4DV4C

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 38
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dv4C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4dv4C02
2UUAC 5IWAC 2ATWA 1XNRC 1N36C 3GKUA 4B3RC 3AF6A 3EERA 2ONFA 3IEUA 2E8FA 4LF9C 1NYEA 1WH9A 4DR2C 2E5LC 1JOSA 1HR0C 4X65C 4DR1C 2CY1A 4DR7C 3LUSA 4LF4C 4DR3C 2QL8A 3OTOC 4JI2C 4NXNC 2VQFC 1MKYA 4DV3C 1PA4A 4LF5C 3AF5A 4XX2A 4AQYC 1HNXC 1XNQC 1N32C 3J80D 1XMQC 1HNZC 4DCTA 1QWIA 4GKKC 1USPB 4NOZA 5LMNC 1ZB9A 4MH4A 4JI0C 4DR4C 4B3TC 2KZFA 2YCBA 5IT9D 2E8CA 1K0RA 4YHHC 1IBMC 1VLAA 4DUYC 3T1YC 1WF3A 1ML8A 1N2FA 1UKKA 4YY3C 3IEVA 4DR6C 4DV2C 1EGAA 4DV0C 2ASBA 1N34C 5BR8C 2UXDC 1L2FA 4NXMC 3CJEA 2VQEC 4DR5C 4LF8C 2F4VC 4DCUA 1IBKC 5A2QD 4DV7C 4K0KC 1USPA 2DYJA 2HHHC 2BJOA 3I07A 2E8EA 2UU9C 4LFBC 4LFAC 5LMUC 3JAMD 4JI6C 2OPLB 2D7VA 2E7GA 1LQLA 2OPLA 3T1HC 1IBLC 4B3SC 1N33C 4LFCC 4B3MC 3R9XA 4DV4C 4X64C 2XR1A 4DV5C 2UUBC 3J81D 2CXCA 4X66C 4JI8C 4GKJC 4KHPC 2PN2A 4DCVA 1HNWC 4MTNA 1HH2P 5FLXD 4DV1C 4JV5C 4JYAC 2HJGA 4DV6C 1I94C 4LF7C 4JI5C 2PT7G 4DCSA 4JI3C 4JI1C 1ZB8A 2EGTA 2UXCC 4OX9C 4JI4C 4JI7C 2ZM6C 2UXBC 1J5EC 2UUCC 2JMPA 1XMOC 3R9WA 1FJGC 3J7AD 4X62C 4DUZC 4LF6C 4BSZA 1KKGA
chains in the Genus database with same CATH superfamily
2UUAC 1O93A 1XNRC 5A19A 3AF6A 4G1IA 2D27A 1XRAA 4NDNA 2PROA 5KEIA 1MD9A 2KDNA 2E5LC 1PU1A 1JOSA 4FUQA 2WD9A 4X65C 1V60A 4D56A 3E7WA 4DR7C 3LUSA 1PG3A 4DR3C 2VQFC 3DLPX 1IB8A 1HNXC 1XMQC 4PROC 3LAXA 4DCTA 1YGTA 3GPCA 4GKKC 4NOZA 1MDFA 4MH4A 5LCIA 4B3TC 2KZFA 1MXAA 2E8CA 1FUGA 4G36A 1IBMC 2DPLA 1VLAA 2D1TA 1XDXA 4DR6C 5ADZA 1XRBA 5AE1A 2YX1A 5BR8C 3VNSA 2UXDC 2JNVA 4TPSB 4FTFA 4LF8C 5AE3A 4BBYA 3FM7A 1XS3A 2DYJA 3O2EA 3TR3A 4LFBC 1QM4A 4LFAC 1O9TA 4ZLPA 2OPLB 1YJ7A 1IBLC 4LFCC 3R9XA 4BC7A 2XR1A 4X66C 3CW8X 2E0GA 2PN2A 4R1LA 4DV1C 4DV6C 4DCSA 3RV2A 1MDBA 2EGTA 4OX9C 4D4IA 3UEBA 3N54B 4GXRA 3A26A 4JI4C 2ZM6C 1O90A 1J5EC 2UUCC 5BSRA 4ISBA 3J7AD 2Y4OA 4DUZC 4U5YD 1KKGA 5KYTA 1N36C 1XHJA 4L4QA 3EERA 1PG4A 2E8FA 3S82A 4FUTA 4LF9C 1NYEA 1WH9A 1HR0C 3A4IA 3H2TA 3TQIA 2CY1A 2WP0C 5E7QA 2P2QA 3AF5A 4RMNA 4RM3A 3KXWA 1HNZC 3A25A 1V25A 1QWIA 1V26A 2VZEA 3NYRA 2NCLA 4DR4C 2YCBA 3ETOA 4PUHA 2P2JA 4OXIA 3IMLA 1WF3A 1N2FA 4PZPA 4YY3C 4PUGA 4DV0C 4NXMC 3CJEA 2M5HA 1MXCA 3A9UA 3B7WA 3L8CA 4DCUA 1IBKC 4DV7C 3TDEA 1USPA 4I9FA 4HPVA 2P02A 3I07A 4RM2A 3CQ3A 3LGXA 4JI6C 2OO4A 1N33C 4RLQA 1M6XA 2QVZX 4DG9A 1TH5A 4DG8A 4X64C 4OYCA 3J81D 4D4GA 5FLXD 4RVOA 1I94C 2BH1X 1RY2A 4JI1C 1ZB8A 2UXCC 1WCJA 3LNOA 5A1IA 3NI2A 2KZ0A 4JI7C 5BUSA 2JMPA 1FJGC 4X62C 2P2BA 2AYAA 2MMAB 3RG2A 3NYQA 2ATWA 4L7IA 3GKUA 5DV9A 4G37A 5BSUA 2VSQA 2P20A 5T8SA 3UOWA 3LNVA 5BSVA 3PROC 4BC9A 5JRHA 2D1RA 5T8TA 4DR1C 2QVXX 3TUFA 4LF4C 2QL8A 5IFIA 1MKYA 4DV3C 1PA4A 3AY0A 2ZTBA 4XX2A 4AQYC 1XNQC 3C5EA 5KYVA 1AMUA 1N32C 2MM9A 1USPB 1VEHA 1ZB9A 4JI0C 3DHVA 3GR1A 4ODJA 5IT9D 2QVYX 1K0RA 2V7BA 1NY8A 5K85A 3T1YC 1ML8A 3UX2A 1UKKA 4WS9A 3IEVA 4DV2C 2MCQA 4RVNA 1EGAA 2ASBA 1N34C 2YWBA 1UWDA 1L2FA 4DR5C 5A1GA 2D1SA 2Y27A 5A2QD 3ETCA 2OBVA 5BSTA 2UU9C 3CQ1A 4KTTA 2D7VA 3VNRA 2E7GA 1LQLA 2OPLA 3T1HC 3G7SA 4B3SC 4I9GA 4DV4C 1T5DX 4LE5A 4JI8C 1P4EC 2D1QA 4JM1A 5CZVA 1RG9A 4DCVA 4MTNA 1HH2P 4JV5C 4JYAC 3SO4A 4LF7C 4JI3C 2D28C 3A9VA 3N2QA 3DAYA 4PHTA 2P2MA 5BUQA 1XMOC 5BURA 3R9WA 5GTDA 4KTVA 4BCAA 4IR7A 5IWAC 3UZ0A 1GPMA 5BSMA 2M5OA 3CQ2A 4L2ZA 4B3RC 2P2FA 2ONFA 3IEUA 3VNQA 4DR2C 3L95X 1FLOA 3FCCA 5H9UA 3OTOC 4JI2C 4NXNC 4IZ6A 2DHMA 4LF5C 2PG1E 2ZZNA 3J80D 3EQ6A 2YWCA 1T5HX 2Z51A 3FCEA 5LMNC 2Y4NA 4GXQA 4YHHC 4R0MA 4DUYC 4GS5A 1ULTA 4PUIA 1P4EA 4ZJZA 5BSWA 2VQEC 1XRCA 4K0BA 2F4VC 4EATA 4K0KC 2HHHC 2BJOA 2E8EA 5LMUC 3UX3A 1MXBA 4RLFA 3JAMD 2QW0X 2CU6A 3PESA 5AE2A 4B3MC 3PBKA 3IPLA 4DV5C 2UUBC 3R44A 1M6XC 2CXCA 3GR0A 1O92A 4GKJC 4KHPC 1HNWC 5CZXA 3NPDA 2HJGA 5K8FA 4JI5C 2PT7G 2ZZMA 3K6RA 1BA3A 2UXBC 3E7XA 4R1MA 3CW9A 1LCIA 1P7LA 4WV3A 3I08A 4LF6C 4BSZA 4D57A
chains in the Genus database with same CATH topology
2UUAC 1O93A 1XNRC 5A19A 3AF6A 4G1IA 2D27A 1XRAA 4NDNA 2PROA 5KEIA 1MD9A 2E5LC 1JOSA 4FUQA 2WD9A 4X65C 4D56A 3E7WA 4DR7C 3LUSA 1PG3A 4DR3C 2VQFC 3DLPX 1HNXC 1XMQC 4PROC 3LAXA 4DCTA 3GPCA 4GKKC 4NOZA 1MDFA 4MH4A 4B3TC 2KZFA 1MXAA 2E8CA 1FUGA 4G36A 1IBMC 2DPLA 1VLAA 2D1TA 4DR6C 5ADZA 1XRBA 5AE1A 5BR8C 3VNSA 2UXDC 4TPSB 4FTFA 4LF8C 5AE3A 4BBYA 2DYJA 4LFBC 1QM4A 4LFAC 1O9TA 4ZLPA 2OPLB 1YJ7A 1IBLC 4LFCC 3R9XA 4BC7A 2XR1A 4X66C 3CW8X 2E0GA 2PN2A 4R1LA 4DV1C 4DV6C 4DCSA 3RV2A 1MDBA 2EGTA 4OX9C 4D4IA 3N54B 4GXRA 4JI4C 2ZM6C 1O90A 1J5EC 2UUCC 5BSRA 4ISBA 3J7AD 2Y4OA 4DUZC 4U5YD 1KKGA 5KYTA 1N36C 4L4QA 3EERA 1PG4A 2E8FA 3S82A 4FUTA 4LF9C 1NYEA 1WH9A 1HR0C 3A4IA 3H2TA 3TQIA 2CY1A 2WP0C 5E7QA 2P2QA 3AF5A 4RMNA 4RM3A 3KXWA 1HNZC 1V25A 1QWIA 1V26A 2VZEA 3NYRA 4DR4C 2YCBA 3ETOA 2P2JA 4OXIA 3IMLA 1WF3A 1N2FA 4PZPA 4YY3C 4DV0C 4NXMC 3CJEA 1MXCA 3A9UA 3B7WA 3L8CA 4DCUA 1IBKC 4DV7C 3TDEA 1USPA 4I9FA 4HPVA 2P02A 3I07A 4RM2A 3LGXA 4JI6C 2OO4A 1N33C 4RLQA 2QVZX 4DG9A 4DG8A 4X64C 4OYCA 3J81D 4D4GA 5FLXD 4RVOA 1I94C 2BH1X 1RY2A 4JI1C 1ZB8A 2UXCC 5A1IA 3NI2A 4JI7C 5BUSA 2JMPA 1FJGC 4X62C 2P2BA 2AYAA 3RG2A 3NYQA 2ATWA 4L7IA 3GKUA 5DV9A 4G37A 5BSUA 2VSQA 2P20A 5T8SA 3UOWA 3LNVA 5BSVA 3PROC 4BC9A 5JRHA 2D1RA 5T8TA 4DR1C 2QVXX 3TUFA 4LF4C 2QL8A 5IFIA 1MKYA 4DV3C 1PA4A 4XX2A 4AQYC 1XNQC 3C5EA 5KYVA 1AMUA 1N32C 1USPB 1ZB9A 4JI0C 3DHVA 3GR1A 4ODJA 5IT9D 2QVYX 1K0RA 2V7BA 5K85A 3T1YC 1ML8A 1UKKA 4WS9A 3IEVA 4DV2C 4RVNA 1EGAA 2ASBA 1N34C 2YWBA 1L2FA 4DR5C 5A1GA 2D1SA 2Y27A 5A2QD 3ETCA 2OBVA 5BSTA 2UU9C 4KTTA 2D7VA 2E7GA 1LQLA 2OPLA 3VNRA 3T1HC 3G7SA 4B3SC 4I9GA 4DV4C 1T5DX 4LE5A 4JI8C 2D1QA 4JM1A 5CZVA 1RG9A 4DCVA 4MTNA 1HH2P 4JV5C 4JYAC 3SO4A 4LF7C 4JI3C 2D28C 3A9VA 3N2QA 3DAYA 4PHTA 2P2MA 5BUQA 1XMOC 5BURA 3R9WA 5GTDA 4KTVA 4BCAA 4IR7A 5IWAC 3UZ0A 1GPMA 5BSMA 4L2ZA 4B3RC 2P2FA 2ONFA 3IEUA 3VNQA 4DR2C 3L95X 3FCCA 5H9UA 3OTOC 4JI2C 4NXNC 4IZ6A 4LF5C 3J80D 3EQ6A 2YWCA 1T5HX 3FCEA 5LMNC 2Y4NA 4GXQA 4YHHC 4R0MA 4DUYC 4GS5A 1ULTA 4ZJZA 5BSWA 2VQEC 1XRCA 4K0BA 2F4VC 4EATA 4K0KC 2HHHC 2BJOA 2E8EA 5LMUC 1MXBA 4RLFA 3JAMD 2QW0X 3PESA 5AE2A 4B3MC 3PBKA 3IPLA 4DV5C 2UUBC 3R44A 2CXCA 3GR0A 1O92A 4GKJC 4KHPC 1HNWC 5CZXA 3NPDA 2HJGA 5K8FA 4JI5C 2PT7G 1BA3A 2UXBC 3E7XA 4R1MA 3CW9A 1LCIA 1P7LA 4WV3A 3I08A 4LF6C 4BSZA 4D57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  5IWA C;  2ATW A;  1XNR C;  1N36 C;  3GKU A;  4B3R C;  3AF6 A;  3EER A;  2ONF A;  3IEU A;  2E8F A;  4LF9 C;  1NYE A;  1WH9 A;  4DR2 C;  2E5L C;  1JOS A;  1HR0 C;  4X65 C;  4DR1 C;  2CY1 A;  4DR7 C;  3LUS A;  4LF4 C;  4DR3 C;  2QL8 A;  3OTO C;  4JI2 C;  4NXN C;  2VQF C;  1MKY A;  4DV3 C;  1PA4 A;  4LF5 C;  3AF5 A;  4XX2 A;  4AQY C;  1HNX C;  1XNQ C;  1N32 C;  3J80 D;  1XMQ C;  1HNZ C;  4DCT A;  1QWI A;  4GKK C;  1USP B;  4NOZ A;  5LMN C;  1ZB9 A;  4MH4 A;  4JI0 C;  4DR4 C;  4B3T C;  2KZF A;  2YCB A;  5IT9 D;  2E8C A;  1K0R A;  4YHH C;  1IBM C;  1VLA A;  4DUY C;  3T1Y C;  1WF3 A;  1ML8 A;  1N2F A;  1UKK A;  4YY3 C;  3IEV A;  4DR6 C;  4DV2 C;  1EGA A;  4DV0 C;  2ASB A;  1N34 C;  5BR8 C;  2UXD C;  1L2F A;  4NXM C;  3CJE A;  2VQE C;  4DR5 C;  4LF8 C;  2F4V C;  4DCU A;  1IBK C;  5A2Q D;  4DV7 C;  4K0K C;  1USP A;  2DYJ A;  2HHH C;  2BJO A;  3I07 A;  2E8E A;  2UU9 C;  4LFB C;  4LFA C;  5LMU C;  3JAM D;  4JI6 C;  2OPL B;  2D7V A;  2E7G A;  1LQL A;  2OPL A;  3T1H C;  1IBL C;  4B3S C;  1N33 C;  4LFC C;  4B3M C;  3R9X A;  4DV4 C;  4X64 C;  2XR1 A;  4DV5 C;  2UUB C;  3J81 D;  2CXC A;  4X66 C;  4JI8 C;  4GKJ C;  4KHP C;  2PN2 A;  4DCV A;  1HNW C;  4MTN A;  1HH2 P;  5FLX D;  4DV1 C;  4JV5 C;  4JYA C;  2HJG A;  4DV6 C;  1I94 C;  4LF7 C;  4JI5 C;  2PT7 G;  4DCS A;  4JI3 C;  4JI1 C;  1ZB8 A;  2EGT A;  2UXC C;  4OX9 C;  4JI4 C;  4JI7 C;  2ZM6 C;  2UXB C;  1J5E C;  2UUC C;  2JMP A;  1XMO C;  3R9W A;  1FJG C;  3J7A D;  4X62 C;  4DUZ C;  4LF6 C;  4BSZ A;  1KKG A; 
#chains in the Genus database with same CATH topology
 2UUA C;  1O93 A;  1XNR C;  5A19 A;  3AF6 A;  4G1I A;  2D27 A;  1XRA A;  4NDN A;  2PRO A;  5KEI A;  1MD9 A;  2KDN A;  2E5L C;  1PU1 A;  1JOS A;  4FUQ A;  2WD9 A;  4X65 C;  1V60 A;  4D56 A;  3E7W A;  4DR7 C;  3LUS A;  1PG3 A;  4DR3 C;  2VQF C;  3DLP X;  1IB8 A;  1HNX C;  1XMQ C;  4PRO C;  3LAX A;  4DCT A;  1YGT A;  3GPC A;  4GKK C;  4NOZ A;  1MDF A;  4MH4 A;  5LCI A;  4B3T C;  2KZF A;  1MXA A;  2E8C A;  1FUG A;  4G36 A;  1IBM C;  2DPL A;  1VLA A;  2D1T A;  1XDX A;  4DR6 C;  5ADZ A;  1XRB A;  5AE1 A;  2YX1 A;  5BR8 C;  3VNS A;  2UXD C;  2JNV A;  4TPS B;  4FTF A;  4LF8 C;  5AE3 A;  4BBY A;  3FM7 A;  1XS3 A;  2DYJ A;  3O2E A;  3TR3 A;  4LFB C;  1QM4 A;  4LFA C;  1O9T A;  4ZLP A;  2OPL B;  1YJ7 A;  1IBL C;  4LFC C;  3R9X A;  4BC7 A;  2XR1 A;  4X66 C;  3CW8 X;  2E0G A;  2PN2 A;  4R1L A;  4DV1 C;  4DV6 C;  4DCS A;  3RV2 A;  1MDB A;  2EGT A;  4OX9 C;  4D4I A;  3UEB A;  3N54 B;  4GXR A;  3A26 A;  4JI4 C;  2ZM6 C;  1O90 A;  1J5E C;  2UUC C;  5BSR A;  4ISB A;  3J7A D;  2Y4O A;  4DUZ C;  4U5Y D;  1KKG A;  5KYT A;  1N36 C;  1XHJ A;  4L4Q A;  3EER A;  1PG4 A;  2E8F A;  3S82 A;  4FUT A;  4LF9 C;  1NYE A;  1WH9 A;  1HR0 C;  3A4I A;  3H2T A;  3TQI A;  2CY1 A;  2WP0 C;  5E7Q A;  2P2Q A;  3AF5 A;  4RMN A;  4RM3 A;  3KXW A;  1HNZ C;  3A25 A;  1V25 A;  1QWI A;  1V26 A;  2VZE A;  3NYR A;  2NCL A;  4DR4 C;  2YCB A;  3ETO A;  4PUH A;  2P2J A;  4OXI A;  3IML A;  1WF3 A;  1N2F A;  4PZP A;  4YY3 C;  4PUG A;  4DV0 C;  4NXM C;  3CJE A;  2M5H A;  1MXC A;  3A9U A;  3B7W A;  3L8C A;  4DCU A;  1IBK C;  4DV7 C;  3TDE A;  1USP A;  4I9F A;  4HPV A;  2P02 A;  3I07 A;  4RM2 A;  3CQ3 A;  3LGX A;  4JI6 C;  2OO4 A;  1N33 C;  4RLQ A;  1M6X A;  2QVZ X;  4DG9 A;  1TH5 A;  4DG8 A;  4X64 C;  4OYC A;  3J81 D;  4D4G A;  5FLX D;  4RVO A;  1I94 C;  2BH1 X;  1RY2 A;  4JI1 C;  1ZB8 A;  2UXC C;  1WCJ A;  3LNO A;  5A1I A;  3NI2 A;  2KZ0 A;  4JI7 C;  5BUS A;  2JMP A;  1FJG C;  4X62 C;  2P2B A;  2AYA A;  2MMA B;  3RG2 A;  3NYQ A;  2ATW A;  4L7I A;  3GKU A;  5DV9 A;  4G37 A;  5BSU A;  2VSQ A;  2P20 A;  5T8S A;  3UOW A;  3LNV A;  5BSV A;  3PRO C;  4BC9 A;  5JRH A;  2D1R A;  5T8T A;  4DR1 C;  2QVX X;  3TUF A;  4LF4 C;  2QL8 A;  5IFI A;  1MKY A;  4DV3 C;  1PA4 A;  3AY0 A;  2ZTB A;  4XX2 A;  4AQY C;  1XNQ C;  3C5E A;  5KYV A;  1AMU A;  1N32 C;  2MM9 A;  1USP B;  1VEH A;  1ZB9 A;  4JI0 C;  3DHV A;  3GR1 A;  4ODJ A;  5IT9 D;  2QVY X;  1K0R A;  2V7B A;  1NY8 A;  5K85 A;  3T1Y C;  1ML8 A;  3UX2 A;  1UKK A;  4WS9 A;  3IEV A;  4DV2 C;  2MCQ A;  4RVN A;  1EGA A;  2ASB A;  1N34 C;  2YWB A;  1UWD A;  1L2F A;  4DR5 C;  5A1G A;  2D1S A;  2Y27 A;  5A2Q D;  3ETC A;  2OBV A;  5BST A;  2UU9 C;  3CQ1 A;  4KTT A;  2D7V A;  3VNR A;  2E7G A;  1LQL A;  2OPL A;  3T1H C;  3G7S A;  4B3S C;  4I9G A;  4DV4 C;  1T5D X;  4LE5 A;  4JI8 C;  1P4E C;  2D1Q A;  4JM1 A;  5CZV A;  1RG9 A;  4DCV A;  4MTN A;  1HH2 P;  4JV5 C;  4JYA C;  3SO4 A;  4LF7 C;  4JI3 C;  2D28 C;  3A9V A;  3N2Q A;  3DAY A;  4PHT A;  2P2M A;  5BUQ A;  1XMO C;  5BUR A;  3R9W A;  5GTD A;  4KTV A;  4BCA A;  4IR7 A;  5IWA C;  3UZ0 A;  1GPM A;  5BSM A;  2M5O A;  3CQ2 A;  4L2Z A;  4B3R C;  2P2F A;  2ONF A;  3IEU A;  3VNQ A;  4DR2 C;  3L95 X;  1FLO A;  3FCC A;  5H9U A;  3OTO C;  4JI2 C;  4NXN C;  4IZ6 A;  2DHM A;  4LF5 C;  2PG1 E;  2ZZN A;  3J80 D;  3EQ6 A;  2YWC A;  1T5H X;  2Z51 A;  3FCE A;  5LMN C;  2Y4N A;  4GXQ A;  4YHH C;  4R0M A;  4DUY C;  4GS5 A;  1ULT A;  4PUI A;  1P4E A;  4ZJZ A;  5BSW A;  2VQE C;  1XRC A;  4K0B A;  2F4V C;  4EAT A;  4K0K C;  2HHH C;  2BJO A;  2E8E A;  5LMU C;  3UX3 A;  1MXB A;  4RLF A;  3JAM D;  2QW0 X;  2CU6 A;  3PES A;  5AE2 A;  4B3M C;  3PBK A;  3IPL A;  4DV5 C;  2UUB C;  3R44 A;  1M6X C;  2CXC A;  3GR0 A;  1O92 A;  4GKJ C;  4KHP C;  1HNW C;  5CZX A;  3NPD A;  2HJG A;  5K8F A;  4JI5 C;  2PT7 G;  2ZZM A;  3K6R A;  1BA3 A;  2UXB C;  3E7X A;  4R1M A;  3CW9 A;  1LCI A;  1P7L A;  4WV3 A;  3I08 A;  4LF6 C;  4BSZ A;  4D57 A; 
#chains in the Genus database with same CATH homology
 2UUA C;  1O93 A;  1XNR C;  5A19 A;  3AF6 A;  4G1I A;  2D27 A;  1XRA A;  4NDN A;  2PRO A;  5KEI A;  1MD9 A;  2E5L C;  1JOS A;  4FUQ A;  2WD9 A;  4X65 C;  4D56 A;  3E7W A;  4DR7 C;  3LUS A;  1PG3 A;  4DR3 C;  2VQF C;  3DLP X;  1HNX C;  1XMQ C;  4PRO C;  3LAX A;  4DCT A;  3GPC A;  4GKK C;  4NOZ A;  1MDF A;  4MH4 A;  4B3T C;  2KZF A;  1MXA A;  2E8C A;  1FUG A;  4G36 A;  1IBM C;  2DPL A;  1VLA A;  2D1T A;  4DR6 C;  5ADZ A;  1XRB A;  5AE1 A;  5BR8 C;  3VNS A;  2UXD C;  4TPS B;  4FTF A;  4LF8 C;  5AE3 A;  4BBY A;  2DYJ A;  4LFB C;  1QM4 A;  4LFA C;  1O9T A;  4ZLP A;  2OPL B;  1YJ7 A;  1IBL C;  4LFC C;  3R9X A;  4BC7 A;  2XR1 A;  4X66 C;  3CW8 X;  2E0G A;  2PN2 A;  4R1L A;  4DV1 C;  4DV6 C;  4DCS A;  3RV2 A;  1MDB A;  2EGT A;  4OX9 C;  4D4I A;  3N54 B;  4GXR A;  4JI4 C;  2ZM6 C;  1O90 A;  1J5E C;  2UUC C;  5BSR A;  4ISB A;  3J7A D;  2Y4O A;  4DUZ C;  4U5Y D;  1KKG A;  5KYT A;  1N36 C;  4L4Q A;  3EER A;  1PG4 A;  2E8F A;  3S82 A;  4FUT A;  4LF9 C;  1NYE A;  1WH9 A;  1HR0 C;  3A4I A;  3H2T A;  3TQI A;  2CY1 A;  2WP0 C;  5E7Q A;  2P2Q A;  3AF5 A;  4RMN A;  4RM3 A;  3KXW A;  1HNZ C;  1V25 A;  1QWI A;  1V26 A;  2VZE A;  3NYR A;  4DR4 C;  2YCB A;  3ETO A;  2P2J A;  4OXI A;  3IML A;  1WF3 A;  1N2F A;  4PZP A;  4YY3 C;  4DV0 C;  4NXM C;  3CJE A;  1MXC A;  3A9U A;  3B7W A;  3L8C A;  4DCU A;  1IBK C;  4DV7 C;  3TDE A;  1USP A;  4I9F A;  4HPV A;  2P02 A;  3I07 A;  4RM2 A;  3LGX A;  4JI6 C;  2OO4 A;  1N33 C;  4RLQ A;  2QVZ X;  4DG9 A;  4DG8 A;  4X64 C;  4OYC A;  3J81 D;  4D4G A;  5FLX D;  4RVO A;  1I94 C;  2BH1 X;  1RY2 A;  4JI1 C;  1ZB8 A;  2UXC C;  5A1I A;  3NI2 A;  4JI7 C;  5BUS A;  2JMP A;  1FJG C;  4X62 C;  2P2B A;  2AYA A;  3RG2 A;  3NYQ A;  2ATW A;  4L7I A;  3GKU A;  5DV9 A;  4G37 A;  5BSU A;  2VSQ A;  2P20 A;  5T8S A;  3UOW A;  3LNV A;  5BSV A;  3PRO C;  4BC9 A;  5JRH A;  2D1R A;  5T8T A;  4DR1 C;  2QVX X;  3TUF A;  4LF4 C;  2QL8 A;  5IFI A;  1MKY A;  4DV3 C;  1PA4 A;  4XX2 A;  4AQY C;  1XNQ C;  3C5E A;  5KYV A;  1AMU A;  1N32 C;  1USP B;  1ZB9 A;  4JI0 C;  3DHV A;  3GR1 A;  4ODJ A;  5IT9 D;  2QVY X;  1K0R A;  2V7B A;  5K85 A;  3T1Y C;  1ML8 A;  1UKK A;  4WS9 A;  3IEV A;  4DV2 C;  4RVN A;  1EGA A;  2ASB A;  1N34 C;  2YWB A;  1L2F A;  4DR5 C;  5A1G A;  2D1S A;  2Y27 A;  5A2Q D;  3ETC A;  2OBV A;  5BST A;  2UU9 C;  4KTT A;  2D7V A;  2E7G A;  1LQL A;  2OPL A;  3VNR A;  3T1H C;  3G7S A;  4B3S C;  4I9G A;  4DV4 C;  1T5D X;  4LE5 A;  4JI8 C;  2D1Q A;  4JM1 A;  5CZV A;  1RG9 A;  4DCV A;  4MTN A;  1HH2 P;  4JV5 C;  4JYA C;  3SO4 A;  4LF7 C;  4JI3 C;  2D28 C;  3A9V A;  3N2Q A;  3DAY A;  4PHT A;  2P2M A;  5BUQ A;  1XMO C;  5BUR A;  3R9W A;  5GTD A;  4KTV A;  4BCA A;  4IR7 A;  5IWA C;  3UZ0 A;  1GPM A;  5BSM A;  4L2Z A;  4B3R C;  2P2F A;  2ONF A;  3IEU A;  3VNQ A;  4DR2 C;  3L95 X;  3FCC A;  5H9U A;  3OTO C;  4JI2 C;  4NXN C;  4IZ6 A;  4LF5 C;  3J80 D;  3EQ6 A;  2YWC A;  1T5H X;  3FCE A;  5LMN C;  2Y4N A;  4GXQ A;  4YHH C;  4R0M A;  4DUY C;  4GS5 A;  1ULT A;  4ZJZ A;  5BSW A;  2VQE C;  1XRC A;  4K0B A;  2F4V C;  4EAT A;  4K0K C;  2HHH C;  2BJO A;  2E8E A;  5LMU C;  1MXB A;  4RLF A;  3JAM D;  2QW0 X;  3PES A;  5AE2 A;  4B3M C;  3PBK A;  3IPL A;  4DV5 C;  2UUB C;  3R44 A;  2CXC A;  3GR0 A;  1O92 A;  4GKJ C;  4KHP C;  1HNW C;  5CZX A;  3NPD A;  2HJG A;  5K8F A;  4JI5 C;  2PT7 G;  1BA3 A;  2UXB C;  3E7X A;  4R1M A;  3CW9 A;  1LCI A;  1P7L A;  4WV3 A;  3I08 A;  4LF6 C;  4BSZ A;  4D57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...