4B3SC

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4b3sC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4b3sC02
1K0RA 1WH9A 4JI6C 2ONFA 3CJEA 4DCSA 1USPA 4DUYC 3J7AD 2CY1A 2PN2A 4LF7C 4DV3C 2F4VC 1USPB 2ATWA 4DUZC 4DV2C 3GKUA 4DR5C 1LQLA 2UXCC 1XNRC 3R9XA 4DV7C 1JOSA 2OPLB 4XX2A 2JMPA 4MH4A 5LMNC 2XR1A 1ZB9A 1EGAA 1HR0C 1MKYA 4LF9C 5IWAC 4DV1C 4X66C 1PA4A 3AF6A 4BSZA 2ASBA 3J80D 1IBKC 1ML8A 4JI1C 3R9WA 2HHHC 1NYEA 4JI0C 2CXCA 4DV0C 4JYAC 4JI2C 5LMUC 5IT9D 4B3RC 5FLXD 4B3SC 4DR6C 4JI7C 4DCTA 2DYJA 4GKKC 4DV6C 4DCUA 1UKKA 4DCVA 4X62C 2EGTA 5BR8C 3T1YC 1I94C 4OX9C 1N34C 1HNZC 2D7VA 2VQFC 2UUCC 4YY3C 1N2FA 4NXNC 1XNQC 1FJGC 3IEUA 1XMOC 2E8CA 3OTOC 1XMQC 1WF3A 2UU9C 3JAMD 3AF5A 4YHHC 2VQEC 4DV4C 4DR2C 3T1HC 2YCBA 4LF4C 2E5LC 2BJOA 3LUSA 4DR1C 1HNWC 2UXDC 4DR7C 4LF5C 4X65C 2UUAC 4LFAC 2ZM6C 2HJGA 4DR3C 5A2QD 1QWIA 3I07A 2KZFA 4JV5C 2PT7G 4B3MC 2QL8A 2E8FA 1KKGA 1IBMC 1J5EC 4GKJC 4LF8C 4JI4C 1N33C 1VLAA 2OPLA 4MTNA 4NXMC 1IBLC 4K0KC 3J81D 2UUBC 4DV5C 4AQYC 4DR4C 1HH2P 4JI8C 4LF6C 1ZB8A 1N32C 4JI3C 4KHPC 4LFCC 2E8EA 4X64C 1HNXC 4NOZA 4B3TC 1N36C 4LFBC 1L2FA 4JI5C 2E7GA 3IEVA 2UXBC 3EERA
chains in the Genus database with same CATH superfamily
1WH9A 4PUIA 4DCSA 5BSRA 5T8TA 3J7AD 2D28C 2YWBA 2YX1A 3CQ2A 5CZVA 5H9UA 1USPB 5AE2A 4DV2C 4U5YD 3H2TA 2OPLB 3DAYA 3N2QA 3VNSA 1EGAA 4BSZA 2ASBA 3J80D 4JI1C 2QVYX 3A25A 3TUFA 3CQ1A 3R44A 4FTFA 4DV0C 2QVXX 1PG4A 5BSUA 3L8CA 4B3SC 3LNOA 4WS9A 5JRHA 4DR6C 3I08A 4DCTA 3CW9A 4R0MA 4DV6C 4DCVA 4RM2A 5BUQA 1I94C 3UEBA 4BC9A 5BUSA 1HNZC 2MCQA 1XNQC 5KEIA 1AMUA 2P20A 3OTOC 3TDEA 3JAMD 4YHHC 4I9GA 2P2JA 2P02A 2KZ0A 1QM4A 4G1IA 1TH5A 4I9FA 4LFAC 2HJGA 4D57A 4OXIA 2E0GA 3ETCA 3I07A 4JV5C 4B3MC 1KKGA 1GPMA 1O9TA 1IBMC 2DHMA 1P7LA 3RG2A 5BSVA 1LCIA 3LNVA 4L7IA 4ZJZA 3J81D 2UUBC 4R1MA 4DR4C 1HH2P 1FLOA 3A9VA 3NPDA 3E7XA 1NY8A 3PBKA 4KHPC 1N32C 1V60A 2AYAA 3N54B 2ZTBA 2V7BA 1L2FA 4JI5C 4L2ZA 3CJEA 4DUYC 3LAXA 2CY1A 4TPSB 1M6XA 2PN2A 4LF7C 2CU6A 3FCEA 5A1GA 4ODJA 1MDBA 5BSWA 4DR5C 1LQLA 1FUGA 1YGTA 3UX3A 3R9XA 4G37A 4MH4A 1ZB9A 1HR0C 4K0BA 4RM3A 4DV1C 3TQIA 1IBKC 3A9UA 3R9WA 1NYEA 2CXCA 4NDNA 4HPVA 4JYAC 3S82A 1MXAA 4KTVA 5FLXD 2QW0X 4DCUA 5K8FA 4DG9A 2Z51A 4OX9C 1N34C 1PG3A 2D7VA 3IMLA 3VNQA 4RVNA 3DLPX 2VQEC 3T1HC 5AE3A 2BH1X 1M6XC 1HNWC 4DR7C 3NYRA 4RVOA 2ZM6C 4DR3C 1O90A 5A2QD 4GS5A 4RLQA 2E8FA 2WD9A 4GXQA 2Y27A 1VLAA 2OPLA 4MTNA 4BCAA 1T5HX 1T5DX 4KTTA 1MD9A 1N36C 4LFBC 4BBYA 1WCJA 3EQ6A 1UWDA 2E7GA 3IEVA 4RLFA 2UXDC 1K0RA 4JI6C 2NCLA 5IFIA 3LGXA 4BC7A 3A26A 2ZZMA 5CZXA 2D1RA 3UZ0A 1VEHA 4PUGA 4DUZC 2P2MA 1MXBA 2UXCC 1XNRC 4DV7C 1JOSA 4XX2A 2JMPA 5LMNC 2XR1A 5AE1A 3E7WA 2VZEA 1MKYA 4LF9C 2PG1E 5IWAC 4X66C 3AF6A 1RG9A 1ML8A 5T8SA 1MXCA 5E7QA 1XRBA 2WP0C 2HHHC 3GR0A 2P2FA 5GTDA 4B3RC 3SO4A 4JI7C 4OYCA 4FUQA 4GKKC 4RMNA 5LCIA 2MMAB 2EGTA 3T1YC 5BURA 2VSQA 4YY3C 4NXNC 3PROC 4IZ6A 2P2QA 3NI2A 1XMOC 3AY0A 5BSMA 4EATA 2D1SA 4ISBA 3FCCA 1WF3A 1RY2A 3AF5A 4DV4C 4LF4C 2E5LC 3RV2A 3G7SA 2BJOA 1V26A 4X65C 2UUAC 2M5OA 4LE5A 2PT7G 2QL8A 1J5EC 4GKJC 4D4GA 4JI4C 1N33C 1ULTA 5ADZA 2QVZX 3GPCA 4DV5C 4AQYC 2PROA 2ZZNA 4LF6C 3UX2A 1XRAA 2E8EA 4NOZA 4B3TC 3CQ3A 3FM7A 1BA3A 3VNRA 3C5EA 2KDNA 2Y4NA 1YJ7A 2ONFA 1USPA 3GR1A 2YWCA 5A1IA 4DV3C 2F4VC 2ATWA 4FUTA 3GKUA 4L4QA 2Y4OA 4GXRA 4PHTA 3CW8X 5DV9A 1PA4A 4R1LA 1O92A 2P2BA 4JM1A 1P4EC 3O2EA 4IR7A 1O93A 4JI0C 4JI2C 5LMUC 5IT9D 3ETOA 3IPLA 3KXWA 4DG8A 5KYTA 1XS3A 5BSTA 1XHJA 2DYJA 5KYVA 1UKKA 2DPLA 4X62C 5K85A 3UOWA 5BR8C 1MDFA 4D4IA 3NYQA 4PZPA 2VQFC 2UUCC 1N2FA 1FJGC 3IEUA 1V25A 2E8CA 1XMQC 2UU9C 4DR2C 2D1QA 2JNVA 2YCBA 2D27A 2MM9A 1XDXA 3LUSA 4DR1C 2OO4A 4WV3A 4LF5C 3B7WA 1XRCA 1QWIA 4PUHA 2KZFA 3K6RA 3PESA 4PROC 2OBVA 5A19A 4LF8C 3DHVA 4ZLPA 1PU1A 1IBLC 4K0KC 4NXMC 4D56A 4G36A 4JI8C 3TR3A 2M5HA 1ZB8A 3A4IA 3L95X 4JI3C 4LFCC 1P4EA 4X64C 1HNXC 2D1TA 1IB8A 2UXBC 3EERA
chains in the Genus database with same CATH topology
1WH9A 4DCSA 5BSRA 5T8TA 3J7AD 2D28C 2YWBA 5CZVA 5H9UA 1USPB 5AE2A 4DV2C 4U5YD 3H2TA 2OPLB 3DAYA 3N2QA 3VNSA 1EGAA 4BSZA 2ASBA 3J80D 4JI1C 2QVYX 3TUFA 3R44A 4FTFA 4DV0C 2QVXX 1PG4A 5BSUA 3L8CA 4B3SC 4WS9A 5JRHA 4DR6C 3I08A 4DCTA 3CW9A 4R0MA 4DV6C 4DCVA 4RM2A 5BUQA 1I94C 4BC9A 5BUSA 1HNZC 1XNQC 5KEIA 1AMUA 2P20A 3OTOC 3TDEA 3JAMD 4YHHC 4I9GA 2P2JA 2P02A 4G1IA 1QM4A 4I9FA 4LFAC 2HJGA 4D57A 4OXIA 2E0GA 3ETCA 3I07A 4JV5C 4B3MC 1KKGA 1GPMA 1O9TA 1IBMC 1P7LA 3RG2A 5BSVA 1LCIA 3LNVA 3J81D 4L7IA 4ZJZA 2UUBC 4R1MA 4DR4C 1HH2P 3A9VA 3NPDA 3E7XA 3PBKA 4KHPC 1N32C 2AYAA 3N54B 2V7BA 1L2FA 4JI5C 4L2ZA 3CJEA 4DUYC 3LAXA 2CY1A 4TPSB 2PN2A 4LF7C 3FCEA 5A1GA 4ODJA 1MDBA 5BSWA 4DR5C 1LQLA 1FUGA 3R9XA 4G37A 4MH4A 1ZB9A 1HR0C 4K0BA 4RM3A 4DV1C 3TQIA 1IBKC 3A9UA 3R9WA 1NYEA 2CXCA 4NDNA 4HPVA 4JYAC 3S82A 1MXAA 4KTVA 5FLXD 2QW0X 4DCUA 5K8FA 4DG9A 4OX9C 1N34C 1PG3A 2D7VA 3IMLA 3VNQA 4RVNA 3DLPX 2VQEC 3T1HC 5AE3A 2BH1X 1HNWC 4DR7C 3NYRA 4RVOA 2ZM6C 4DR3C 1O90A 5A2QD 4GS5A 4RLQA 2E8FA 2WD9A 4GXQA 2Y27A 1VLAA 2OPLA 4MTNA 4BCAA 1T5HX 1T5DX 4KTTA 1MD9A 1N36C 4LFBC 4BBYA 3EQ6A 2E7GA 3IEVA 4RLFA 2UXDC 1K0RA 4JI6C 5IFIA 3LGXA 4BC7A 5CZXA 2D1RA 3UZ0A 4DUZC 2P2MA 1MXBA 2UXCC 1XNRC 4DV7C 1JOSA 4XX2A 2JMPA 5LMNC 2XR1A 5AE1A 3E7WA 2VZEA 1MKYA 4LF9C 5IWAC 4X66C 3AF6A 1RG9A 1ML8A 5T8SA 1MXCA 5E7QA 1XRBA 2WP0C 2HHHC 3GR0A 2P2FA 5GTDA 4B3RC 3SO4A 4JI7C 4OYCA 4FUQA 4GKKC 4RMNA 2EGTA 3T1YC 5BURA 2VSQA 4YY3C 4NXNC 3PROC 4IZ6A 2P2QA 3NI2A 1XMOC 5BSMA 4EATA 2D1SA 4ISBA 3FCCA 1WF3A 1RY2A 3AF5A 4DV4C 4LF4C 2E5LC 3RV2A 3G7SA 2BJOA 1V26A 4X65C 2UUAC 4LE5A 2PT7G 2QL8A 1J5EC 4GKJC 4D4GA 4JI4C 1N33C 1ULTA 5ADZA 2QVZX 3GPCA 4DV5C 4AQYC 2PROA 4LF6C 1XRAA 2E8EA 4NOZA 4B3TC 1BA3A 3VNRA 3C5EA 2Y4NA 1YJ7A 2ONFA 1USPA 3GR1A 2YWCA 5A1IA 4DV3C 2F4VC 2ATWA 4FUTA 3GKUA 4L4QA 2Y4OA 4GXRA 4PHTA 3CW8X 5DV9A 1PA4A 4R1LA 1O92A 2P2BA 4JM1A 4IR7A 1O93A 4JI0C 4JI2C 5LMUC 5IT9D 3ETOA 3IPLA 3KXWA 4DG8A 5KYTA 5BSTA 2DYJA 5KYVA 1UKKA 2DPLA 4X62C 5K85A 3UOWA 5BR8C 1MDFA 4D4IA 3NYQA 4PZPA 2VQFC 2UUCC 1N2FA 1FJGC 3IEUA 1V25A 2E8CA 1XMQC 2UU9C 4DR2C 2D1QA 2YCBA 2D27A 3LUSA 4DR1C 2OO4A 4WV3A 4LF5C 3B7WA 1XRCA 1QWIA 2KZFA 3PESA 4PROC 2OBVA 5A19A 4LF8C 3DHVA 4ZLPA 1IBLC 4K0KC 4NXMC 4D56A 4G36A 4JI8C 1ZB8A 3A4IA 3L95X 4JI3C 4LFCC 4X64C 1HNXC 2D1TA 2UXBC 3EERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0R A;  1WH9 A;  4JI6 C;  2ONF A;  3CJE A;  4DCS A;  1USP A;  4DUY C;  3J7A D;  2CY1 A;  2PN2 A;  4LF7 C;  4DV3 C;  2F4V C;  1USP B;  2ATW A;  4DUZ C;  4DV2 C;  3GKU A;  4DR5 C;  1LQL A;  2UXC C;  1XNR C;  3R9X A;  4DV7 C;  1JOS A;  2OPL B;  4XX2 A;  2JMP A;  4MH4 A;  5LMN C;  2XR1 A;  1ZB9 A;  1EGA A;  1HR0 C;  1MKY A;  4LF9 C;  5IWA C;  4DV1 C;  4X66 C;  1PA4 A;  3AF6 A;  4BSZ A;  2ASB A;  3J80 D;  1IBK C;  1ML8 A;  4JI1 C;  3R9W A;  2HHH C;  1NYE A;  4JI0 C;  2CXC A;  4DV0 C;  4JYA C;  4JI2 C;  5LMU C;  5IT9 D;  4B3R C;  5FLX D;  4B3S C;  4DR6 C;  4JI7 C;  4DCT A;  2DYJ A;  4GKK C;  4DV6 C;  4DCU A;  1UKK A;  4DCV A;  4X62 C;  2EGT A;  5BR8 C;  3T1Y C;  1I94 C;  4OX9 C;  1N34 C;  1HNZ C;  2D7V A;  2VQF C;  2UUC C;  4YY3 C;  1N2F A;  4NXN C;  1XNQ C;  1FJG C;  3IEU A;  1XMO C;  2E8C A;  3OTO C;  1XMQ C;  1WF3 A;  2UU9 C;  3JAM D;  3AF5 A;  4YHH C;  2VQE C;  4DV4 C;  4DR2 C;  3T1H C;  2YCB A;  4LF4 C;  2E5L C;  2BJO A;  3LUS A;  4DR1 C;  1HNW C;  2UXD C;  4DR7 C;  4LF5 C;  4X65 C;  2UUA C;  4LFA C;  2ZM6 C;  2HJG A;  4DR3 C;  5A2Q D;  1QWI A;  3I07 A;  2KZF A;  4JV5 C;  2PT7 G;  4B3M C;  2QL8 A;  2E8F A;  1KKG A;  1IBM C;  1J5E C;  4GKJ C;  4LF8 C;  4JI4 C;  1N33 C;  1VLA A;  2OPL A;  4MTN A;  4NXM C;  1IBL C;  4K0K C;  3J81 D;  2UUB C;  4DV5 C;  4AQY C;  4DR4 C;  1HH2 P;  4JI8 C;  4LF6 C;  1ZB8 A;  1N32 C;  4JI3 C;  4KHP C;  4LFC C;  2E8E A;  4X64 C;  1HNX C;  4NOZ A;  4B3T C;  1N36 C;  4LFB C;  1L2F A;  4JI5 C;  2E7G A;  3IEV A;  2UXB C;  3EER A; 
#chains in the Genus database with same CATH topology
 1WH9 A;  4PUI A;  4DCS A;  5BSR A;  5T8T A;  3J7A D;  2D28 C;  2YWB A;  2YX1 A;  3CQ2 A;  5CZV A;  5H9U A;  1USP B;  5AE2 A;  4DV2 C;  4U5Y D;  3H2T A;  2OPL B;  3DAY A;  3N2Q A;  3VNS A;  1EGA A;  4BSZ A;  2ASB A;  3J80 D;  4JI1 C;  2QVY X;  3A25 A;  3TUF A;  3CQ1 A;  3R44 A;  4FTF A;  4DV0 C;  2QVX X;  1PG4 A;  5BSU A;  3L8C A;  4B3S C;  3LNO A;  4WS9 A;  5JRH A;  4DR6 C;  3I08 A;  4DCT A;  3CW9 A;  4R0M A;  4DV6 C;  4DCV A;  4RM2 A;  5BUQ A;  1I94 C;  3UEB A;  4BC9 A;  5BUS A;  1HNZ C;  2MCQ A;  1XNQ C;  5KEI A;  1AMU A;  2P20 A;  3OTO C;  3TDE A;  3JAM D;  4YHH C;  4I9G A;  2P2J A;  2P02 A;  2KZ0 A;  1QM4 A;  4G1I A;  1TH5 A;  4I9F A;  4LFA C;  2HJG A;  4D57 A;  4OXI A;  2E0G A;  3ETC A;  3I07 A;  4JV5 C;  4B3M C;  1KKG A;  1GPM A;  1O9T A;  1IBM C;  2DHM A;  1P7L A;  3RG2 A;  5BSV A;  1LCI A;  3LNV A;  4L7I A;  4ZJZ A;  3J81 D;  2UUB C;  4R1M A;  4DR4 C;  1HH2 P;  1FLO A;  3A9V A;  3NPD A;  3E7X A;  1NY8 A;  3PBK A;  4KHP C;  1N32 C;  1V60 A;  2AYA A;  3N54 B;  2ZTB A;  2V7B A;  1L2F A;  4JI5 C;  4L2Z A;  3CJE A;  4DUY C;  3LAX A;  2CY1 A;  4TPS B;  1M6X A;  2PN2 A;  4LF7 C;  2CU6 A;  3FCE A;  5A1G A;  4ODJ A;  1MDB A;  5BSW A;  4DR5 C;  1LQL A;  1FUG A;  1YGT A;  3UX3 A;  3R9X A;  4G37 A;  4MH4 A;  1ZB9 A;  1HR0 C;  4K0B A;  4RM3 A;  4DV1 C;  3TQI A;  1IBK C;  3A9U A;  3R9W A;  1NYE A;  2CXC A;  4NDN A;  4HPV A;  4JYA C;  3S82 A;  1MXA A;  4KTV A;  5FLX D;  2QW0 X;  4DCU A;  5K8F A;  4DG9 A;  2Z51 A;  4OX9 C;  1N34 C;  1PG3 A;  2D7V A;  3IML A;  3VNQ A;  4RVN A;  3DLP X;  2VQE C;  3T1H C;  5AE3 A;  2BH1 X;  1M6X C;  1HNW C;  4DR7 C;  3NYR A;  4RVO A;  2ZM6 C;  4DR3 C;  1O90 A;  5A2Q D;  4GS5 A;  4RLQ A;  2E8F A;  2WD9 A;  4GXQ A;  2Y27 A;  1VLA A;  2OPL A;  4MTN A;  4BCA A;  1T5H X;  1T5D X;  4KTT A;  1MD9 A;  1N36 C;  4LFB C;  4BBY A;  1WCJ A;  3EQ6 A;  1UWD A;  2E7G A;  3IEV A;  4RLF A;  2UXD C;  1K0R A;  4JI6 C;  2NCL A;  5IFI A;  3LGX A;  4BC7 A;  3A26 A;  2ZZM A;  5CZX A;  2D1R A;  3UZ0 A;  1VEH A;  4PUG A;  4DUZ C;  2P2M A;  1MXB A;  2UXC C;  1XNR C;  4DV7 C;  1JOS A;  4XX2 A;  2JMP A;  5LMN C;  2XR1 A;  5AE1 A;  3E7W A;  2VZE A;  1MKY A;  4LF9 C;  2PG1 E;  5IWA C;  4X66 C;  3AF6 A;  1RG9 A;  1ML8 A;  5T8S A;  1MXC A;  5E7Q A;  1XRB A;  2WP0 C;  2HHH C;  3GR0 A;  2P2F A;  5GTD A;  4B3R C;  3SO4 A;  4JI7 C;  4OYC A;  4FUQ A;  4GKK C;  4RMN A;  5LCI A;  2MMA B;  2EGT A;  3T1Y C;  5BUR A;  2VSQ A;  4YY3 C;  4NXN C;  3PRO C;  4IZ6 A;  2P2Q A;  3NI2 A;  1XMO C;  3AY0 A;  5BSM A;  4EAT A;  2D1S A;  4ISB A;  3FCC A;  1WF3 A;  1RY2 A;  3AF5 A;  4DV4 C;  4LF4 C;  2E5L C;  3RV2 A;  3G7S A;  2BJO A;  1V26 A;  4X65 C;  2UUA C;  2M5O A;  4LE5 A;  2PT7 G;  2QL8 A;  1J5E C;  4GKJ C;  4D4G A;  4JI4 C;  1N33 C;  1ULT A;  5ADZ A;  2QVZ X;  3GPC A;  4DV5 C;  4AQY C;  2PRO A;  2ZZN A;  4LF6 C;  3UX2 A;  1XRA A;  2E8E A;  4NOZ A;  4B3T C;  3CQ3 A;  3FM7 A;  1BA3 A;  3VNR A;  3C5E A;  2KDN A;  2Y4N A;  1YJ7 A;  2ONF A;  1USP A;  3GR1 A;  2YWC A;  5A1I A;  4DV3 C;  2F4V C;  2ATW A;  4FUT A;  3GKU A;  4L4Q A;  2Y4O A;  4GXR A;  4PHT A;  3CW8 X;  5DV9 A;  1PA4 A;  4R1L A;  1O92 A;  2P2B A;  4JM1 A;  1P4E C;  3O2E A;  4IR7 A;  1O93 A;  4JI0 C;  4JI2 C;  5LMU C;  5IT9 D;  3ETO A;  3IPL A;  3KXW A;  4DG8 A;  5KYT A;  1XS3 A;  5BST A;  1XHJ A;  2DYJ A;  5KYV A;  1UKK A;  2DPL A;  4X62 C;  5K85 A;  3UOW A;  5BR8 C;  1MDF A;  4D4I A;  3NYQ A;  4PZP A;  2VQF C;  2UUC C;  1N2F A;  1FJG C;  3IEU A;  1V25 A;  2E8C A;  1XMQ C;  2UU9 C;  4DR2 C;  2D1Q A;  2JNV A;  2YCB A;  2D27 A;  2MM9 A;  1XDX A;  3LUS A;  4DR1 C;  2OO4 A;  4WV3 A;  4LF5 C;  3B7W A;  1XRC A;  1QWI A;  4PUH A;  2KZF A;  3K6R A;  3PES A;  4PRO C;  2OBV A;  5A19 A;  4LF8 C;  3DHV A;  4ZLP A;  1PU1 A;  1IBL C;  4K0K C;  4NXM C;  4D56 A;  4G36 A;  4JI8 C;  3TR3 A;  2M5H A;  1ZB8 A;  3A4I A;  3L95 X;  4JI3 C;  4LFC C;  1P4E A;  4X64 C;  1HNX C;  2D1T A;  1IB8 A;  2UXB C;  3EER A; 
#chains in the Genus database with same CATH homology
 1WH9 A;  4DCS A;  5BSR A;  5T8T A;  3J7A D;  2D28 C;  2YWB A;  5CZV A;  5H9U A;  1USP B;  5AE2 A;  4DV2 C;  4U5Y D;  3H2T A;  2OPL B;  3DAY A;  3N2Q A;  3VNS A;  1EGA A;  4BSZ A;  2ASB A;  3J80 D;  4JI1 C;  2QVY X;  3TUF A;  3R44 A;  4FTF A;  4DV0 C;  2QVX X;  1PG4 A;  5BSU A;  3L8C A;  4B3S C;  4WS9 A;  5JRH A;  4DR6 C;  3I08 A;  4DCT A;  3CW9 A;  4R0M A;  4DV6 C;  4DCV A;  4RM2 A;  5BUQ A;  1I94 C;  4BC9 A;  5BUS A;  1HNZ C;  1XNQ C;  5KEI A;  1AMU A;  2P20 A;  3OTO C;  3TDE A;  3JAM D;  4YHH C;  4I9G A;  2P2J A;  2P02 A;  4G1I A;  1QM4 A;  4I9F A;  4LFA C;  2HJG A;  4D57 A;  4OXI A;  2E0G A;  3ETC A;  3I07 A;  4JV5 C;  4B3M C;  1KKG A;  1GPM A;  1O9T A;  1IBM C;  1P7L A;  3RG2 A;  5BSV A;  1LCI A;  3LNV A;  3J81 D;  4L7I A;  4ZJZ A;  2UUB C;  4R1M A;  4DR4 C;  1HH2 P;  3A9V A;  3NPD A;  3E7X A;  3PBK A;  4KHP C;  1N32 C;  2AYA A;  3N54 B;  2V7B A;  1L2F A;  4JI5 C;  4L2Z A;  3CJE A;  4DUY C;  3LAX A;  2CY1 A;  4TPS B;  2PN2 A;  4LF7 C;  3FCE A;  5A1G A;  4ODJ A;  1MDB A;  5BSW A;  4DR5 C;  1LQL A;  1FUG A;  3R9X A;  4G37 A;  4MH4 A;  1ZB9 A;  1HR0 C;  4K0B A;  4RM3 A;  4DV1 C;  3TQI A;  1IBK C;  3A9U A;  3R9W A;  1NYE A;  2CXC A;  4NDN A;  4HPV A;  4JYA C;  3S82 A;  1MXA A;  4KTV A;  5FLX D;  2QW0 X;  4DCU A;  5K8F A;  4DG9 A;  4OX9 C;  1N34 C;  1PG3 A;  2D7V A;  3IML A;  3VNQ A;  4RVN A;  3DLP X;  2VQE C;  3T1H C;  5AE3 A;  2BH1 X;  1HNW C;  4DR7 C;  3NYR A;  4RVO A;  2ZM6 C;  4DR3 C;  1O90 A;  5A2Q D;  4GS5 A;  4RLQ A;  2E8F A;  2WD9 A;  4GXQ A;  2Y27 A;  1VLA A;  2OPL A;  4MTN A;  4BCA A;  1T5H X;  1T5D X;  4KTT A;  1MD9 A;  1N36 C;  4LFB C;  4BBY A;  3EQ6 A;  2E7G A;  3IEV A;  4RLF A;  2UXD C;  1K0R A;  4JI6 C;  5IFI A;  3LGX A;  4BC7 A;  5CZX A;  2D1R A;  3UZ0 A;  4DUZ C;  2P2M A;  1MXB A;  2UXC C;  1XNR C;  4DV7 C;  1JOS A;  4XX2 A;  2JMP A;  5LMN C;  2XR1 A;  5AE1 A;  3E7W A;  2VZE A;  1MKY A;  4LF9 C;  5IWA C;  4X66 C;  3AF6 A;  1RG9 A;  1ML8 A;  5T8S A;  1MXC A;  5E7Q A;  1XRB A;  2WP0 C;  2HHH C;  3GR0 A;  2P2F A;  5GTD A;  4B3R C;  3SO4 A;  4JI7 C;  4OYC A;  4FUQ A;  4GKK C;  4RMN A;  2EGT A;  3T1Y C;  5BUR A;  2VSQ A;  4YY3 C;  4NXN C;  3PRO C;  4IZ6 A;  2P2Q A;  3NI2 A;  1XMO C;  5BSM A;  4EAT A;  2D1S A;  4ISB A;  3FCC A;  1WF3 A;  1RY2 A;  3AF5 A;  4DV4 C;  4LF4 C;  2E5L C;  3RV2 A;  3G7S A;  2BJO A;  1V26 A;  4X65 C;  2UUA C;  4LE5 A;  2PT7 G;  2QL8 A;  1J5E C;  4GKJ C;  4D4G A;  4JI4 C;  1N33 C;  1ULT A;  5ADZ A;  2QVZ X;  3GPC A;  4DV5 C;  4AQY C;  2PRO A;  4LF6 C;  1XRA A;  2E8E A;  4NOZ A;  4B3T C;  1BA3 A;  3VNR A;  3C5E A;  2Y4N A;  1YJ7 A;  2ONF A;  1USP A;  3GR1 A;  2YWC A;  5A1I A;  4DV3 C;  2F4V C;  2ATW A;  4FUT A;  3GKU A;  4L4Q A;  2Y4O A;  4GXR A;  4PHT A;  3CW8 X;  5DV9 A;  1PA4 A;  4R1L A;  1O92 A;  2P2B A;  4JM1 A;  4IR7 A;  1O93 A;  4JI0 C;  4JI2 C;  5LMU C;  5IT9 D;  3ETO A;  3IPL A;  3KXW A;  4DG8 A;  5KYT A;  5BST A;  2DYJ A;  5KYV A;  1UKK A;  2DPL A;  4X62 C;  5K85 A;  3UOW A;  5BR8 C;  1MDF A;  4D4I A;  3NYQ A;  4PZP A;  2VQF C;  2UUC C;  1N2F A;  1FJG C;  3IEU A;  1V25 A;  2E8C A;  1XMQ C;  2UU9 C;  4DR2 C;  2D1Q A;  2YCB A;  2D27 A;  3LUS A;  4DR1 C;  2OO4 A;  4WV3 A;  4LF5 C;  3B7W A;  1XRC A;  1QWI A;  2KZF A;  3PES A;  4PRO C;  2OBV A;  5A19 A;  4LF8 C;  3DHV A;  4ZLP A;  1IBL C;  4K0K C;  4NXM C;  4D56 A;  4G36 A;  4JI8 C;  1ZB8 A;  3A4I A;  3L95 X;  4JI3 C;  4LFC C;  4X64 C;  1HNX C;  2D1T A;  2UXB C;  3EER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...