S A;  2ZM6 C;  4KHP C;  1HNX C;  2UUA C;  1N33 C;  4DV2 C;  2P2Q A;  4YHH C;  1N32 C;  3KXW A;  4NXN C;  3L95 X;  2D1Q A;  5LMU C;  3JAM D;  1XMQ C;  2HHH C;  4WV3 A;  4RVO A;  4ISB A;  4K0B A;  1RG9 A;  2Y4O A;  3NPD A;  4JI0 C;  1MD9 A;  3NI2 A;  4DV7 C;  4XX2 A;  2F4V C;  2UXC C;  2YCB A;  2OPL B;  2BJO A;  2CY1 A;  4OX9 C;  3TUF A;  4JI5 C;  4LFC C;  2AYA A;  4G37 A;  1T5H X;  1EGA A;  2KZF A;  4B3T C;  4D57 A;  2WP0 C;  3SO4 A;  1P7L A;  5KEI A;  3AF5 A;  1LCI A;  3RG2 A;  1HNW C;  3CW8 X;  5E7Q A;  2D1T A;  3LGX A;  1HH2 P;  5A2Q D;  2D28 C;  5CZX A;  5A19 A;  1IBL C;  4LF7 C;  4I9F A;  3I07 A;  2JMP A;  3DHV A;  1V26 A;  1XRA A;  4NXM C;  5JRH A;  3C5E A;  1USP A;  3UOW A;  4DCV A;  4OYC A;  2P02 A;  3J80 D;  4BBY A;  1JOS A;  2E8F A;  2PN2 A;  1MDF A;  4FUQ A;  2UUB C;  4GS5 A;  1XNQ C;  3UZ0 A;  1MXA A;  3E7X A;  1UKK A;  3R44 A;  3DLP X;  3IML A;  5BSR A;  1I94 C;  3GKU A;  3VNQ A;  4YY3 C;  4FTF A;  4DR3 C;  2E0G A;  4JI1 C;  5CZV A;  5A1I A;  3GR0 A;  3VNS A;  1O9T A;  2Y4N A;  3A9U A;  4JI7 C;  3AF6 A;  1ZB9 A;  1K0R A;  3OTO C;  1NYE A;  1IBK C;  1KKG A;  4X65 C;  4MH4 A;  1RY2 A;  2QVZ X;  4DV1 C;  3B7W A;  3IPL A;  5FLX D;  5DV9 A;  2P2M A;  5KYV A;  5AE3 A;  4GXR A;  5BSM A;  3CJE A;  5IT9 D;  2ONF A;  4FUT A;  3J7A D;  2PRO A;  2E8E A;  4DCS A;  4RVN A;  4R0M A;  1XMO C;  3LAX A;  4RM3 A;  1N2F A;  3ETC A;  1WF3 A;  2OBV A;  4D4G A;  4MTN A;  4ZLP A;  4HPV A;  1IBM C;  4BSZ A;  2QVX X;  5ADZ A;  3VNR A;  5BUQ A;  1BA3 A;  3CW9 A;  3FCE A;  5BSU A;  3DAY A;  5BUS A;  4PZP A;  4JYA C;  4TPS B;  1V25 A;  3T1Y C;  1FUG A;  4DUZ C;  5BST A;  1O93 A;  2QW0 X;  3GPC A;  4LF4 C;  2DPL A;  3A9V A;  1LQL A;  4GKK C;  1HNZ C;  4GKJ C;  2P20 A;  4I9G A;  2UXB C;  4L2Z A;  4PHT A;  4DUY C;  4NDN A;  2WD9 A;  2ASB A;  5AE2 A;  2CXC A;  4JI6 C;  4G36 A;  3PES A;  2ATW A;  3LUS A;  4NOZ A;  5GTD A;  4U5Y D;  4IR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...