4DV4C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv4C02
4LF4C 2CY1A 1HNXC 5LMNC 2ATWA 1XMQC 1LQLA 4DR5C 3I07A 4B3RC 3GKUA 1N33C 4AQYC 2EGTA 2KZFA 4DR3C 2D7VA 2E5LC 4LF6C 4LF5C 4NXNC 4X64C 4JYAC 4LF7C 2E8EA 3R9XA 4JI5C 4DV6C 3AF6A 4GKKC 1N32C 1QWIA 2BJOA 2VQFC 1HR0C 4DR2C 1JOSA 5A2QD 2UUAC 1XNRC 4DR6C 4B3TC 4JI6C 2UXBC 2JMPA 1XNQC 4DCSA 1N34C 2QL8A 2F4VC 4DR4C 4DV4C 1UKKA 3CJEA 1ZB8A 3J80D 1FJGC 4B3MC 4DCVA 3T1YC 3AF5A 4K0KC 1WF3A 1HNZC 1IBMC 1K0RA 3JAMD 3EERA 5LMUC 4JV5C 3OTOC 4DV1C 2ONFA 4MH4A 1ML8A 4BSZA 2E8FA 4DUZC 4JI2C 4DUYC 2UUCC 1WH9A 1J5EC 4DV2C 2ASBA 4LF8C 1MKYA 2XR1A 2DYJA 4JI8C 5BR8C 1EGAA 3R9WA 3J81D 1PA4A 4NXMC 2YCBA 1IBKC 1VLAA 4X66C 4JI7C 4DR7C 2E8CA 4YY3C 1N36C 4X65C 4KHPC 4JI1C 2UXDC 4X62C 1L2FA 1I94C 1USPA 3LUSA 4YHHC 5FLXD 3IEVA 4XX2A 4GKJC 4LFBC 1USPB 4DCUA 4LFAC 2OPLA 5IWAC 2HHHC 4DV5C 2UUBC 4LFCC 3T1HC 2OPLB 2VQEC 4DV0C 2UU9C 1NYEA 4JI4C 2HJGA 1N2FA 5IT9D 4B3SC 4DV3C 1XMOC 4DV7C 3J7AD 2CXCA 4NOZA 1HH2P 2ZM6C 1HNWC 4LF9C 1KKGA 4OX9C 2PN2A 4DCTA 3IEUA 2PT7G 1ZB9A 4MTNA 2E7GA 1IBLC 2UXCC 4JI0C 4JI3C 4DR1C
chains in the Genus database with same CATH superfamily
2QVXX 5LMNC 4HPVA 3TDEA 4B3RC 4D4GA 3LAXA 4U5YD 3L8CA 4LF6C 3VNSA 3L95X 4RMNA 4PUHA 4RVOA 4LF7C 2E8EA 4G37A 4GKKC 3AF6A 3G7SA 4JM1A 5GTDA 4DR2C 1JOSA 5A2QD 3EQ6A 2JMPA 1XNQC 1N34C 2F4VC 3A4IA 4DR4C 1UKKA 1ZB8A 4KTVA 1XRCA 3AY0A 2MMAB 3C5EA 4B3MC 4R1MA 3T1YC 4FTFA 4RVNA 2VSQA 1P4EA 4K0BA 4RM2A 3O2EA 2Z51A 4ISBA 1ML8A 1RG9A 2M5OA 4I9GA 4DUZC 1WH9A 2ASBA 1XRAA 1MXAA 1T5DX 2KZ0A 4JI8C 1WCJA 3LNVA 1PA4A 2YWCA 1IBKC 1V25A 2P2JA 4JI7C 4I9FA 4X65C 4KHPC 4PZPA 5JRHA 3S82A 3VNRA 2P2BA 3LUSA 5BSMA 3PESA 1FUGA 2HHHC 2VZEA 4DV5C 2M5HA 5BSWA 2Y4NA 3T1HC 2PG1E 5KYVA 2HJGA 4BC9A 1FLOA 2PN2A 3IEUA 3A9UA 2E7GA 4IZ6A 1MXCA 1BA3A 2UXCC 1M6XA 4DR1C 1HNXC 2ATWA 2P2MA 2QW0X 3NPDA 2QVZX 4RLFA 2D1TA 2DPLA 5BSRA 1N33C 2OBVA 5BUQA 1VEHA 2D7VA 2E5LC 5CZVA 4LF5C 5ADZA 4JYAC 3N2QA 4GS5A 5LCIA 4RM3A 1PG4A 4JI6C 3DAYA 2P20A 3UX3A 3FM7A 2MCQA 2P2FA 3NI2A 1O92A 3IPLA 3PBKA 5AE1A 1YGTA 3CW9A 5LMUC 2P2QA 4DV1C 2ONFA 4MH4A 2E8FA 1V60A 2MM9A 4LE5A 2DYJA 3FCEA 3TQIA 5BR8C 3R9WA 4NXMC 2YCBA 3A25A 5BSTA 2E8CA 4YY3C 3I08A 2ZTBA 4R0MA 4JI1C 4OYCA 1I94C 3ETOA 1P4EC 4XX2A 4LFAC 4IR7A 2Y27A 5DV9A 2ZZMA 2D1RA 2OPLB 4PUIA 4DV0C 3K6RA 2UU9C 4JI4C 3ETCA 2Y4OA 4DV7C 3J7AD 3PROC 1HH2P 4BC7A 4DCTA 5CZXA 2D28C 3CQ2A 1IB8A 1IBLC 4ZLPA 3B7WA 4LF4C 3E7XA 3N54B 2P02A 2ZZNA 3VNQA 1M6XC 2YWBA 3GKUA 3RV2A 4AQYC 2KZFA 4KTTA 5A1GA 4RLQA 1AMUA 4D56A 3R9XA 1XS3A 1QWIA 2BJOA 2VQFC 1HR0C 3R44A 5BSUA 1ULTA 4FUQA 4DR6C 2UXBC 1XRBA 2QL8A 3DHVA 3CJEA 3J80D 1FJGC 3TR3A 1O93A 3GR0A 4BBYA 4K0KC 1MDFA 4G1IA 1IBMC 1K0RA 3JAMD 4BCAA 3OTOC 3IMLA 4BSZA 4JI2C 4DUYC 2V7BA 1J5EC 4LF8C 1MKYA 2OO4A 4TPSB 4WS9A 4L7IA 2DHMA 3J81D 1VLAA 3GPCA 4X66C 5BUSA 1O9TA 4D4IA 1T5HX 2D1QA 2UXDC 4DG8A 4X62C 1L2FA 3KXWA 3IEVA 4LFBC 4GKJC 1USPB 2QVYX 4DCUA 5IWAC 5AE2A 4G36A 2E0GA 3A9VA 2UUBC 1MXBA 4FUTA 1PU1A 4LFCC 5T8TA 3E7WA 2JNVA 4WV3A 5AE3A 1N2FA 4GXRA 4B3SC 4DV3C 3NYQA 2CXCA 4NOZA 2ZM6C 1HNWC 3NYRA 1KKGA 5KYTA 1ZB9A 3SO4A 2PROA 3UX2A 2CY1A 1XMQC 3CW8X 1LQLA 4DR5C 3I07A 4ODJA 4OXIA 2EGTA 5A19A 4DR3C 4PROC 5IFIA 1P7LA 1O90A 4NXNC 4X64C 4R1LA 1N32C 1NY8A 5KEIA 4JI5C 4DV6C 2UUAC 1XNRC 4B3TC 4NDNA 4DG9A 4EATA 2YX1A 3H2TA 4DCSA 5T8SA 5BSVA 4DV4C 2KDNA 5BURA 2D27A 2NCLA 4DCVA 5K8FA 3AF5A 3UZ0A 1WF3A 1HNZC 3CQ3A 3EERA 1YJ7A 4JV5C 1MD9A 2WP0C 2UUCC 5K85A 4DV2C 4PHTA 2XR1A 1RY2A 2BH1X 4ZJZA 1EGAA 3LNOA 5A1IA 1MDBA 1XHJA 3TUFA 4L2ZA 4DR7C 1N36C 1LCIA 5H9UA 3GR1A 1UWDA 1USPA 4YHHC 5FLXD 3LGXA 5E7QA 3FCCA 2OPLA 2CU6A 2D1SA 3UOWA 1TH5A 3CQ1A 3UEBA 2VQEC 2AYAA 1NYEA 3A26A 5IT9D 3DLPX 1XMOC 1QM4A 1V26A 1PG3A 4D57A 4LF9C 4OX9C 1GPMA 3RG2A 2PT7G 2WD9A 4L4QA 4MTNA 4PUGA 1XDXA 4GXQA 4JI0C 4JI3C
chains in the Genus database with same CATH topology
2QVXX 5LMNC 4HPVA 3TDEA 4B3RC 4D4GA 3LAXA 4U5YD 3L8CA 4LF6C 3VNSA 3L95X 4RMNA 4RVOA 4LF7C 2E8EA 4G37A 4GKKC 3AF6A 3G7SA 4JM1A 5GTDA 4DR2C 1JOSA 5A2QD 3EQ6A 2JMPA 1XNQC 1N34C 2F4VC 3A4IA 4DR4C 1UKKA 1ZB8A 4KTVA 1XRCA 3C5EA 4B3MC 4R1MA 3T1YC 4FTFA 4RVNA 2VSQA 4K0BA 4RM2A 4ISBA 1ML8A 1RG9A 4I9GA 4DUZC 1WH9A 2ASBA 1XRAA 1MXAA 1T5DX 4JI8C 3LNVA 1PA4A 2YWCA 1IBKC 1V25A 2P2JA 4JI7C 4I9FA 4X65C 4KHPC 4PZPA 5JRHA 3S82A 3VNRA 2P2BA 3LUSA 5BSMA 3PESA 1FUGA 2HHHC 2VZEA 4DV5C 5BSWA 2Y4NA 3T1HC 5KYVA 2HJGA 4BC9A 2PN2A 3IEUA 3A9UA 2E7GA 4IZ6A 1MXCA 1BA3A 2UXCC 4DR1C 1HNXC 2ATWA 2P2MA 2QW0X 3NPDA 2QVZX 4RLFA 2D1TA 2DPLA 5BSRA 1N33C 2OBVA 5BUQA 2D7VA 2E5LC 5CZVA 4LF5C 5ADZA 4JYAC 3N2QA 4GS5A 4RM3A 1PG4A 4JI6C 3DAYA 2P20A 2P2FA 3NI2A 1O92A 3IPLA 3PBKA 5AE1A 3CW9A 5LMUC 2P2QA 4DV1C 2ONFA 4MH4A 2E8FA 4LE5A 2DYJA 3FCEA 3TQIA 5BR8C 3R9WA 4NXMC 2YCBA 5BSTA 2E8CA 4YY3C 3I08A 4R0MA 4JI1C 4OYCA 1I94C 3ETOA 4XX2A 4LFAC 4IR7A 2Y27A 5DV9A 2D1RA 2OPLB 4DV0C 2UU9C 4JI4C 3ETCA 2Y4OA 4DV7C 3J7AD 3PROC 1HH2P 4BC7A 4DCTA 5CZXA 2D28C 1IBLC 4ZLPA 3B7WA 4LF4C 3E7XA 3N54B 2P02A 3VNQA 2YWBA 3GKUA 3RV2A 4AQYC 2KZFA 4KTTA 5A1GA 4RLQA 1AMUA 4D56A 3R9XA 1QWIA 2BJOA 2VQFC 1HR0C 3R44A 5BSUA 1ULTA 4FUQA 4DR6C 2UXBC 1XRBA 2QL8A 3DHVA 3CJEA 3J80D 1FJGC 1O93A 3GR0A 4BBYA 4K0KC 1MDFA 4G1IA 1IBMC 1K0RA 3JAMD 4BCAA 3OTOC 3IMLA 4BSZA 4JI2C 4DUYC 2V7BA 1J5EC 4LF8C 1MKYA 2OO4A 4TPSB 4WS9A 4L7IA 3J81D 1VLAA 3GPCA 4X66C 5BUSA 1O9TA 4D4IA 1T5HX 2D1QA 2UXDC 4DG8A 4X62C 1L2FA 3KXWA 3IEVA 4LFBC 4GKJC 1USPB 2QVYX 4DCUA 5IWAC 5AE2A 4G36A 2E0GA 3A9VA 2UUBC 1MXBA 4FUTA 4LFCC 5T8TA 3E7WA 4WV3A 5AE3A 1N2FA 4GXRA 4B3SC 4DV3C 3NYQA 2CXCA 4NOZA 2ZM6C 1HNWC 3NYRA 1KKGA 5KYTA 1ZB9A 3SO4A 2PROA 2CY1A 1XMQC 3CW8X 1LQLA 4DR5C 3I07A 4ODJA 4OXIA 2EGTA 5A19A 4DR3C 4PROC 5IFIA 1P7LA 1O90A 4NXNC 4X64C 4R1LA 1N32C 5KEIA 4JI5C 4DV6C 2UUAC 1XNRC 4B3TC 4NDNA 4DG9A 4EATA 4DCSA 3H2TA 5T8SA 5BSVA 4DV4C 5BURA 2D27A 4DCVA 5K8FA 3AF5A 3UZ0A 1WF3A 1HNZC 3EERA 1YJ7A 4JV5C 1MD9A 2WP0C 2UUCC 5K85A 4DV2C 4PHTA 2XR1A 1RY2A 2BH1X 4ZJZA 1EGAA 5A1IA 1MDBA 3TUFA 4L2ZA 4DR7C 1N36C 1LCIA 5H9UA 3GR1A 1USPA 4YHHC 5FLXD 3LGXA 5E7QA 3FCCA 2OPLA 2D1SA 3UOWA 2VQEC 2AYAA 1NYEA 5IT9D 3DLPX 1XMOC 1QM4A 1V26A 1PG3A 4D57A 4LF9C 4OX9C 1GPMA 3RG2A 2PT7G 2WD9A 4L4QA 4MTNA 4GXQA 4JI0C 4JI3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 C;  2CY1 A;  1HNX C;  5LMN C;  2ATW A;  1XMQ C;  1LQL A;  4DR5 C;  3I07 A;  4B3R C;  3GKU A;  1N33 C;  4AQY C;  2EGT A;  2KZF A;  4DR3 C;  2D7V A;  2E5L C;  4LF6 C;  4LF5 C;  4NXN C;  4X64 C;  4JYA C;  4LF7 C;  2E8E A;  3R9X A;  4JI5 C;  4DV6 C;  3AF6 A;  4GKK C;  1N32 C;  1QWI A;  2BJO A;  2VQF C;  1HR0 C;  4DR2 C;  1JOS A;  5A2Q D;  2UUA C;  1XNR C;  4DR6 C;  4B3T C;  4JI6 C;  2UXB C;  2JMP A;  1XNQ C;  4DCS A;  1N34 C;  2QL8 A;  2F4V C;  4DR4 C;  4DV4 C;  1UKK A;  3CJE A;  1ZB8 A;  3J80 D;  1FJG C;  4B3M C;  4DCV A;  3T1Y C;  3AF5 A;  4K0K C;  1WF3 A;  1HNZ C;  1IBM C;  1K0R A;  3JAM D;  3EER A;  5LMU C;  4JV5 C;  3OTO C;  4DV1 C;  2ONF A;  4MH4 A;  1ML8 A;  4BSZ A;  2E8F A;  4DUZ C;  4JI2 C;  4DUY C;  2UUC C;  1WH9 A;  1J5E C;  4DV2 C;  2ASB A;  4LF8 C;  1MKY A;  2XR1 A;  2DYJ A;  4JI8 C;  5BR8 C;  1EGA A;  3R9W A;  3J81 D;  1PA4 A;  4NXM C;  2YCB A;  1IBK C;  1VLA A;  4X66 C;  4JI7 C;  4DR7 C;  2E8C A;  4YY3 C;  1N36 C;  4X65 C;  4KHP C;  4JI1 C;  2UXD C;  4X62 C;  1L2F A;  1I94 C;  1USP A;  3LUS A;  4YHH C;  5FLX D;  3IEV A;  4XX2 A;  4GKJ C;  4LFB C;  1USP B;  4DCU A;  4LFA C;  2OPL A;  5IWA C;  2HHH C;  4DV5 C;  2UUB C;  4LFC C;  3T1H C;  2OPL B;  2VQE C;  4DV0 C;  2UU9 C;  1NYE A;  4JI4 C;  2HJG A;  1N2F A;  5IT9 D;  4B3S C;  4DV3 C;  1XMO C;  4DV7 C;  3J7A D;  2CXC A;  4NOZ A;  1HH2 P;  2ZM6 C;  1HNW C;  4LF9 C;  1KKG A;  4OX9 C;  2PN2 A;  4DCT A;  3IEU A;  2PT7 G;  1ZB9 A;  4MTN A;  2E7G A;  1IBL C;  2UXC C;  4JI0 C;  4JI3 C;  4DR1 C; 
#chains in the Genus database with same CATH topology
 2QVX X;  5LMN C;  4HPV A;  3TDE A;  4B3R C;  4D4G A;  3LAX A;  4U5Y D;  3L8C A;  4LF6 C;  3VNS A;  3L95 X;  4RMN A;  4PUH A;  4RVO A;  4LF7 C;  2E8E A;  4G37 A;  4GKK C;  3AF6 A;  3G7S A;  4JM1 A;  5GTD A;  4DR2 C;  1JOS A;  5A2Q D;  3EQ6 A;  2JMP A;  1XNQ C;  1N34 C;  2F4V C;  3A4I A;  4DR4 C;  1UKK A;  1ZB8 A;  4KTV A;  1XRC A;  3AY0 A;  2MMA B;  3C5E A;  4B3M C;  4R1M A;  3T1Y C;  4FTF A;  4RVN A;  2VSQ A;  1P4E A;  4K0B A;  4RM2 A;  3O2E A;  2Z51 A;  4ISB A;  1ML8 A;  1RG9 A;  2M5O A;  4I9G A;  4DUZ C;  1WH9 A;  2ASB A;  1XRA A;  1MXA A;  1T5D X;  2KZ0 A;  4JI8 C;  1WCJ A;  3LNV A;  1PA4 A;  2YWC A;  1IBK C;  1V25 A;  2P2J A;  4JI7 C;  4I9F A;  4X65 C;  4KHP C;  4PZP A;  5JRH A;  3S82 A;  3VNR A;  2P2B A;  3LUS A;  5BSM A;  3PES A;  1FUG A;  2HHH C;  2VZE A;  4DV5 C;  2M5H A;  5BSW A;  2Y4N A;  3T1H C;  2PG1 E;  5KYV A;  2HJG A;  4BC9 A;  1FLO A;  2PN2 A;  3IEU A;  3A9U A;  2E7G A;  4IZ6 A;  1MXC A;  1BA3 A;  2UXC C;  1M6X A;  4DR1 C;  1HNX C;  2ATW A;  2P2M A;  2QW0 X;  3NPD A;  2QVZ X;  4RLF A;  2D1T A;  2DPL A;  5BSR A;  1N33 C;  2OBV A;  5BUQ A;  1VEH A;  2D7V A;  2E5L C;  5CZV A;  4LF5 C;  5ADZ A;  4JYA C;  3N2Q A;  4GS5 A;  5LCI A;  4RM3 A;  1PG4 A;  4JI6 C;  3DAY A;  2P20 A;  3UX3 A;  3FM7 A;  2MCQ A;  2P2F A;  3NI2 A;  1O92 A;  3IPL A;  3PBK A;  5AE1 A;  1YGT A;  3CW9 A;  5LMU C;  2P2Q A;  4DV1 C;  2ONF A;  4MH4 A;  2E8F A;  1V60 A;  2MM9 A;  4LE5 A;  2DYJ A;  3FCE A;  3TQI A;  5BR8 C;  3R9W A;  4NXM C;  2YCB A;  3A25 A;  5BST A;  2E8C A;  4YY3 C;  3I08 A;  2ZTB A;  4R0M A;  4JI1 C;  4OYC A;  1I94 C;  3ETO A;  1P4E C;  4XX2 A;  4LFA C;  4IR7 A;  2Y27 A;  5DV9 A;  2ZZM A;  2D1R A;  2OPL B;  4PUI A;  4DV0 C;  3K6R A;  2UU9 C;  4JI4 C;  3ETC A;  2Y4O A;  4DV7 C;  3J7A D;  3PRO C;  1HH2 P;  4BC7 A;  4DCT A;  5CZX A;  2D28 C;  3CQ2 A;  1IB8 A;  1IBL C;  4ZLP A;  3B7W A;  4LF4 C;  3E7X A;  3N54 B;  2P02 A;  2ZZN A;  3VNQ A;  1M6X C;  2YWB A;  3GKU A;  3RV2 A;  4AQY C;  2KZF A;  4KTT A;  5A1G A;  4RLQ A;  1AMU A;  4D56 A;  3R9X A;  1XS3 A;  1QWI A;  2BJO A;  2VQF C;  1HR0 C;  3R44 A;  5BSU A;  1ULT A;  4FUQ A;  4DR6 C;  2UXB C;  1XRB A;  2QL8 A;  3DHV A;  3CJE A;  3J80 D;  1FJG C;  3TR3 A;  1O93 A;  3GR0 A;  4BBY A;  4K0K C;  1MDF A;  4G1I A;  1IBM C;  1K0R A;  3JAM D;  4BCA A;  3OTO C;  3IML A;  4BSZ A;  4JI2 C;  4DUY C;  2V7B A;  1J5E C;  4LF8 C;  1MKY A;  2OO4 A;  4TPS B;  4WS9 A;  4L7I A;  2DHM A;  3J81 D;  1VLA A;  3GPC A;  4X66 C;  5BUS A;  1O9T A;  4D4I A;  1T5H X;  2D1Q A;  2UXD C;  4DG8 A;  4X62 C;  1L2F A;  3KXW A;  3IEV A;  4LFB C;  4GKJ C;  1USP B;  2QVY X;  4DCU A;  5IWA C;  5AE2 A;  4G36 A;  2E0G A;  3A9V A;  2UUB C;  1MXB A;  4FUT A;  1PU1 A;  4LFC C;  5T8T A;  3E7W A;  2JNV A;  4WV3 A;  5AE3 A;  1N2F A;  4GXR A;  4B3S C;  4DV3 C;  3NYQ A;  2CXC A;  4NOZ A;  2ZM6 C;  1HNW C;  3NYR A;  1KKG A;  5KYT A;  1ZB9 A;  3SO4 A;  2PRO A;  3UX2 A;  2CY1 A;  1XMQ C;  3CW8 X;  1LQL A;  4DR5 C;  3I07 A;  4ODJ A;  4OXI A;  2EGT A;  5A19 A;  4DR3 C;  4PRO C;  5IFI A;  1P7L A;  1O90 A;  4NXN C;  4X64 C;  4R1L A;  1N32 C;  1NY8 A;  5KEI A;  4JI5 C;  4DV6 C;  2UUA C;  1XNR C;  4B3T C;  4NDN A;  4DG9 A;  4EAT A;  2YX1 A;  3H2T A;  4DCS A;  5T8S A;  5BSV A;  4DV4 C;  2KDN A;  5BUR A;  2D27 A;  2NCL A;  4DCV A;  5K8F A;  3AF5 A;  3UZ0 A;  1WF3 A;  1HNZ C;  3CQ3 A;  3EER A;  1YJ7 A;  4JV5 C;  1MD9 A;  2WP0 C;  2UUC C;  5K85 A;  4DV2 C;  4PHT A;  2XR1 A;  1RY2 A;  2BH1 X;  4ZJZ A;  1EGA A;  3LNO A;  5A1I A;  1MDB A;  1XHJ A;  3TUF A;  4L2Z A;  4DR7 C;  1N36 C;  1LCI A;  5H9U A;  3GR1 A;  1UWD A;  1USP A;  4YHH C;  5FLX D;  3LGX A;  5E7Q A;  3FCC A;  2OPL A;  2CU6 A;  2D1S A;  3UOW A;  1TH5 A;  3CQ1 A;  3UEB A;  2VQE C;  2AYA A;  1NYE A;  3A26 A;  5IT9 D;  3DLP X;  1XMO C;  1QM4 A;  1V26 A;  1PG3 A;  4D57 A;  4LF9 C;  4OX9 C;  1GPM A;  3RG2 A;  2PT7 G;  2WD9 A;  4L4Q A;  4MTN A;  4PUG A;  1XDX A;  4GXQ A;  4JI0 C;  4JI3 C; 
#chains in the Genus database with same CATH homology
 2QVX X;  5LMN C;  4HPV A;  3TDE A;  4B3R C;  4D4G A;  3LAX A;  4U5Y D;  3L8C A;  4LF6 C;  3VNS A;  3L95 X;  4RMN A;  4RVO A;  4LF7 C;  2E8E A;  4G37 A;  4GKK C;  3AF6 A;  3G7S A;  4JM1 A;  5GTD A;  4DR2 C;  1JOS A;  5A2Q D;  3EQ6 A;  2JMP A;  1XNQ C;  1N34 C;  2F4V C;  3A4I A;  4DR4 C;  1UKK A;  1ZB8 A;  4KTV A;  1XRC A;  3C5E A;  4B3M C;  4R1M A;  3T1Y C;  4FTF A;  4RVN A;  2VSQ A;  4K0B A;  4RM2 A;  4ISB A;  1ML8 A;  1RG9 A;  4I9G A;  4DUZ C;  1WH9 A;  2ASB A;  1XRA A;  1MXA A;  1T5D X;  4JI8 C;  3LNV A;  1PA4 A;  2YWC A;  1IBK C;  1V25 A;  2P2J A;  4JI7 C;  4I9F A;  4X65 C;  4KHP C;  4PZP A;  5JRH A;  3S82 A;  3VNR A;  2P2B A;  3LUS A;  5BSM A;  3PES A;  1FUG A;  2HHH C;  2VZE A;  4DV5 C;  5BSW A;  2Y4N A;  3T1H C;  5KYV A;  2HJG A;  4BC9 A;  2PN2 A;  3IEU A;  3A9U A;  2E7G A;  4IZ6 A;  1MXC A;  1BA3 A;  2UXC C;  4DR1 C;  1HNX C;  2ATW A;  2P2M A;  2QW0 X;  3NPD A;  2QVZ X;  4RLF A;  2D1T A;  2DPL A;  5BSR A;  1N33 C;  2OBV A;  5BUQ A;  2D7V A;  2E5L C;  5CZV A;  4LF5 C;  5ADZ A;  4JYA C;  3N2Q A;  4GS5 A;  4RM3 A;  1PG4 A;  4JI6 C;  3DAY A;  2P20 A;  2P2F A;  3NI2 A;  1O92 A;  3IPL A;  3PBK A;  5AE1 A;  3CW9 A;  5LMU C;  2P2Q A;  4DV1 C;  2ONF A;  4MH4 A;  2E8F A;  4LE5 A;  2DYJ A;  3FCE A;  3TQI A;  5BR8 C;  3R9W A;  4NXM C;  2YCB A;  5BST A;  2E8C A;  4YY3 C;  3I08 A;  4R0M A;  4JI1 C;  4OYC A;  1I94 C;  3ETO A;  4XX2 A;  4LFA C;  4IR7 A;  2Y27 A;  5DV9 A;  2D1R A;  2OPL B;  4DV0 C;  2UU9 C;  4JI4 C;  3ETC A;  2Y4O A;  4DV7 C;  3J7A D;  3PRO C;  1HH2 P;  4BC7 A;  4DCT A;  5CZX A;  2D28 C;  1IBL C;  4ZLP A;  3B7W A;  4LF4 C;  3E7X A;  3N54 B;  2P02 A;  3VNQ A;  2YWB A;  3GKU A;  3RV2 A;  4AQY C;  2KZF A;  4KTT A;  5A1G A;  4RLQ A;  1AMU A;  4D56 A;  3R9X A;  1QWI A;  2BJO A;  2VQF C;  1HR0 C;  3R44 A;  5BSU A;  1ULT A;  4FUQ A;  4DR6 C;  2UXB C;  1XRB A;  2QL8 A;  3DHV A;  3CJE A;  3J80 D;  1FJG C;  1O93 A;  3GR0 A;  4BBY A;  4K0K C;  1MDF A;  4G1I A;  1IBM C;  1K0R A;  3JAM D;  4BCA A;  3OTO C;  3IML A;  4BSZ A;  4JI2 C;  4DUY C;  2V7B A;  1J5E C;  4LF8 C;  1MKY A;  2OO4 A;  4TPS B;  4WS9 A;  4L7I A;  3J81 D;  1VLA A;  3GPC A;  4X66 C;  5BUS A;  1O9T A;  4D4I A;  1T5H X;  2D1Q A;  2UXD C;  4DG8 A;  4X62 C;  1L2F A;  3KXW A;  3IEV A;  4LFB C;  4GKJ C;  1USP B;  2QVY X;  4DCU A;  5IWA C;  5AE2 A;  4G36 A;  2E0G A;  3A9V A;  2UUB C;  1MXB A;  4FUT A;  4LFC C;  5T8T A;  3E7W A;  4WV3 A;  5AE3 A;  1N2F A;  4GXR A;  4B3S C;  4DV3 C;  3NYQ A;  2CXC A;  4NOZ A;  2ZM6 C;  1HNW C;  3NYR A;  1KKG A;  5KYT A;  1ZB9 A;  3SO4 A;  2PRO A;  2CY1 A;  1XMQ C;  3CW8 X;  1LQL A;  4DR5 C;  3I07 A;  4ODJ A;  4OXI A;  2EGT A;  5A19 A;  4DR3 C;  4PRO C;  5IFI A;  1P7L A;  1O90 A;  4NXN C;  4X64 C;  4R1L A;  1N32 C;  5KEI A;  4JI5 C;  4DV6 C;  2UUA C;  1XNR C;  4B3T C;  4NDN A;  4DG9 A;  4EAT A;  4DCS A;  3H2T A;  5T8S A;  5BSV A;  4DV4 C;  5BUR A;  2D27 A;  4DCV A;  5K8F A;  3AF5 A;  3UZ0 A;  1WF3 A;  1HNZ C;  3EER A;  1YJ7 A;  4JV5 C;  1MD9 A;  2WP0 C;  2UUC C;  5K85 A;  4DV2 C;  4PHT A;  2XR1 A;  1RY2 A;  2BH1 X;  4ZJZ A;  1EGA A;  5A1I A;  1MDB A;  3TUF A;  4L2Z A;  4DR7 C;  1N36 C;  1LCI A;  5H9U A;  3GR1 A;  1USP A;  4YHH C;  5FLX D;  3LGX A;  5E7Q A;  3FCC A;  2OPL A;  2D1S A;  3UOW A;  2VQE C;  2AYA A;  1NYE A;  5IT9 D;  3DLP X;  1XMO C;  1QM4 A;  1V26 A;  1PG3 A;  4D57 A;  4LF9 C;  4OX9 C;  1GPM A;  3RG2 A;  2PT7 G;  2WD9 A;  4L4Q A;  4MTN A;  4GXQ A;  4JI0 C;  4JI3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...