4DV4C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv4C02
1N34C 2ATWA 5FLXD 1XMQC 2E5LC 5BR8C 4JI8C 4DV7C 3R9WA 1IBMC 2CXCA 4NXMC 4KHPC 2F4VC 2EGTA 4AQYC 2JMPA 2ASBA 4GKJC 4BSZA 4LF9C 2OPLB 1WF3A 4NOZA 4JI6C 3OTOC 1PA4A 3AF6A 1N36C 4JYAC 4DV6C 4LF6C 1USPA 3CJEA 4JI2C 3EERA 2HHHC 1I94C 1JOSA 2CY1A 2PT7G 4DCUA 2ZM6C 1EGAA 4DR2C 1UKKA 1VLAA 4DV4C 3JAMD 2E8EA 4JI7C 4LFBC 2UUAC 2UU9C 3GKUA 4DR6C 4DCSA 4JI1C 4LF8C 1XNQC 2UXDC 4X64C 5IWAC 4DCTA 4NXNC 1KKGA 1N32C 2UXBC 2BJOA 2OPLA 4DV2C 4DCVA 1ZB9A 5LMUC 4OX9C 4DR7C 4B3SC 1ML8A 2KZFA 2ONFA 2UUBC 4YHHC 5LMNC 4DV0C 3T1HC 4JV5C 1HNWC 1NYEA 3T1YC 2YCBA 4X65C 2PN2A 4JI5C 3J81D 1ZB8A 4B3TC 1QWIA 4DR1C 2QL8A 2DYJA 5A2QD 1HR0C 1USPB 3LUSA 4MH4A 1HNXC 1WH9A 2E8FA 2HJGA 4B3RC 1N2FA 4LFAC 4LF5C 4DV1C 3AF5A 4DR3C 3I07A 2UUCC 4JI3C 3R9XA 1HH2P 5IT9D 2E8CA 1HNZC 1K0RA 4JI4C 3J80D 2XR1A 1N33C 4GKKC 2VQFC 4X66C 4X62C 2VQEC 1IBLC 4DUZC 4LF4C 1FJGC 4DUYC 1J5EC 2UXCC 4K0KC 1L2FA 3IEVA 4YY3C 1MKYA 1XMOC 4MTNA 4LFCC 2D7VA 4DR4C 4DR5C 3J7AD 4B3MC 4DV3C 2E7GA 3IEUA 1IBKC 4LF7C 4XX2A 4JI0C 1XNRC 4DV5C 1LQLA
chains in the Genus database with same CATH superfamily
2ATWA 3ETOA 4I9GA 4NDNA 5BSTA 2JMPA 4BSZA 2P2FA 4JI6C 4D4GA 3AF6A 4DV6C 3LNOA 3CQ2A 3B7WA 3DLPX 4I9FA 3RG2A 4DR2C 2QVYX 3JAMD 1P4EA 3DAYA 2UU9C 5A19A 3DHVA 4PUHA 4L4QA 2MMAB 5AE3A 1N32C 4G36A 3KXWA 4BCAA 5LMUC 4DR7C 2KZFA 2QW0X 4RM3A 5BUQA 4DV0C 1NYEA 2D1QA 4EATA 3TDEA 1O90A 1QWIA 3EQ6A 1HR0C 2M5HA 2D1RA 4FUQA 1N2FA 1RY2A 3I08A 3R44A 4RMNA 4DV1C 3I07A 5BSVA 1QM4A 5T8TA 4R1LA 1M6XC 3UX2A 3N2QA 3NYQA 1O9TA 3LGXA 2E8CA 2ZZNA 3J80D 1N33C 1XRBA 1PG3A 1FJGC 2Z51A 1J5EC 3L8CA 4K0KC 5KYTA 3IEVA 2AYAA 1MKYA 1O93A 3G7SA 1XHJA 4LFCC 4WS9A 4DR5C 1PG4A 2PG1E 1NY8A 3PBKA 4ISBA 4WV3A 4DV5C 2QVZX 3GR1A 1XMQC 5BUSA 4DV7C 2OO4A 1IBMC 2CXCA 3PROC 1BA3A 4JM1A 3A9UA 1N36C 4LF6C 3CJEA 2CU6A 3LAXA 5A1GA 2D1SA 3ETCA 2P2BA 2PT7G 4ZLPA 4DCUA 3A26A 3TR3A 5LCIA 4RLFA 4G37A 5CZVA 4OXIA 2E0GA 2UUAC 1GPMA 4DR6C 2UXDC 3IPLA 5IWAC 4DCTA 3VNQA 4DV2C 5KEIA 4PZPA 5E7QA 5BSRA 2JNVA 4OX9C 1XRCA 4B3SC 2ONFA 2BH1X 3T1HC 1MXBA 2YCBA 4KTVA 2OBVA 3LNVA 4PUIA 2PN2A 3J81D 4B3TC 4R0MA 2DYJA 3K6RA 4D57A 1M6XA 4GXRA 3TUFA 4ZJZA 4MH4A 2P20A 5KYVA 2E8FA 2HJGA 3VNRA 4B3RC 2YWCA 4LF5C 5K85A 4K0BA 3NYRA 4RLQA 2KZ0A 4U5YD 3UEBA 1TH5A 2WD9A 5IT9D 2MM9A 4G1IA 3NPDA 1K0RA 4GKKC 2VQFC 1FUGA 5DV9A 4R1MA 1IBLC 4LF4C 1V26A 4KTTA 4IZ6A 4D56A 4B3MC 4DV3C 1IBKC 2VZEA 5GTDA 3UX3A 1AMUA 2YWBA 4BBYA 3A25A 2PROA 4JI8C 3R9WA 1T5HX 4NXMC 4DG8A 2ASBA 5BSWA 4GKJC 5AE2A 2OPLB 5K8FA 1P4EC 3RV2A 4BC9A 3OTOC 3FCEA 4JYAC 5H9UA 1USPA 4JI2C 3EERA 1ULTA 2HHHC 5ADZA 3C5EA 1YJ7A 1I94C 2CY1A 2DPLA 5BURA 2D28C 1EGAA 1T5DX 1UKKA 4DV4C 4BC7A 2VSQA 1VEHA 3IMLA 2Y27A 3GKUA 4DCSA 4JI1C 4X64C 1XS3A 2ZTBA 4NXNC 1KKGA 1V60A 3A9VA 4D4IA 3H2TA 5T8SA 5CZXA 4DCVA 1ZB9A 1ML8A 1PU1A 5LMNC 1HNWC 1V25A 3FCCA 4JI5C 4RM2A 4DR1C 2Y4NA 1HNXC 2MCQA 1MDBA 5BSMA 4LFAC 3AF5A 2UUCC 3TQIA 1MXAA 3A4IA 1HNZC 4DG9A 4HPVA 4X62C 2VQEC 3O2EA 3CW8X 4DUZC 2UXCC 4LE5A 3PESA 2WP0C 3VNSA 3IEUA 4XX2A 1XNRC 1LCIA 1N34C 4RVOA 5FLXD 5AE1A 2E5LC 5BR8C 2P02A 4ODJA 4KHPC 2F4VC 2EGTA 4AQYC 4PUGA 4LF9C 3CW9A 1IB8A 1WF3A 1UWDA 4NOZA 5A1IA 3FM7A 5JRHA 1PA4A 4OYCA 1JOSA 2ZM6C 2Y4OA 2DHMA 1FLOA 1VLAA 3UZ0A 3CQ1A 2YX1A 5IFIA 2E8EA 4JI7C 4LFBC 1MXCA 1XDXA 4LF8C 1XNQC 4GS5A 2KDNA 3AY0A 2P2MA 2UXBC 2BJOA 2OPLA 3E7WA 1XRAA 3S82A 2UUBC 4YHHC 1RG9A 4JV5C 3T1YC 4X65C 4IR7A 1P7LA 3UOWA 1ZB8A 2QL8A 1WCJA 3CQ3A 5A2QD 1USPB 3LUSA 2QVXX 2ZZMA 1WH9A 2P2QA 4PROC 4DR3C 4GXQA 4JI3C 1MDFA 2D27A 4RVNA 3R9XA 2M5OA 1O92A 1HH2P 2NCLA 3L95X 5BSUA 4JI4C 2XR1A 1MD9A 3GR0A 3NI2A 2P2JA 4TPSB 4X66C 1YGTA 2D1TA 4DUYC 4L7IA 2V7BA 1L2FA 4FTFA 3SO4A 4YY3C 1XMOC 4MTNA 2D7VA 4DR4C 3J7AD 3E7XA 3GPCA 2E7GA 4LF7C 4FUTA 4L2ZA 3N54B 4JI0C 4PHTA 1LQLA
chains in the Genus database with same CATH topology
2ATWA 3ETOA 4I9GA 4NDNA 5BSTA 2JMPA 4BSZA 2P2FA 4JI6C 4D4GA 3AF6A 4DV6C 3B7WA 3DLPX 4I9FA 3RG2A 4DR2C 2QVYX 3JAMD 3DAYA 2UU9C 5A19A 3DHVA 4L4QA 5AE3A 1N32C 4G36A 3KXWA 4BCAA 5LMUC 4DR7C 2KZFA 2QW0X 4RM3A 5BUQA 4DV0C 1NYEA 2D1QA 4EATA 3TDEA 1O90A 1QWIA 3EQ6A 1HR0C 2D1RA 4FUQA 1N2FA 1RY2A 3I08A 3R44A 4RMNA 4DV1C 3I07A 5BSVA 1QM4A 5T8TA 4R1LA 3N2QA 3NYQA 1O9TA 3LGXA 2E8CA 3J80D 1N33C 1XRBA 1PG3A 1FJGC 1J5EC 3L8CA 4K0KC 5KYTA 3IEVA 2AYAA 1MKYA 1O93A 3G7SA 4LFCC 4WS9A 4DR5C 1PG4A 3PBKA 4ISBA 4WV3A 4DV5C 2QVZX 3GR1A 1XMQC 5BUSA 4DV7C 2OO4A 1IBMC 2CXCA 3PROC 1BA3A 4JM1A 3A9UA 1N36C 4LF6C 3CJEA 3LAXA 5A1GA 2D1SA 3ETCA 2P2BA 2PT7G 4ZLPA 4DCUA 4RLFA 4G37A 5CZVA 4OXIA 2E0GA 2UUAC 1GPMA 4DR6C 2UXDC 3IPLA 5IWAC 4DCTA 3VNQA 4DV2C 5KEIA 4PZPA 5E7QA 5BSRA 4OX9C 1XRCA 4B3SC 2ONFA 2BH1X 3T1HC 1MXBA 2YCBA 4KTVA 2OBVA 3LNVA 2PN2A 3J81D 4B3TC 4R0MA 2DYJA 4D57A 4GXRA 3TUFA 4ZJZA 4MH4A 2P20A 5KYVA 2E8FA 2HJGA 3VNRA 4B3RC 2YWCA 4LF5C 5K85A 4K0BA 3NYRA 4RLQA 4U5YD 2WD9A 5IT9D 4G1IA 3NPDA 1K0RA 4GKKC 2VQFC 1FUGA 5DV9A 4R1MA 1IBLC 4LF4C 1V26A 4KTTA 4IZ6A 4D56A 4B3MC 4DV3C 1IBKC 2VZEA 5GTDA 1AMUA 2YWBA 4BBYA 2PROA 4JI8C 3R9WA 1T5HX 4NXMC 4DG8A 2ASBA 5BSWA 4GKJC 5AE2A 2OPLB 5K8FA 3RV2A 4BC9A 3OTOC 3FCEA 4JYAC 5H9UA 1USPA 4JI2C 3EERA 1ULTA 2HHHC 5ADZA 3C5EA 1YJ7A 1I94C 2CY1A 2DPLA 5BURA 2D28C 1EGAA 1T5DX 1UKKA 4DV4C 4BC7A 2VSQA 3IMLA 2Y27A 3GKUA 4DCSA 4JI1C 4X64C 4NXNC 1KKGA 3A9VA 4D4IA 3H2TA 5T8SA 5CZXA 4DCVA 1ZB9A 1ML8A 5LMNC 1HNWC 1V25A 3FCCA 4JI5C 4RM2A 4DR1C 2Y4NA 1HNXC 1MDBA 5BSMA 4LFAC 3AF5A 2UUCC 3TQIA 1MXAA 3A4IA 1HNZC 4DG9A 4HPVA 4X62C 2VQEC 3CW8X 4DUZC 2UXCC 4LE5A 3PESA 2WP0C 3VNSA 3IEUA 4XX2A 1XNRC 1LCIA 1N34C 4RVOA 5FLXD 5AE1A 2E5LC 5BR8C 2P02A 4ODJA 4KHPC 2F4VC 2EGTA 4AQYC 4LF9C 3CW9A 1WF3A 4NOZA 5A1IA 5JRHA 1PA4A 4OYCA 1JOSA 2ZM6C 2Y4OA 1VLAA 3UZ0A 5IFIA 2E8EA 4JI7C 4LFBC 1MXCA 4LF8C 1XNQC 4GS5A 2P2MA 2UXBC 2BJOA 2OPLA 3E7WA 1XRAA 3S82A 2UUBC 4YHHC 1RG9A 4JV5C 3T1YC 4X65C 4IR7A 1P7LA 3UOWA 1ZB8A 2QL8A 5A2QD 1USPB 3LUSA 2QVXX 1WH9A 2P2QA 4PROC 4DR3C 4GXQA 4JI3C 1MDFA 2D27A 4RVNA 3R9XA 1O92A 1HH2P 3L95X 5BSUA 4JI4C 2XR1A 1MD9A 3GR0A 3NI2A 2P2JA 4TPSB 4X66C 2D1TA 4DUYC 4L7IA 2V7BA 1L2FA 4FTFA 3SO4A 4YY3C 1XMOC 4MTNA 2D7VA 4DR4C 3J7AD 3E7XA 3GPCA 2E7GA 4LF7C 4FUTA 4L2ZA 3N54B 4JI0C 4PHTA 1LQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 C;  2ATW A;  5FLX D;  1XMQ C;  2E5L C;  5BR8 C;  4JI8 C;  4DV7 C;  3R9W A;  1IBM C;  2CXC A;  4NXM C;  4KHP C;  2F4V C;  2EGT A;  4AQY C;  2JMP A;  2ASB A;  4GKJ C;  4BSZ A;  4LF9 C;  2OPL B;  1WF3 A;  4NOZ A;  4JI6 C;  3OTO C;  1PA4 A;  3AF6 A;  1N36 C;  4JYA C;  4DV6 C;  4LF6 C;  1USP A;  3CJE A;  4JI2 C;  3EER A;  2HHH C;  1I94 C;  1JOS A;  2CY1 A;  2PT7 G;  4DCU A;  2ZM6 C;  1EGA A;  4DR2 C;  1UKK A;  1VLA A;  4DV4 C;  3JAM D;  2E8E A;  4JI7 C;  4LFB C;  2UUA C;  2UU9 C;  3GKU A;  4DR6 C;  4DCS A;  4JI1 C;  4LF8 C;  1XNQ C;  2UXD C;  4X64 C;  5IWA C;  4DCT A;  4NXN C;  1KKG A;  1N32 C;  2UXB C;  2BJO A;  2OPL A;  4DV2 C;  4DCV A;  1ZB9 A;  5LMU C;  4OX9 C;  4DR7 C;  4B3S C;  1ML8 A;  2KZF A;  2ONF A;  2UUB C;  4YHH C;  5LMN C;  4DV0 C;  3T1H C;  4JV5 C;  1HNW C;  1NYE A;  3T1Y C;  2YCB A;  4X65 C;  2PN2 A;  4JI5 C;  3J81 D;  1ZB8 A;  4B3T C;  1QWI A;  4DR1 C;  2QL8 A;  2DYJ A;  5A2Q D;  1HR0 C;  1USP B;  3LUS A;  4MH4 A;  1HNX C;  1WH9 A;  2E8F A;  2HJG A;  4B3R C;  1N2F A;  4LFA C;  4LF5 C;  4DV1 C;  3AF5 A;  4DR3 C;  3I07 A;  2UUC C;  4JI3 C;  3R9X A;  1HH2 P;  5IT9 D;  2E8C A;  1HNZ C;  1K0R A;  4JI4 C;  3J80 D;  2XR1 A;  1N33 C;  4GKK C;  2VQF C;  4X66 C;  4X62 C;  2VQE C;  1IBL C;  4DUZ C;  4LF4 C;  1FJG C;  4DUY C;  1J5E C;  2UXC C;  4K0K C;  1L2F A;  3IEV A;  4YY3 C;  1MKY A;  1XMO C;  4MTN A;  4LFC C;  2D7V A;  4DR4 C;  4DR5 C;  3J7A D;  4B3M C;  4DV3 C;  2E7G A;  3IEU A;  1IBK C;  4LF7 C;  4XX2 A;  4JI0 C;  1XNR C;  4DV5 C;  1LQL A; 
#chains in the Genus database with same CATH topology
 2ATW A;  3ETO A;  4I9G A;  4NDN A;  5BST A;  2JMP A;  4BSZ A;  2P2F A;  4JI6 C;  4D4G A;  3AF6 A;  4DV6 C;  3LNO A;  3CQ2 A;  3B7W A;  3DLP X;  4I9F A;  3RG2 A;  4DR2 C;  2QVY X;  3JAM D;  1P4E A;  3DAY A;  2UU9 C;  5A19 A;  3DHV A;  4PUH A;  4L4Q A;  2MMA B;  5AE3 A;  1N32 C;  4G36 A;  3KXW A;  4BCA A;  5LMU C;  4DR7 C;  2KZF A;  2QW0 X;  4RM3 A;  5BUQ A;  4DV0 C;  1NYE A;  2D1Q A;  4EAT A;  3TDE A;  1O90 A;  1QWI A;  3EQ6 A;  1HR0 C;  2M5H A;  2D1R A;  4FUQ A;  1N2F A;  1RY2 A;  3I08 A;  3R44 A;  4RMN A;  4DV1 C;  3I07 A;  5BSV A;  1QM4 A;  5T8T A;  4R1L A;  1M6X C;  3UX2 A;  3N2Q A;  3NYQ A;  1O9T A;  3LGX A;  2E8C A;  2ZZN A;  3J80 D;  1N33 C;  1XRB A;  1PG3 A;  1FJG C;  2Z51 A;  1J5E C;  3L8C A;  4K0K C;  5KYT A;  3IEV A;  2AYA A;  1MKY A;  1O93 A;  3G7S A;  1XHJ A;  4LFC C;  4WS9 A;  4DR5 C;  1PG4 A;  2PG1 E;  1NY8 A;  3PBK A;  4ISB A;  4WV3 A;  4DV5 C;  2QVZ X;  3GR1 A;  1XMQ C;  5BUS A;  4DV7 C;  2OO4 A;  1IBM C;  2CXC A;  3PRO C;  1BA3 A;  4JM1 A;  3A9U A;  1N36 C;  4LF6 C;  3CJE A;  2CU6 A;  3LAX A;  5A1G A;  2D1S A;  3ETC A;  2P2B A;  2PT7 G;  4ZLP A;  4DCU A;  3A26 A;  3TR3 A;  5LCI A;  4RLF A;  4G37 A;  5CZV A;  4OXI A;  2E0G A;  2UUA C;  1GPM A;  4DR6 C;  2UXD C;  3IPL A;  5IWA C;  4DCT A;  3VNQ A;  4DV2 C;  5KEI A;  4PZP A;  5E7Q A;  5BSR A;  2JNV A;  4OX9 C;  1XRC A;  4B3S C;  2ONF A;  2BH1 X;  3T1H C;  1MXB A;  2YCB A;  4KTV A;  2OBV A;  3LNV A;  4PUI A;  2PN2 A;  3J81 D;  4B3T C;  4R0M A;  2DYJ A;  3K6R A;  4D57 A;  1M6X A;  4GXR A;  3TUF A;  4ZJZ A;  4MH4 A;  2P20 A;  5KYV A;  2E8F A;  2HJG A;  3VNR A;  4B3R C;  2YWC A;  4LF5 C;  5K85 A;  4K0B A;  3NYR A;  4RLQ A;  2KZ0 A;  4U5Y D;  3UEB A;  1TH5 A;  2WD9 A;  5IT9 D;  2MM9 A;  4G1I A;  3NPD A;  1K0R A;  4GKK C;  2VQF C;  1FUG A;  5DV9 A;  4R1M A;  1IBL C;  4LF4 C;  1V26 A;  4KTT A;  4IZ6 A;  4D56 A;  4B3M C;  4DV3 C;  1IBK C;  2VZE A;  5GTD A;  3UX3 A;  1AMU A;  2YWB A;  4BBY A;  3A25 A;  2PRO A;  4JI8 C;  3R9W A;  1T5H X;  4NXM C;  4DG8 A;  2ASB A;  5BSW A;  4GKJ C;  5AE2 A;  2OPL B;  5K8F A;  1P4E C;  3RV2 A;  4BC9 A;  3OTO C;  3FCE A;  4JYA C;  5H9U A;  1USP A;  4JI2 C;  3EER A;  1ULT A;  2HHH C;  5ADZ A;  3C5E A;  1YJ7 A;  1I94 C;  2CY1 A;  2DPL A;  5BUR A;  2D28 C;  1EGA A;  1T5D X;  1UKK A;  4DV4 C;  4BC7 A;  2VSQ A;  1VEH A;  3IML A;  2Y27 A;  3GKU A;  4DCS A;  4JI1 C;  4X64 C;  1XS3 A;  2ZTB A;  4NXN C;  1KKG A;  1V60 A;  3A9V A;  4D4I A;  3H2T A;  5T8S A;  5CZX A;  4DCV A;  1ZB9 A;  1ML8 A;  1PU1 A;  5LMN C;  1HNW C;  1V25 A;  3FCC A;  4JI5 C;  4RM2 A;  4DR1 C;  2Y4N A;  1HNX C;  2MCQ A;  1MDB A;  5BSM A;  4LFA C;  3AF5 A;  2UUC C;  3TQI A;  1MXA A;  3A4I A;  1HNZ C;  4DG9 A;  4HPV A;  4X62 C;  2VQE C;  3O2E A;  3CW8 X;  4DUZ C;  2UXC C;  4LE5 A;  3PES A;  2WP0 C;  3VNS A;  3IEU A;  4XX2 A;  1XNR C;  1LCI A;  1N34 C;  4RVO A;  5FLX D;  5AE1 A;  2E5L C;  5BR8 C;  2P02 A;  4ODJ A;  4KHP C;  2F4V C;  2EGT A;  4AQY C;  4PUG A;  4LF9 C;  3CW9 A;  1IB8 A;  1WF3 A;  1UWD A;  4NOZ A;  5A1I A;  3FM7 A;  5JRH A;  1PA4 A;  4OYC A;  1JOS A;  2ZM6 C;  2Y4O A;  2DHM A;  1FLO A;  1VLA A;  3UZ0 A;  3CQ1 A;  2YX1 A;  5IFI A;  2E8E A;  4JI7 C;  4LFB C;  1MXC A;  1XDX A;  4LF8 C;  1XNQ C;  4GS5 A;  2KDN A;  3AY0 A;  2P2M A;  2UXB C;  2BJO A;  2OPL A;  3E7W A;  1XRA A;  3S82 A;  2UUB C;  4YHH C;  1RG9 A;  4JV5 C;  3T1Y C;  4X65 C;  4IR7 A;  1P7L A;  3UOW A;  1ZB8 A;  2QL8 A;  1WCJ A;  3CQ3 A;  5A2Q D;  1USP B;  3LUS A;  2QVX X;  2ZZM A;  1WH9 A;  2P2Q A;  4PRO C;  4DR3 C;  4GXQ A;  4JI3 C;  1MDF A;  2D27 A;  4RVN A;  3R9X A;  2M5O A;  1O92 A;  1HH2 P;  2NCL A;  3L95 X;  5BSU A;  4JI4 C;  2XR1 A;  1MD9 A;  3GR0 A;  3NI2 A;  2P2J A;  4TPS B;  4X66 C;  1YGT A;  2D1T A;  4DUY C;  4L7I A;  2V7B A;  1L2F A;  4FTF A;  3SO4 A;  4YY3 C;  1XMO C;  4MTN A;  2D7V A;  4DR4 C;  3J7A D;  3E7X A;  3GPC A;  2E7G A;  4LF7 C;  4FUT A;  4L2Z A;  3N54 B;  4JI0 C;  4PHT A;  1LQL A; 
#chains in the Genus database with same CATH homology
 2ATW A;  3ETO A;  4I9G A;  4NDN A;  5BST A;  2JMP A;  4BSZ A;  2P2F A;  4JI6 C;  4D4G A;  3AF6 A;  4DV6 C;  3B7W A;  3DLP X;  4I9F A;  3RG2 A;  4DR2 C;  2QVY X;  3JAM D;  3DAY A;  2UU9 C;  5A19 A;  3DHV A;  4L4Q A;  5AE3 A;  1N32 C;  4G36 A;  3KXW A;  4BCA A;  5LMU C;  4DR7 C;  2KZF A;  2QW0 X;  4RM3 A;  5BUQ A;  4DV0 C;  1NYE A;  2D1Q A;  4EAT A;  3TDE A;  1O90 A;  1QWI A;  3EQ6 A;  1HR0 C;  2D1R A;  4FUQ A;  1N2F A;  1RY2 A;  3I08 A;  3R44 A;  4RMN A;  4DV1 C;  3I07 A;  5BSV A;  1QM4 A;  5T8T A;  4R1L A;  3N2Q A;  3NYQ A;  1O9T A;  3LGX A;  2E8C A;  3J80 D;  1N33 C;  1XRB A;  1PG3 A;  1FJG C;  1J5E C;  3L8C A;  4K0K C;  5KYT A;  3IEV A;  2AYA A;  1MKY A;  1O93 A;  3G7S A;  4LFC C;  4WS9 A;  4DR5 C;  1PG4 A;  3PBK A;  4ISB A;  4WV3 A;  4DV5 C;  2QVZ X;  3GR1 A;  1XMQ C;  5BUS A;  4DV7 C;  2OO4 A;  1IBM C;  2CXC A;  3PRO C;  1BA3 A;  4JM1 A;  3A9U A;  1N36 C;  4LF6 C;  3CJE A;  3LAX A;  5A1G A;  2D1S A;  3ETC A;  2P2B A;  2PT7 G;  4ZLP A;  4DCU A;  4RLF A;  4G37 A;  5CZV A;  4OXI A;  2E0G A;  2UUA C;  1GPM A;  4DR6 C;  2UXD C;  3IPL A;  5IWA C;  4DCT A;  3VNQ A;  4DV2 C;  5KEI A;  4PZP A;  5E7Q A;  5BSR A;  4OX9 C;  1XRC A;  4B3S C;  2ONF A;  2BH1 X;  3T1H C;  1MXB A;  2YCB A;  4KTV A;  2OBV A;  3LNV A;  2PN2 A;  3J81 D;  4B3T C;  4R0M A;  2DYJ A;  4D57 A;  4GXR A;  3TUF A;  4ZJZ A;  4MH4 A;  2P20 A;  5KYV A;  2E8F A;  2HJG A;  3VNR A;  4B3R C;  2YWC A;  4LF5 C;  5K85 A;  4K0B A;  3NYR A;  4RLQ A;  4U5Y D;  2WD9 A;  5IT9 D;  4G1I A;  3NPD A;  1K0R A;  4GKK C;  2VQF C;  1FUG A;  5DV9 A;  4R1M A;  1IBL C;  4LF4 C;  1V26 A;  4KTT A;  4IZ6 A;  4D56 A;  4B3M C;  4DV3 C;  1IBK C;  2VZE A;  5GTD A;  1AMU A;  2YWB A;  4BBY A;  2PRO A;  4JI8 C;  3R9W A;  1T5H X;  4NXM C;  4DG8 A;  2ASB A;  5BSW A;  4GKJ C;  5AE2 A;  2OPL B;  5K8F A;  3RV2 A;  4BC9 A;  3OTO C;  3FCE A;  4JYA C;  5H9U A;  1USP A;  4JI2 C;  3EER A;  1ULT A;  2HHH C;  5ADZ A;  3C5E A;  1YJ7 A;  1I94 C;  2CY1 A;  2DPL A;  5BUR A;  2D28 C;  1EGA A;  1T5D X;  1UKK A;  4DV4 C;  4BC7 A;  2VSQ A;  3IML A;  2Y27 A;  3GKU A;  4DCS A;  4JI1 C;  4X64 C;  4NXN C;  1KKG A;  3A9V A;  4D4I A;  3H2T A;  5T8S A;  5CZX A;  4DCV A;  1ZB9 A;  1ML8 A;  5LMN C;  1HNW C;  1V25 A;  3FCC A;  4JI5 C;  4RM2 A;  4DR1 C;  2Y4N A;  1HNX C;  1MDB A;  5BSM A;  4LFA C;  3AF5 A;  2UUC C;  3TQI A;  1MXA A;  3A4I A;  1HNZ C;  4DG9 A;  4HPV A;  4X62 C;  2VQE C;  3CW8 X;  4DUZ C;  2UXC C;  4LE5 A;  3PES A;  2WP0 C;  3VNS A;  3IEU A;  4XX2 A;  1XNR C;  1LCI A;  1N34 C;  4RVO A;  5FLX D;  5AE1 A;  2E5L C;  5BR8 C;  2P02 A;  4ODJ A;  4KHP C;  2F4V C;  2EGT A;  4AQY C;  4LF9 C;  3CW9 A;  1WF3 A;  4NOZ A;  5A1I A;  5JRH A;  1PA4 A;  4OYC A;  1JOS A;  2ZM6 C;  2Y4O A;  1VLA A;  3UZ0 A;  5IFI A;  2E8E A;  4JI7 C;  4LFB C;  1MXC A;  4LF8 C;  1XNQ C;  4GS5 A;  2P2M A;  2UXB C;  2BJO A;  2OPL A;  3E7W A;  1XRA A;  3S82 A;  2UUB C;  4YHH C;  1RG9 A;  4JV5 C;  3T1Y C;  4X65 C;  4IR7 A;  1P7L A;  3UOW A;  1ZB8 A;  2QL8 A;  5A2Q D;  1USP B;  3LUS A;  2QVX X;  1WH9 A;  2P2Q A;  4PRO C;  4DR3 C;  4GXQ A;  4JI3 C;  1MDF A;  2D27 A;  4RVN A;  3R9X A;  1O92 A;  1HH2 P;  3L95 X;  5BSU A;  4JI4 C;  2XR1 A;  1MD9 A;  3GR0 A;  3NI2 A;  2P2J A;  4TPS B;  4X66 C;  2D1T A;  4DUY C;  4L7I A;  2V7B A;  1L2F A;  4FTF A;  3SO4 A;  4YY3 C;  1XMO C;  4MTN A;  2D7V A;  4DR4 C;  3J7A D;  3E7X A;  3GPC A;  2E7G A;  4LF7 C;  4FUT A;  4L2Z A;  3N54 B;  4JI0 C;  4PHT A;  1LQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...