4DV4C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv4C02
1N32C 2E7GA 1FJGC 4DV6C 2UUBC 4K0KC 1L2FA 2XR1A 4DR1C 4DV0C 3T1HC 3I07A 5BR8C 4JI4C 3OTOC 1UKKA 1USPA 4JI3C 4JI7C 3AF6A 2ZM6C 1N33C 4NOZA 2ONFA 4LF6C 2HHHC 1N2FA 1I94C 4MH4A 2UUAC 4GKKC 2E8FA 4NXMC 4DCSA 4OX9C 4JI2C 2VQFC 2BJOA 4LF4C 2F4VC 1HR0C 4JI5C 3J7AD 4JI6C 1IBLC 4DV1C 1NYEA 2OPLB 2CXCA 4MTNA 2VQEC 1HNZC 4DR6C 4YHHC 2D7VA 1XMQC 1LQLA 2PN2A 4DCUA 4B3RC 3R9XA 4X66C 1ZB9A 4DR7C 4B3MC 1HNXC 1XNRC 2HJGA 2ASBA 4BSZA 2UU9C 2UXBC 4DUZC 1J5EC 4KHPC 4JV5C 2DYJA 5FLXD 4DCVA 3IEUA 4X64C 4DV5C 3JAMD 2JMPA 4B3SC 4DV7C 1ZB8A 1K0RA 1WH9A 4DUYC 4LF7C 4GKJC 1MKYA 3EERA 4AQYC 4DR4C 4JI0C 4DV2C 4YY3C 3GKUA 2OPLA 3J80D 4LFBC 1KKGA 2EGTA 2E8EA 2E5LC 4LF8C 4LFAC 4LFCC 1N34C 2UXCC 4X62C 4NXNC 1HH2P 4XX2A 2CY1A 2PT7G 1HNWC 5IT9D 5LMNC 2UXDC 4LF5C 5IWAC 4DR2C 3T1YC 1N36C 4DV3C 3IEVA 3CJEA 4DV4C 2E8CA 1IBKC 2UUCC 2QL8A 1XNQC 3R9WA 1IBMC 1QWIA 3LUSA 4DR3C 4X65C 4JI1C 2ATWA 3J81D 1USPB 1VLAA 4JYAC 5LMUC 2KZFA 4DR5C 1WF3A 5A2QD 4LF9C 1ML8A 1EGAA 4JI8C 1PA4A 1JOSA 1XMOC 2YCBA 3AF5A 4B3TC 4DCTA
chains in the Genus database with same CATH superfamily
1N32C 2P2BA 4BC7A 2ZZNA 1M6XC 3NYQA 4FUQA 3I07A 3OTOC 1UKKA 1USPA 1RG9A 4JI3C 1N33C 2BH1X 5GTDA 2HHHC 1N2FA 1I94C 3DHVA 4MH4A 1PG3A 4OYCA 4DCSA 1M6XA 1UWDA 2CU6A 4R0MA 4BC9A 3A25A 1GPMA 3L95X 5E7QA 3S82A 2CXCA 4MTNA 1P7LA 4B3RC 4GXRA 4B3MC 3CQ2A 3L8CA 4PHTA 2UXBC 3UEBA 2DYJA 1BA3A 4DCVA 2YWBA 3IEUA 4DV5C 4PUIA 4PUHA 4LF7C 3IPLA 4GKJC 4DR4C 4JI0C 4DV2C 1MXBA 5LCIA 4YY3C 3J80D 3IMLA 3FCCA 2E8EA 2QVZX 5BUSA 2E5LC 5T8TA 4LFCC 1PU1A 1N34C 4PUGA 5BSRA 2PT7G 5IWAC 5CZXA 1N36C 3IEVA 3CJEA 3KXWA 2D1QA 2QL8A 4DR3C 4RMNA 4RM2A 2KDNA 5LMUC 2KZFA 3NYRA 1PA4A 1WCJA 3LNOA 2Y4NA 2Z51A 2UUBC 3LNVA 2Y27A 5JRHA 3ETCA 3TDEA 2QW0X 1NY8A 5BR8C 2V7BA 4JI4C 4D4GA 4JI7C 3AF6A 4NOZA 3AY0A 4L2ZA 4GS5A 3RG2A 5A1IA 4LF6C 3K6RA 2UUAC 2YX1A 3UX2A 2OBVA 2E8FA 2P2QA 3E7XA 4JI2C 1O90A 1VEHA 4LF4C 3LAXA 4R1MA 4JI6C 1IBLC 4IZ6A 2OPLB 1HNZC 5BSTA 4RM3A 2PN2A 2VSQA 4DCUA 3R9XA 2P20A 4X66C 5IFIA 2ASBA 1QM4A 2D27A 2UU9C 4DUZC 1J5EC 4KHPC 2WD9A 2NCLA 3TR3A 4DV7C 3FCEA 4TPSB 2MCQA 5BSMA 1PG4A 2OPLA 2EGTA 4LF8C 4LFAC 4WS9A 3PROC 3H2TA 5KEIA 2UXDC 5LMNC 4LF5C 1FLOA 4DR2C 4DV4C 2E8CA 1IBKC 2DHMA 1XNQC 4OXIA 1AMUA 3LUSA 2ZTBA 4K0BA 4X65C 4EATA 3J81D 3CQ3A 3A4IA 3RV2A 5A2QD 1ULTA 1P4EC 3GPCA 3A9VA 4ODJA 3PBKA 5KYTA 3CW8X 1FJGC 4DV6C 1O9TA 2XR1A 4G1IA 4DR1C 3E7WA 2P02A 3T1HC 3NI2A 3TUFA 4RLFA 1P4EA 5CZVA 2ONFA 3R44A 4D56A 2QVXX 1XDXA 2P2MA 4GKKC 1V25A 2E0GA 2ZZMA 2BJOA 5KYVA 4PROC 2F4VC 3TQIA 4JI5C 4U5YD 3CQ1A 2WP0C 3B7WA 4I9FA 3UX3A 1NYEA 4KTVA 2VQEC 4DR6C 4YHHC 5H9UA 1XMQC 1LQLA 4D4IA 1MDFA 1T5DX 1HNXC 3CW9A 4BBYA 3NPDA 4PZPA 5A19A 3I08A 5T8SA 4JV5C 4X64C 5AE1A 1XRAA 2PROA 4ISBA 2YWCA 1ZB8A 1K0RA 4DUYC 3N2QA 1YJ7A 3EERA 4AQYC 5A1GA 1O92A 1XRCA 3GKUA 4R1LA 3UZ0A 2AYAA 1XHJA 4ZLPA 4X62C 4NXNC 5BUQA 5IT9D 3DAYA 4DV3C 5DV9A 1O93A 3DLPX 3R9WA 2VZEA 4FUTA 5BSVA 1RY2A 1V26A 1QWIA 1IBMC 2ATWA 3EQ6A 3GR1A 2D28C 1USPB 4HPVA 3A26A 3FM7A 4JYAC 1WF3A 3UOWA 4RVNA 3G7SA 4LF9C 2PG1E 1MDBA 1FUGA 4RLQA 4JI8C 4G36A 1XMOC 4RVOA 2YCBA 5BURA 3AF5A 4B3TC 4DCTA 3A9UA 4L4QA 4BCAA 4LE5A 2E7GA 4K0KC 1L2FA 2QVYX 1IB8A 4DV0C 1YGTA 4DG8A 3N54B 4FTFA 5AE3A 5BSUA 4IR7A 2ZM6C 5K85A 3GR0A 2P2FA 4NXMC 4OX9C 2VQFC 2D1RA 4WV3A 1MD9A 1HR0C 4G37A 3J7AD 2OO4A 2DPLA 4DV1C 3VNRA 1V60A 1TH5A 3ETOA 2D7VA 2KZ0A 3PESA 1T5HX 4GXQA 1ZB9A 4DR7C 1XNRC 2HJGA 3SO4A 4BSZA 2D1SA 2MM9A 1MXCA 4KTTA 2P2JA 4D57A 5ADZA 5FLXD 2D1TA 4JM1A 3JAMD 2JMPA 4B3SC 4ZJZA 4I9GA 1WH9A 5K8FA 1MKYA 2MMAB 3O2EA 5AE2A 2JNVA 4LFBC 1KKGA 3VNSA 3LGXA 1XRBA 5BSWA 2UXCC 2M5OA 1HH2P 4XX2A 2CY1A 3C5EA 1HNWC 3T1YC 1LCIA 2UUCC 4JI1C 2Y4OA 1VLAA 4L7IA 1XS3A 4DR5C 4DG9A 1ML8A 1EGAA 4NDNA 1JOSA 1MXAA 3VNQA 2M5HA
chains in the Genus database with same CATH topology
1N32C 2P2BA 4BC7A 3NYQA 4FUQA 3I07A 3OTOC 1UKKA 1USPA 1RG9A 4JI3C 1N33C 2BH1X 5GTDA 2HHHC 1N2FA 1I94C 3DHVA 4MH4A 1PG3A 4OYCA 4DCSA 4R0MA 4BC9A 1GPMA 3L95X 5E7QA 3S82A 2CXCA 4MTNA 1P7LA 4B3RC 4GXRA 4B3MC 3L8CA 4PHTA 2UXBC 2DYJA 1BA3A 4DCVA 2YWBA 3IEUA 4DV5C 4LF7C 3IPLA 4GKJC 4DR4C 4JI0C 4DV2C 1MXBA 4YY3C 3J80D 3IMLA 3FCCA 2E8EA 2QVZX 5BUSA 2E5LC 5T8TA 4LFCC 1N34C 5BSRA 2PT7G 5IWAC 5CZXA 1N36C 3IEVA 3CJEA 3KXWA 2D1QA 2QL8A 4DR3C 4RMNA 4RM2A 5LMUC 2KZFA 3NYRA 1PA4A 2Y4NA 2UUBC 3LNVA 2Y27A 5JRHA 3ETCA 3TDEA 2QW0X 5BR8C 2V7BA 4JI4C 4D4GA 4JI7C 3AF6A 4NOZA 4L2ZA 3RG2A 4GS5A 5A1IA 4LF6C 2UUAC 2OBVA 2E8FA 2P2QA 3E7XA 4JI2C 1O90A 4LF4C 3LAXA 4R1MA 4JI6C 1IBLC 4IZ6A 2OPLB 1HNZC 5BSTA 4RM3A 2PN2A 2VSQA 4DCUA 3R9XA 2P20A 4X66C 5IFIA 2ASBA 1QM4A 2D27A 2UU9C 4DUZC 1J5EC 4KHPC 2WD9A 4DV7C 3FCEA 4TPSB 5BSMA 1PG4A 2OPLA 2EGTA 4LF8C 4LFAC 4WS9A 3PROC 3H2TA 5KEIA 2UXDC 5LMNC 4LF5C 4DR2C 4DV4C 2E8CA 1IBKC 1XNQC 4OXIA 1AMUA 3LUSA 4K0BA 4X65C 4EATA 3J81D 3A4IA 3RV2A 5A2QD 1ULTA 3GPCA 3A9VA 4ODJA 3PBKA 5KYTA 3CW8X 1FJGC 4DV6C 1O9TA 2XR1A 4G1IA 4DR1C 3E7WA 2P02A 3T1HC 3NI2A 3TUFA 4RLFA 5CZVA 2ONFA 3R44A 4D56A 2QVXX 2P2MA 4GKKC 1V25A 2E0GA 2BJOA 5KYVA 4PROC 2F4VC 3TQIA 4JI5C 4U5YD 2WP0C 3B7WA 4I9FA 1NYEA 4KTVA 2VQEC 4DR6C 4YHHC 5H9UA 1XMQC 1LQLA 4D4IA 1MDFA 1T5DX 1HNXC 3CW9A 4BBYA 3NPDA 4PZPA 5A19A 3I08A 5T8SA 4JV5C 4X64C 5AE1A 1XRAA 2PROA 4ISBA 2YWCA 1ZB8A 1K0RA 4DUYC 3N2QA 1YJ7A 3EERA 4AQYC 5A1GA 1O92A 1XRCA 3GKUA 4R1LA 3UZ0A 2AYAA 4ZLPA 4X62C 4NXNC 5BUQA 5IT9D 3DAYA 4DV3C 5DV9A 1O93A 3DLPX 3R9WA 2VZEA 4FUTA 5BSVA 1RY2A 1V26A 1QWIA 1IBMC 2ATWA 3EQ6A 3GR1A 2D28C 1USPB 4HPVA 4JYAC 1WF3A 3UOWA 4RVNA 3G7SA 4LF9C 1MDBA 1FUGA 4RLQA 4JI8C 4G36A 1XMOC 4RVOA 2YCBA 5BURA 3AF5A 4B3TC 4DCTA 3A9UA 4L4QA 4BCAA 4LE5A 2E7GA 4K0KC 1L2FA 2QVYX 4DV0C 4DG8A 3N54B 4FTFA 5AE3A 5BSUA 4IR7A 2ZM6C 5K85A 3GR0A 2P2FA 4NXMC 4OX9C 2VQFC 2D1RA 4WV3A 1MD9A 1HR0C 4G37A 3J7AD 2OO4A 2DPLA 4DV1C 3VNRA 3ETOA 2D7VA 3PESA 1T5HX 4GXQA 1ZB9A 4DR7C 1XNRC 2HJGA 3SO4A 4BSZA 2D1SA 1MXCA 4KTTA 2P2JA 4D57A 5ADZA 5FLXD 2D1TA 4JM1A 3JAMD 2JMPA 4B3SC 4ZJZA 4I9GA 1WH9A 5K8FA 1MKYA 5AE2A 4LFBC 1KKGA 3VNSA 3LGXA 1XRBA 5BSWA 2UXCC 1HH2P 4XX2A 2CY1A 3C5EA 1HNWC 3T1YC 1LCIA 2UUCC 4JI1C 2Y4OA 1VLAA 4L7IA 4DR5C 4DG9A 1ML8A 1EGAA 4NDNA 1JOSA 1MXAA 3VNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 C;  2E7G A;  1FJG C;  4DV6 C;  2UUB C;  4K0K C;  1L2F A;  2XR1 A;  4DR1 C;  4DV0 C;  3T1H C;  3I07 A;  5BR8 C;  4JI4 C;  3OTO C;  1UKK A;  1USP A;  4JI3 C;  4JI7 C;  3AF6 A;  2ZM6 C;  1N33 C;  4NOZ A;  2ONF A;  4LF6 C;  2HHH C;  1N2F A;  1I94 C;  4MH4 A;  2UUA C;  4GKK C;  2E8F A;  4NXM C;  4DCS A;  4OX9 C;  4JI2 C;  2VQF C;  2BJO A;  4LF4 C;  2F4V C;  1HR0 C;  4JI5 C;  3J7A D;  4JI6 C;  1IBL C;  4DV1 C;  1NYE A;  2OPL B;  2CXC A;  4MTN A;  2VQE C;  1HNZ C;  4DR6 C;  4YHH C;  2D7V A;  1XMQ C;  1LQL A;  2PN2 A;  4DCU A;  4B3R C;  3R9X A;  4X66 C;  1ZB9 A;  4DR7 C;  4B3M C;  1HNX C;  1XNR C;  2HJG A;  2ASB A;  4BSZ A;  2UU9 C;  2UXB C;  4DUZ C;  1J5E C;  4KHP C;  4JV5 C;  2DYJ A;  5FLX D;  4DCV A;  3IEU A;  4X64 C;  4DV5 C;  3JAM D;  2JMP A;  4B3S C;  4DV7 C;  1ZB8 A;  1K0R A;  1WH9 A;  4DUY C;  4LF7 C;  4GKJ C;  1MKY A;  3EER A;  4AQY C;  4DR4 C;  4JI0 C;  4DV2 C;  4YY3 C;  3GKU A;  2OPL A;  3J80 D;  4LFB C;  1KKG A;  2EGT A;  2E8E A;  2E5L C;  4LF8 C;  4LFA C;  4LFC C;  1N34 C;  2UXC C;  4X62 C;  4NXN C;  1HH2 P;  4XX2 A;  2CY1 A;  2PT7 G;  1HNW C;  5IT9 D;  5LMN C;  2UXD C;  4LF5 C;  5IWA C;  4DR2 C;  3T1Y C;  1N36 C;  4DV3 C;  3IEV A;  3CJE A;  4DV4 C;  2E8C A;  1IBK C;  2UUC C;  2QL8 A;  1XNQ C;  3R9W A;  1IBM C;  1QWI A;  3LUS A;  4DR3 C;  4X65 C;  4JI1 C;  2ATW A;  3J81 D;  1USP B;  1VLA A;  4JYA C;  5LMU C;  2KZF A;  4DR5 C;  1WF3 A;  5A2Q D;  4LF9 C;  1ML8 A;  1EGA A;  4JI8 C;  1PA4 A;  1JOS A;  1XMO C;  2YCB A;  3AF5 A;  4B3T C;  4DCT A; 
#chains in the Genus database with same CATH topology
 1N32 C;  2P2B A;  4BC7 A;  2ZZN A;  1M6X C;  3NYQ A;  4FUQ A;  3I07 A;  3OTO C;  1UKK A;  1USP A;  1RG9 A;  4JI3 C;  1N33 C;  2BH1 X;  5GTD A;  2HHH C;  1N2F A;  1I94 C;  3DHV A;  4MH4 A;  1PG3 A;  4OYC A;  4DCS A;  1M6X A;  1UWD A;  2CU6 A;  4R0M A;  4BC9 A;  3A25 A;  1GPM A;  3L95 X;  5E7Q A;  3S82 A;  2CXC A;  4MTN A;  1P7L A;  4B3R C;  4GXR A;  4B3M C;  3CQ2 A;  3L8C A;  4PHT A;  2UXB C;  3UEB A;  2DYJ A;  1BA3 A;  4DCV A;  2YWB A;  3IEU A;  4DV5 C;  4PUI A;  4PUH A;  4LF7 C;  3IPL A;  4GKJ C;  4DR4 C;  4JI0 C;  4DV2 C;  1MXB A;  5LCI A;  4YY3 C;  3J80 D;  3IML A;  3FCC A;  2E8E A;  2QVZ X;  5BUS A;  2E5L C;  5T8T A;  4LFC C;  1PU1 A;  1N34 C;  4PUG A;  5BSR A;  2PT7 G;  5IWA C;  5CZX A;  1N36 C;  3IEV A;  3CJE A;  3KXW A;  2D1Q A;  2QL8 A;  4DR3 C;  4RMN A;  4RM2 A;  2KDN A;  5LMU C;  2KZF A;  3NYR A;  1PA4 A;  1WCJ A;  3LNO A;  2Y4N A;  2Z51 A;  2UUB C;  3LNV A;  2Y27 A;  5JRH A;  3ETC A;  3TDE A;  2QW0 X;  1NY8 A;  5BR8 C;  2V7B A;  4JI4 C;  4D4G A;  4JI7 C;  3AF6 A;  4NOZ A;  3AY0 A;  4L2Z A;  4GS5 A;  3RG2 A;  5A1I A;  4LF6 C;  3K6R A;  2UUA C;  2YX1 A;  3UX2 A;  2OBV A;  2E8F A;  2P2Q A;  3E7X A;  4JI2 C;  1O90 A;  1VEH A;  4LF4 C;  3LAX A;  4R1M A;  4JI6 C;  1IBL C;  4IZ6 A;  2OPL B;  1HNZ C;  5BST A;  4RM3 A;  2PN2 A;  2VSQ A;  4DCU A;  3R9X A;  2P20 A;  4X66 C;  5IFI A;  2ASB A;  1QM4 A;  2D27 A;  2UU9 C;  4DUZ C;  1J5E C;  4KHP C;  2WD9 A;  2NCL A;  3TR3 A;  4DV7 C;  3FCE A;  4TPS B;  2MCQ A;  5BSM A;  1PG4 A;  2OPL A;  2EGT A;  4LF8 C;  4LFA C;  4WS9 A;  3PRO C;  3H2T A;  5KEI A;  2UXD C;  5LMN C;  4LF5 C;  1FLO A;  4DR2 C;  4DV4 C;  2E8C A;  1IBK C;  2DHM A;  1XNQ C;  4OXI A;  1AMU A;  3LUS A;  2ZTB A;  4K0B A;  4X65 C;  4EAT A;  3J81 D;  3CQ3 A;  3A4I A;  3RV2 A;  5A2Q D;  1ULT A;  1P4E C;  3GPC A;  3A9V A;  4ODJ A;  3PBK A;  5KYT A;  3CW8 X;  1FJG C;  4DV6 C;  1O9T A;  2XR1 A;  4G1I A;  4DR1 C;  3E7W A;  2P02 A;  3T1H C;  3NI2 A;  3TUF A;  4RLF A;  1P4E A;  5CZV A;  2ONF A;  3R44 A;  4D56 A;  2QVX X;  1XDX A;  2P2M A;  4GKK C;  1V25 A;  2E0G A;  2ZZM A;  2BJO A;  5KYV A;  4PRO C;  2F4V C;  3TQI A;  4JI5 C;  4U5Y D;  3CQ1 A;  2WP0 C;  3B7W A;  4I9F A;  3UX3 A;  1NYE A;  4KTV A;  2VQE C;  4DR6 C;  4YHH C;  5H9U A;  1XMQ C;  1LQL A;  4D4I A;  1MDF A;  1T5D X;  1HNX C;  3CW9 A;  4BBY A;  3NPD A;  4PZP A;  5A19 A;  3I08 A;  5T8S A;  4JV5 C;  4X64 C;  5AE1 A;  1XRA A;  2PRO A;  4ISB A;  2YWC A;  1ZB8 A;  1K0R A;  4DUY C;  3N2Q A;  1YJ7 A;  3EER A;  4AQY C;  5A1G A;  1O92 A;  1XRC A;  3GKU A;  4R1L A;  3UZ0 A;  2AYA A;  1XHJ A;  4ZLP A;  4X62 C;  4NXN C;  5BUQ A;  5IT9 D;  3DAY A;  4DV3 C;  5DV9 A;  1O93 A;  3DLP X;  3R9W A;  2VZE A;  4FUT A;  5BSV A;  1RY2 A;  1V26 A;  1QWI A;  1IBM C;  2ATW A;  3EQ6 A;  3GR1 A;  2D28 C;  1USP B;  4HPV A;  3A26 A;  3FM7 A;  4JYA C;  1WF3 A;  3UOW A;  4RVN A;  3G7S A;  4LF9 C;  2PG1 E;  1MDB A;  1FUG A;  4RLQ A;  4JI8 C;  4G36 A;  1XMO C;  4RVO A;  2YCB A;  5BUR A;  3AF5 A;  4B3T C;  4DCT A;  3A9U A;  4L4Q A;  4BCA A;  4LE5 A;  2E7G A;  4K0K C;  1L2F A;  2QVY X;  1IB8 A;  4DV0 C;  1YGT A;  4DG8 A;  3N54 B;  4FTF A;  5AE3 A;  5BSU A;  4IR7 A;  2ZM6 C;  5K85 A;  3GR0 A;  2P2F A;  4NXM C;  4OX9 C;  2VQF C;  2D1R A;  4WV3 A;  1MD9 A;  1HR0 C;  4G37 A;  3J7A D;  2OO4 A;  2DPL A;  4DV1 C;  3VNR A;  1V60 A;  1TH5 A;  3ETO A;  2D7V A;  2KZ0 A;  3PES A;  1T5H X;  4GXQ A;  1ZB9 A;  4DR7 C;  1XNR C;  2HJG A;  3SO4 A;  4BSZ A;  2D1S A;  2MM9 A;  1MXC A;  4KTT A;  2P2J A;  4D57 A;  5ADZ A;  5FLX D;  2D1T A;  4JM1 A;  3JAM D;  2JMP A;  4B3S C;  4ZJZ A;  4I9G A;  1WH9 A;  5K8F A;  1MKY A;  2MMA B;  3O2E A;  5AE2 A;  2JNV A;  4LFB C;  1KKG A;  3VNS A;  3LGX A;  1XRB A;  5BSW A;  2UXC C;  2M5O A;  1HH2 P;  4XX2 A;  2CY1 A;  3C5E A;  1HNW C;  3T1Y C;  1LCI A;  2UUC C;  4JI1 C;  2Y4O A;  1VLA A;  4L7I A;  1XS3 A;  4DR5 C;  4DG9 A;  1ML8 A;  1EGA A;  4NDN A;  1JOS A;  1MXA A;  3VNQ A;  2M5H A; 
#chains in the Genus database with same CATH homology
 1N32 C;  2P2B A;  4BC7 A;  3NYQ A;  4FUQ A;  3I07 A;  3OTO C;  1UKK A;  1USP A;  1RG9 A;  4JI3 C;  1N33 C;  2BH1 X;  5GTD A;  2HHH C;  1N2F A;  1I94 C;  3DHV A;  4MH4 A;  1PG3 A;  4OYC A;  4DCS A;  4R0M A;  4BC9 A;  1GPM A;  3L95 X;  5E7Q A;  3S82 A;  2CXC A;  4MTN A;  1P7L A;  4B3R C;  4GXR A;  4B3M C;  3L8C A;  4PHT A;  2UXB C;  2DYJ A;  1BA3 A;  4DCV A;  2YWB A;  3IEU A;  4DV5 C;  4LF7 C;  3IPL A;  4GKJ C;  4DR4 C;  4JI0 C;  4DV2 C;  1MXB A;  4YY3 C;  3J80 D;  3IML A;  3FCC A;  2E8E A;  2QVZ X;  5BUS A;  2E5L C;  5T8T A;  4LFC C;  1N34 C;  5BSR A;  2PT7 G;  5IWA C;  5CZX A;  1N36 C;  3IEV A;  3CJE A;  3KXW A;  2D1Q A;  2QL8 A;  4DR3 C;  4RMN A;  4RM2 A;  5LMU C;  2KZF A;  3NYR A;  1PA4 A;  2Y4N A;  2UUB C;  3LNV A;  2Y27 A;  5JRH A;  3ETC A;  3TDE A;  2QW0 X;  5BR8 C;  2V7B A;  4JI4 C;  4D4G A;  4JI7 C;  3AF6 A;  4NOZ A;  4L2Z A;  3RG2 A;  4GS5 A;  5A1I A;  4LF6 C;  2UUA C;  2OBV A;  2E8F A;  2P2Q A;  3E7X A;  4JI2 C;  1O90 A;  4LF4 C;  3LAX A;  4R1M A;  4JI6 C;  1IBL C;  4IZ6 A;  2OPL B;  1HNZ C;  5BST A;  4RM3 A;  2PN2 A;  2VSQ A;  4DCU A;  3R9X A;  2P20 A;  4X66 C;  5IFI A;  2ASB A;  1QM4 A;  2D27 A;  2UU9 C;  4DUZ C;  1J5E C;  4KHP C;  2WD9 A;  4DV7 C;  3FCE A;  4TPS B;  5BSM A;  1PG4 A;  2OPL A;  2EGT A;  4LF8 C;  4LFA C;  4WS9 A;  3PRO C;  3H2T A;  5KEI A;  2UXD C;  5LMN C;  4LF5 C;  4DR2 C;  4DV4 C;  2E8C A;  1IBK C;  1XNQ C;  4OXI A;  1AMU A;  3LUS A;  4K0B A;  4X65 C;  4EAT A;  3J81 D;  3A4I A;  3RV2 A;  5A2Q D;  1ULT A;  3GPC A;  3A9V A;  4ODJ A;  3PBK A;  5KYT A;  3CW8 X;  1FJG C;  4DV6 C;  1O9T A;  2XR1 A;  4G1I A;  4DR1 C;  3E7W A;  2P02 A;  3T1H C;  3NI2 A;  3TUF A;  4RLF A;  5CZV A;  2ONF A;  3R44 A;  4D56 A;  2QVX X;  2P2M A;  4GKK C;  1V25 A;  2E0G A;  2BJO A;  5KYV A;  4PRO C;  2F4V C;  3TQI A;  4JI5 C;  4U5Y D;  2WP0 C;  3B7W A;  4I9F A;  1NYE A;  4KTV A;  2VQE C;  4DR6 C;  4YHH C;  5H9U A;  1XMQ C;  1LQL A;  4D4I A;  1MDF A;  1T5D X;  1HNX C;  3CW9 A;  4BBY A;  3NPD A;  4PZP A;  5A19 A;  3I08 A;  5T8S A;  4JV5 C;  4X64 C;  5AE1 A;  1XRA A;  2PRO A;  4ISB A;  2YWC A;  1ZB8 A;  1K0R A;  4DUY C;  3N2Q A;  1YJ7 A;  3EER A;  4AQY C;  5A1G A;  1O92 A;  1XRC A;  3GKU A;  4R1L A;  3UZ0 A;  2AYA A;  4ZLP A;  4X62 C;  4NXN C;  5BUQ A;  5IT9 D;  3DAY A;  4DV3 C;  5DV9 A;  1O93 A;  3DLP X;  3R9W A;  2VZE A;  4FUT A;  5BSV A;  1RY2 A;  1V26 A;  1QWI A;  1IBM C;  2ATW A;  3EQ6 A;  3GR1 A;  2D28 C;  1USP B;  4HPV A;  4JYA C;  1WF3 A;  3UOW A;  4RVN A;  3G7S A;  4LF9 C;  1MDB A;  1FUG A;  4RLQ A;  4JI8 C;  4G36 A;  1XMO C;  4RVO A;  2YCB A;  5BUR A;  3AF5 A;  4B3T C;  4DCT A;  3A9U A;  4L4Q A;  4BCA A;  4LE5 A;  2E7G A;  4K0K C;  1L2F A;  2QVY X;  4DV0 C;  4DG8 A;  3N54 B;  4FTF A;  5AE3 A;  5BSU A;  4IR7 A;  2ZM6 C;  5K85 A;  3GR0 A;  2P2F A;  4NXM C;  4OX9 C;  2VQF C;  2D1R A;  4WV3 A;  1MD9 A;  1HR0 C;  4G37 A;  3J7A D;  2OO4 A;  2DPL A;  4DV1 C;  3VNR A;  3ETO A;  2D7V A;  3PES A;  1T5H X;  4GXQ A;  1ZB9 A;  4DR7 C;  1XNR C;  2HJG A;  3SO4 A;  4BSZ A;  2D1S A;  1MXC A;  4KTT A;  2P2J A;  4D57 A;  5ADZ A;  5FLX D;  2D1T A;  4JM1 A;  3JAM D;  2JMP A;  4B3S C;  4ZJZ A;  4I9G A;  1WH9 A;  5K8F A;  1MKY A;  5AE2 A;  4LFB C;  1KKG A;  3VNS A;  3LGX A;  1XRB A;  5BSW A;  2UXC C;  1HH2 P;  4XX2 A;  2CY1 A;  3C5E A;  1HNW C;  3T1Y C;  1LCI A;  2UUC C;  4JI1 C;  2Y4O A;  1VLA A;  4L7I A;  4DR5 C;  4DG9 A;  1ML8 A;  1EGA A;  4NDN A;  1JOS A;  1MXA A;  3VNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...