4JI3C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji3C02
2F4VC 1JOSA 4K0KC 2UXCC 3IEUA 4B3SC 1J5EC 3AF5A 2E8CA 4DCSA 3EERA 2UUCC 4BSZA 4JI4C 4DV7C 1UKKA 4DCUA 4JI6C 4DV1C 3T1HC 1HH2P 2D7VA 1HNXC 2KZFA 4DR3C 1N33C 1K0RA 2OPLA 2E5LC 4DCTA 3LUSA 3I07A 1LQLA 1KKGA 5LMNC 2UU9C 4GKKC 4LF9C 4DUZC 4JI2C 4X66C 1ZB9A 4LF8C 4DR2C 4JI7C 1XNQC 4X65C 4B3RC 4DV4C 2QL8A 1EGAA 4X62C 4DV2C 1XMQC 4JYAC 2E8FA 4DR5C 1XMOC 2XR1A 1HR0C 2DYJA 4NXNC 2ATWA 3J81D 1MKYA 2E7GA 1N34C 4JV5C 1N2FA 2BJOA 2CXCA 1FJGC 1XNRC 4LF5C 3J80D 1IBMC 2VQFC 4JI0C 1ZB8A 2E8EA 2HJGA 4MTNA 4YY3C 5LMUC 3AF6A 1USPA 2UXBC 4DV5C 4MH4A 2UUAC 3JAMD 1HNWC 4DR6C 3CJEA 1HNZC 3T1YC 1VLAA 4DR4C 1USPB 4OX9C 4GKJC 4JI5C 2HHHC 3J7AD 2CY1A 4XX2A 4JI1C 4B3TC 2YCBA 2PT7G 2VQEC 4LFBC 4LF7C 4DUYC 3IEVA 5BR8C 2EGTA 4DV6C 4AQYC 4B3MC 2UUBC 4LF4C 4DR1C 2UXDC 4LFAC 5A2QD 1PA4A 1WF3A 4JI8C 4X64C 2JMPA 1ML8A 5IWAC 3OTOC 1L2FA 1QWIA 4NOZA 5IT9D 5FLXD 2ZM6C 2ASBA 1IBKC 4DR7C 2PN2A 2OPLB 1I94C 4DV0C 4LF6C 4LFCC 1N32C 1N36C 1NYEA 3R9XA 3R9WA 4KHPC 4YHHC 2ONFA 3GKUA 4JI3C 4DV3C 4DCVA 1WH9A 4NXMC 1IBLC
chains in the Genus database with same CATH superfamily
3UEBA 3VNRA 3IPLA 4JI4C 4L4QA 4DCUA 1O92A 5A19A 2D7VA 3E7XA 3TUFA 2OBVA 1XRCA 1M6XC 3B7WA 2DPLA 2OPLA 2E5LC 4G37A 3I07A 4JM1A 2D28C 4X66C 1BA3A 4JI7C 2NCLA 4DV4C 2PG1E 4X62C 4PZPA 3TR3A 3ETCA 1HR0C 3PBKA 3UOWA 4NXNC 2ATWA 2MMAB 3NYRA 3N54B 4KTTA 5K85A 4GXQA 1M6XA 5BUSA 5BSRA 1MXBA 1IBMC 1V25A 1AMUA 1USPA 4DV5C 4MH4A 3JAMD 3CJEA 1YGTA 4PUHA 5T8TA 1YJ7A 4DR4C 1O93A 4OX9C 4GKJC 3J7AD 2OO4A 4JI1C 2V7BA 3IEVA 4RM3A 3LAXA 5BSWA 2EGTA 3A9UA 2JNVA 3S82A 1MDBA 3I08A 1WF3A 5KYTA 3OTOC 3CQ2A 1L2FA 1PG4A 2AYAA 5ADZA 2P2FA 1MDFA 2PN2A 2OPLB 5BSMA 5JRHA 5T8SA 4JI3C 2QW0X 4IR7A 3SO4A 3RG2A 1JOSA 4K0KC 2VSQA 3EQ6A 3C5EA 2M5OA 4JI6C 3T1HC 5KYVA 1HH2P 4EATA 4IZ6A 5AE1A 4DR3C 1XDXA 4PHTA 1XS3A 3LGXA 3RV2A 2UU9C 4GKKC 4DG9A 1LCIA 5CZVA 4LF8C 4TPSB 3UX3A 2YWCA 4D56A 1WCJA 4B3RC 2WP0C 4KTVA 1XMOC 3FCEA 2E7GA 2KDNA 4JV5C 3CW8X 3KXWA 3LNVA 2BJOA 3NI2A 4ODJA 3J80D 1P7LA 1QM4A 3NYQA 4GXRA 3AF6A 1FUGA 4FUTA 1XRAA 5BSVA 3DLPX 4D57A 2P02A 2P2QA 5KEIA 2DHMA 4G36A 1HNZC 1GPMA 2KZ0A 3A4IA 1RY2A 4JI5C 3CQ1A 2HHHC 2CY1A 4ZJZA 5GTDA 2Y27A 4B3TC 4PROC 4LF7C 4I9FA 3A9VA 5A1IA 4BC7A 4DV6C 2ZZMA 1UWDA 3PROC 4B3MC 1NY8A 2VZEA 4LFAC 1P4EA 5K8FA 4LE5A 3UX2A 2JMPA 1VEHA 3GR1A 5FLXD 4DR7C 2QVYX 1N32C 1PG3A 1TH5A 3A25A 1MXAA 4KHPC 4I9GA 2P2MA 5BURA 1V60A 4NXMC 4DR1C 2F4VC 2Z51A 2BH1X 3IEUA 4BC9A 4B3SC 1J5EC 5BSUA 2E8CA 4DCSA 2UUCC 5E7QA 4DV7C 1UKKA 1XHJA 5BSTA 3A26A 2KZFA 5A1GA 1K0RA 2ZTBA 2YWBA 3DHVA 3ETOA 3FM7A 1LQLA 3K6RA 5LMNC 4FUQA 4LF9C 4FTFA 1ZB9A 4DR2C 4X65C 4BCAA 1EGAA 4DV2C 1XMQC 3L95X 4DR5C 2E8FA 3GR0A 2DYJA 3LNOA 4ZLPA 3CQ3A 4WV3A 1ULTA 4LF5C 2ZZNA 2E8EA 4MTNA 5LMUC 1O9TA 2P20A 2UXBC 2UUAC 2D1RA 4DR6C 4WS9A 3O2EA 1FLOA 1VLAA 5AE3A 3VNSA 4XX2A 3CW9A 3TQIA 4LFBC 2YCBA 1IB8A 4GS5A 2MCQA 2YX1A 3H2TA 2UUBC 1XRBA 4LF4C 1PA4A 3DAYA 5IFIA 4X64C 1ML8A 5IWAC 4NOZA 1QWIA 4HPVA 4RLQA 1IBKC 4LF6C 4LFCC 4NDNA 4YHHC 3GKUA 4DV3C 5BUQA 1WH9A 3EERA 1IBLC 3L8CA 4RVOA 2UXCC 2E0GA 2WD9A 4R0MA 3AF5A 1PU1A 4BSZA 4D4IA 4G1IA 5AE2A 4DV1C 3GPCA 4U5YD 1T5HX 2CU6A 1HNXC 4OYCA 3TDEA 1N33C 4OXIA 1MD9A 5H9UA 4DCTA 3LUSA 1KKGA 4R1LA 4DUZC 4JI2C 2Y4NA 1XNQC 2D1SA 2QL8A 4RMNA 4RM2A 4JYAC 2Y4OA 4K0BA 3UZ0A 2XR1A 4ISBA 3NPDA 5LCIA 3J81D 1MKYA 1N34C 1N2FA 2P2BA 2CXCA 2PROA 2M5HA 1FJGC 4L7IA 1XNRC 2QVXX 2VQFC 4JI0C 2D1QA 1O90A 1ZB8A 2HJGA 4YY3C 2MM9A 1MXCA 4DG8A 4RLFA 1HNWC 3T1YC 5DV9A 1USPB 5CZXA 3R44A 4L2ZA 2P2JA 2PT7G 2VQEC 3G7SA 4DUYC 2D1TA 5BR8C 1P4EC 4AQYC 3IMLA 2UXDC 4RVNA 5A2QD 4JI8C 3N2QA 4R1MA 4PUGA 5IT9D 1RG9A 2QVZX 2ZM6C 2ASBA 2D27A 1I94C 4DV0C 4BBYA 1V26A 1N36C 1NYEA 3R9XA 3R9WA 3AY0A 3VNQA 1T5DX 2ONFA 3E7WA 3FCCA 3PESA 4D4GA 4PUIA 4DCVA
chains in the Genus database with same CATH topology
3VNRA 3IPLA 4JI4C 4L4QA 4DCUA 1O92A 5A19A 2D7VA 3E7XA 3TUFA 2OBVA 1XRCA 3B7WA 2DPLA 2OPLA 2E5LC 4G37A 3I07A 4JM1A 2D28C 4X66C 1BA3A 4JI7C 4DV4C 4X62C 4PZPA 3ETCA 1HR0C 3PBKA 3UOWA 4NXNC 2ATWA 3NYRA 3N54B 4KTTA 5K85A 4GXQA 5BUSA 5BSRA 1MXBA 1IBMC 1V25A 1AMUA 1USPA 4DV5C 4MH4A 3JAMD 3CJEA 5T8TA 1YJ7A 4DR4C 1O93A 4OX9C 4GKJC 3J7AD 2OO4A 4JI1C 2V7BA 3IEVA 4RM3A 3LAXA 5BSWA 2EGTA 3A9UA 3S82A 1MDBA 3I08A 1WF3A 5KYTA 3OTOC 1L2FA 1PG4A 2AYAA 5ADZA 2P2FA 1MDFA 2PN2A 2OPLB 5BSMA 5JRHA 5T8SA 4JI3C 2QW0X 4IR7A 3SO4A 3RG2A 1JOSA 4K0KC 2VSQA 3EQ6A 3C5EA 4JI6C 3T1HC 5KYVA 1HH2P 4EATA 4IZ6A 5AE1A 4DR3C 4PHTA 3LGXA 3RV2A 2UU9C 4GKKC 4DG9A 1LCIA 5CZVA 4LF8C 4TPSB 2YWCA 4D56A 4B3RC 2WP0C 4KTVA 1XMOC 3FCEA 2E7GA 4JV5C 3CW8X 3KXWA 3LNVA 2BJOA 3NI2A 4ODJA 3J80D 1P7LA 1QM4A 3NYQA 4GXRA 3AF6A 1FUGA 4FUTA 1XRAA 5BSVA 3DLPX 4D57A 2P02A 2P2QA 5KEIA 4G36A 1HNZC 1GPMA 3A4IA 1RY2A 4JI5C 2HHHC 2CY1A 4ZJZA 5GTDA 2Y27A 4B3TC 4PROC 4LF7C 4I9FA 3A9VA 5A1IA 4BC7A 4DV6C 3PROC 4B3MC 2VZEA 4LFAC 5K8FA 4LE5A 2JMPA 3GR1A 5FLXD 4DR7C 2QVYX 1N32C 1PG3A 1MXAA 4KHPC 4I9GA 2P2MA 5BURA 4NXMC 4DR1C 2F4VC 2BH1X 3IEUA 4BC9A 4B3SC 1J5EC 5BSUA 2E8CA 4DCSA 2UUCC 5E7QA 4DV7C 1UKKA 5BSTA 2KZFA 5A1GA 1K0RA 2YWBA 3DHVA 3ETOA 1LQLA 5LMNC 4FUQA 4LF9C 4FTFA 1ZB9A 4DR2C 4X65C 4BCAA 1EGAA 4DV2C 1XMQC 3L95X 4DR5C 2E8FA 3GR0A 2DYJA 4ZLPA 4WV3A 1ULTA 4LF5C 2E8EA 4MTNA 5LMUC 1O9TA 2P20A 2UXBC 2UUAC 2D1RA 4DR6C 4WS9A 1VLAA 5AE3A 3VNSA 4XX2A 3CW9A 3TQIA 4LFBC 2YCBA 4GS5A 3H2TA 2UUBC 1XRBA 4LF4C 1PA4A 3DAYA 5IFIA 4X64C 1ML8A 5IWAC 4NOZA 1QWIA 4HPVA 4RLQA 1IBKC 4LF6C 4LFCC 4NDNA 4YHHC 3GKUA 4DV3C 5BUQA 1WH9A 3EERA 1IBLC 3L8CA 4RVOA 2UXCC 2E0GA 2WD9A 4R0MA 3AF5A 4BSZA 4D4IA 4G1IA 5AE2A 4DV1C 3GPCA 4U5YD 1T5HX 1HNXC 4OYCA 3TDEA 1N33C 4OXIA 1MD9A 5H9UA 4DCTA 3LUSA 1KKGA 4R1LA 4DUZC 4JI2C 2Y4NA 1XNQC 2D1SA 2QL8A 4RMNA 4RM2A 4JYAC 2Y4OA 4K0BA 3UZ0A 2XR1A 4ISBA 3NPDA 3J81D 1MKYA 1N34C 1N2FA 2P2BA 2CXCA 2PROA 1FJGC 4L7IA 1XNRC 2QVXX 2VQFC 4JI0C 2D1QA 1O90A 1ZB8A 2HJGA 4YY3C 1MXCA 4DG8A 4RLFA 1HNWC 3T1YC 5DV9A 1USPB 5CZXA 3R44A 4L2ZA 2P2JA 2PT7G 2VQEC 3G7SA 4DUYC 2D1TA 5BR8C 4AQYC 3IMLA 2UXDC 4RVNA 5A2QD 4JI8C 3N2QA 4R1MA 5IT9D 1RG9A 2QVZX 2ZM6C 2ASBA 2D27A 1I94C 4DV0C 4BBYA 1V26A 1N36C 1NYEA 3R9XA 3R9WA 3VNQA 1T5DX 2ONFA 3E7WA 3FCCA 3PESA 4D4GA 4DCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V C;  1JOS A;  4K0K C;  2UXC C;  3IEU A;  4B3S C;  1J5E C;  3AF5 A;  2E8C A;  4DCS A;  3EER A;  2UUC C;  4BSZ A;  4JI4 C;  4DV7 C;  1UKK A;  4DCU A;  4JI6 C;  4DV1 C;  3T1H C;  1HH2 P;  2D7V A;  1HNX C;  2KZF A;  4DR3 C;  1N33 C;  1K0R A;  2OPL A;  2E5L C;  4DCT A;  3LUS A;  3I07 A;  1LQL A;  1KKG A;  5LMN C;  2UU9 C;  4GKK C;  4LF9 C;  4DUZ C;  4JI2 C;  4X66 C;  1ZB9 A;  4LF8 C;  4DR2 C;  4JI7 C;  1XNQ C;  4X65 C;  4B3R C;  4DV4 C;  2QL8 A;  1EGA A;  4X62 C;  4DV2 C;  1XMQ C;  4JYA C;  2E8F A;  4DR5 C;  1XMO C;  2XR1 A;  1HR0 C;  2DYJ A;  4NXN C;  2ATW A;  3J81 D;  1MKY A;  2E7G A;  1N34 C;  4JV5 C;  1N2F A;  2BJO A;  2CXC A;  1FJG C;  1XNR C;  4LF5 C;  3J80 D;  1IBM C;  2VQF C;  4JI0 C;  1ZB8 A;  2E8E A;  2HJG A;  4MTN A;  4YY3 C;  5LMU C;  3AF6 A;  1USP A;  2UXB C;  4DV5 C;  4MH4 A;  2UUA C;  3JAM D;  1HNW C;  4DR6 C;  3CJE A;  1HNZ C;  3T1Y C;  1VLA A;  4DR4 C;  1USP B;  4OX9 C;  4GKJ C;  4JI5 C;  2HHH C;  3J7A D;  2CY1 A;  4XX2 A;  4JI1 C;  4B3T C;  2YCB A;  2PT7 G;  2VQE C;  4LFB C;  4LF7 C;  4DUY C;  3IEV A;  5BR8 C;  2EGT A;  4DV6 C;  4AQY C;  4B3M C;  2UUB C;  4LF4 C;  4DR1 C;  2UXD C;  4LFA C;  5A2Q D;  1PA4 A;  1WF3 A;  4JI8 C;  4X64 C;  2JMP A;  1ML8 A;  5IWA C;  3OTO C;  1L2F A;  1QWI A;  4NOZ A;  5IT9 D;  5FLX D;  2ZM6 C;  2ASB A;  1IBK C;  4DR7 C;  2PN2 A;  2OPL B;  1I94 C;  4DV0 C;  4LF6 C;  4LFC C;  1N32 C;  1N36 C;  1NYE A;  3R9X A;  3R9W A;  4KHP C;  4YHH C;  2ONF A;  3GKU A;  4JI3 C;  4DV3 C;  4DCV A;  1WH9 A;  4NXM C;  1IBL C; 
#chains in the Genus database with same CATH topology
 3UEB A;  3VNR A;  3IPL A;  4JI4 C;  4L4Q A;  4DCU A;  1O92 A;  5A19 A;  2D7V A;  3E7X A;  3TUF A;  2OBV A;  1XRC A;  1M6X C;  3B7W A;  2DPL A;  2OPL A;  2E5L C;  4G37 A;  3I07 A;  4JM1 A;  2D28 C;  4X66 C;  1BA3 A;  4JI7 C;  2NCL A;  4DV4 C;  2PG1 E;  4X62 C;  4PZP A;  3TR3 A;  3ETC A;  1HR0 C;  3PBK A;  3UOW A;  4NXN C;  2ATW A;  2MMA B;  3NYR A;  3N54 B;  4KTT A;  5K85 A;  4GXQ A;  1M6X A;  5BUS A;  5BSR A;  1MXB A;  1IBM C;  1V25 A;  1AMU A;  1USP A;  4DV5 C;  4MH4 A;  3JAM D;  3CJE A;  1YGT A;  4PUH A;  5T8T A;  1YJ7 A;  4DR4 C;  1O93 A;  4OX9 C;  4GKJ C;  3J7A D;  2OO4 A;  4JI1 C;  2V7B A;  3IEV A;  4RM3 A;  3LAX A;  5BSW A;  2EGT A;  3A9U A;  2JNV A;  3S82 A;  1MDB A;  3I08 A;  1WF3 A;  5KYT A;  3OTO C;  3CQ2 A;  1L2F A;  1PG4 A;  2AYA A;  5ADZ A;  2P2F A;  1MDF A;  2PN2 A;  2OPL B;  5BSM A;  5JRH A;  5T8S A;  4JI3 C;  2QW0 X;  4IR7 A;  3SO4 A;  3RG2 A;  1JOS A;  4K0K C;  2VSQ A;  3EQ6 A;  3C5E A;  2M5O A;  4JI6 C;  3T1H C;  5KYV A;  1HH2 P;  4EAT A;  4IZ6 A;  5AE1 A;  4DR3 C;  1XDX A;  4PHT A;  1XS3 A;  3LGX A;  3RV2 A;  2UU9 C;  4GKK C;  4DG9 A;  1LCI A;  5CZV A;  4LF8 C;  4TPS B;  3UX3 A;  2YWC A;  4D56 A;  1WCJ A;  4B3R C;  2WP0 C;  4KTV A;  1XMO C;  3FCE A;  2E7G A;  2KDN A;  4JV5 C;  3CW8 X;  3KXW A;  3LNV A;  2BJO A;  3NI2 A;  4ODJ A;  3J80 D;  1P7L A;  1QM4 A;  3NYQ A;  4GXR A;  3AF6 A;  1FUG A;  4FUT A;  1XRA A;  5BSV A;  3DLP X;  4D57 A;  2P02 A;  2P2Q A;  5KEI A;  2DHM A;  4G36 A;  1HNZ C;  1GPM A;  2KZ0 A;  3A4I A;  1RY2 A;  4JI5 C;  3CQ1 A;  2HHH C;  2CY1 A;  4ZJZ A;  5GTD A;  2Y27 A;  4B3T C;  4PRO C;  4LF7 C;  4I9F A;  3A9V A;  5A1I A;  4BC7 A;  4DV6 C;  2ZZM A;  1UWD A;  3PRO C;  4B3M C;  1NY8 A;  2VZE A;  4LFA C;  1P4E A;  5K8F A;  4LE5 A;  3UX2 A;  2JMP A;  1VEH A;  3GR1 A;  5FLX D;  4DR7 C;  2QVY X;  1N32 C;  1PG3 A;  1TH5 A;  3A25 A;  1MXA A;  4KHP C;  4I9G A;  2P2M A;  5BUR A;  1V60 A;  4NXM C;  4DR1 C;  2F4V C;  2Z51 A;  2BH1 X;  3IEU A;  4BC9 A;  4B3S C;  1J5E C;  5BSU A;  2E8C A;  4DCS A;  2UUC C;  5E7Q A;  4DV7 C;  1UKK A;  1XHJ A;  5BST A;  3A26 A;  2KZF A;  5A1G A;  1K0R A;  2ZTB A;  2YWB A;  3DHV A;  3ETO A;  3FM7 A;  1LQL A;  3K6R A;  5LMN C;  4FUQ A;  4LF9 C;  4FTF A;  1ZB9 A;  4DR2 C;  4X65 C;  4BCA A;  1EGA A;  4DV2 C;  1XMQ C;  3L95 X;  4DR5 C;  2E8F A;  3GR0 A;  2DYJ A;  3LNO A;  4ZLP A;  3CQ3 A;  4WV3 A;  1ULT A;  4LF5 C;  2ZZN A;  2E8E A;  4MTN A;  5LMU C;  1O9T A;  2P20 A;  2UXB C;  2UUA C;  2D1R A;  4DR6 C;  4WS9 A;  3O2E A;  1FLO A;  1VLA A;  5AE3 A;  3VNS A;  4XX2 A;  3CW9 A;  3TQI A;  4LFB C;  2YCB A;  1IB8 A;  4GS5 A;  2MCQ A;  2YX1 A;  3H2T A;  2UUB C;  1XRB A;  4LF4 C;  1PA4 A;  3DAY A;  5IFI A;  4X64 C;  1ML8 A;  5IWA C;  4NOZ A;  1QWI A;  4HPV A;  4RLQ A;  1IBK C;  4LF6 C;  4LFC C;  4NDN A;  4YHH C;  3GKU A;  4DV3 C;  5BUQ A;  1WH9 A;  3EER A;  1IBL C;  3L8C A;  4RVO A;  2UXC C;  2E0G A;  2WD9 A;  4R0M A;  3AF5 A;  1PU1 A;  4BSZ A;  4D4I A;  4G1I A;  5AE2 A;  4DV1 C;  3GPC A;  4U5Y D;  1T5H X;  2CU6 A;  1HNX C;  4OYC A;  3TDE A;  1N33 C;  4OXI A;  1MD9 A;  5H9U A;  4DCT A;  3LUS A;  1KKG A;  4R1L A;  4DUZ C;  4JI2 C;  2Y4N A;  1XNQ C;  2D1S A;  2QL8 A;  4RMN A;  4RM2 A;  4JYA C;  2Y4O A;  4K0B A;  3UZ0 A;  2XR1 A;  4ISB A;  3NPD A;  5LCI A;  3J81 D;  1MKY A;  1N34 C;  1N2F A;  2P2B A;  2CXC A;  2PRO A;  2M5H A;  1FJG C;  4L7I A;  1XNR C;  2QVX X;  2VQF C;  4JI0 C;  2D1Q A;  1O90 A;  1ZB8 A;  2HJG A;  4YY3 C;  2MM9 A;  1MXC A;  4DG8 A;  4RLF A;  1HNW C;  3T1Y C;  5DV9 A;  1USP B;  5CZX A;  3R44 A;  4L2Z A;  2P2J A;  2PT7 G;  2VQE C;  3G7S A;  4DUY C;  2D1T A;  5BR8 C;  1P4E C;  4AQY C;  3IML A;  2UXD C;  4RVN A;  5A2Q D;  4JI8 C;  3N2Q A;  4R1M A;  4PUG A;  5IT9 D;  1RG9 A;  2QVZ X;  2ZM6 C;  2ASB A;  2D27 A;  1I94 C;  4DV0 C;  4BBY A;  1V26 A;  1N36 C;  1NYE A;  3R9X A;  3R9W A;  3AY0 A;  3VNQ A;  1T5D X;  2ONF A;  3E7W A;  3FCC A;  3PES A;  4D4G A;  4PUI A;  4DCV A; 
#chains in the Genus database with same CATH homology
 3VNR A;  3IPL A;  4JI4 C;  4L4Q A;  4DCU A;  1O92 A;  5A19 A;  2D7V A;  3E7X A;  3TUF A;  2OBV A;  1XRC A;  3B7W A;  2DPL A;  2OPL A;  2E5L C;  4G37 A;  3I07 A;  4JM1 A;  2D28 C;  4X66 C;  1BA3 A;  4JI7 C;  4DV4 C;  4X62 C;  4PZP A;  3ETC A;  1HR0 C;  3PBK A;  3UOW A;  4NXN C;  2ATW A;  3NYR A;  3N54 B;  4KTT A;  5K85 A;  4GXQ A;  5BUS A;  5BSR A;  1MXB A;  1IBM C;  1V25 A;  1AMU A;  1USP A;  4DV5 C;  4MH4 A;  3JAM D;  3CJE A;  5T8T A;  1YJ7 A;  4DR4 C;  1O93 A;  4OX9 C;  4GKJ C;  3J7A D;  2OO4 A;  4JI1 C;  2V7B A;  3IEV A;  4RM3 A;  3LAX A;  5BSW A;  2EGT A;  3A9U A;  3S82 A;  1MDB A;  3I08 A;  1WF3 A;  5KYT A;  3OTO C;  1L2F A;  1PG4 A;  2AYA A;  5ADZ A;  2P2F A;  1MDF A;  2PN2 A;  2OPL B;  5BSM A;  5JRH A;  5T8S A;  4JI3 C;  2QW0 X;  4IR7 A;  3SO4 A;  3RG2 A;  1JOS A;  4K0K C;  2VSQ A;  3EQ6 A;  3C5E A;  4JI6 C;  3T1H C;  5KYV A;  1HH2 P;  4EAT A;  4IZ6 A;  5AE1 A;  4DR3 C;  4PHT A;  3LGX A;  3RV2 A;  2UU9 C;  4GKK C;  4DG9 A;  1LCI A;  5CZV A;  4LF8 C;  4TPS B;  2YWC A;  4D56 A;  4B3R C;  2WP0 C;  4KTV A;  1XMO C;  3FCE A;  2E7G A;  4JV5 C;  3CW8 X;  3KXW A;  3LNV A;  2BJO A;  3NI2 A;  4ODJ A;  3J80 D;  1P7L A;  1QM4 A;  3NYQ A;  4GXR A;  3AF6 A;  1FUG A;  4FUT A;  1XRA A;  5BSV A;  3DLP X;  4D57 A;  2P02 A;  2P2Q A;  5KEI A;  4G36 A;  1HNZ C;  1GPM A;  3A4I A;  1RY2 A;  4JI5 C;  2HHH C;  2CY1 A;  4ZJZ A;  5GTD A;  2Y27 A;  4B3T C;  4PRO C;  4LF7 C;  4I9F A;  3A9V A;  5A1I A;  4BC7 A;  4DV6 C;  3PRO C;  4B3M C;  2VZE A;  4LFA C;  5K8F A;  4LE5 A;  2JMP A;  3GR1 A;  5FLX D;  4DR7 C;  2QVY X;  1N32 C;  1PG3 A;  1MXA A;  4KHP C;  4I9G A;  2P2M A;  5BUR A;  4NXM C;  4DR1 C;  2F4V C;  2BH1 X;  3IEU A;  4BC9 A;  4B3S C;  1J5E C;  5BSU A;  2E8C A;  4DCS A;  2UUC C;  5E7Q A;  4DV7 C;  1UKK A;  5BST A;  2KZF A;  5A1G A;  1K0R A;  2YWB A;  3DHV A;  3ETO A;  1LQL A;  5LMN C;  4FUQ A;  4LF9 C;  4FTF A;  1ZB9 A;  4DR2 C;  4X65 C;  4BCA A;  1EGA A;  4DV2 C;  1XMQ C;  3L95 X;  4DR5 C;  2E8F A;  3GR0 A;  2DYJ A;  4ZLP A;  4WV3 A;  1ULT A;  4LF5 C;  2E8E A;  4MTN A;  5LMU C;  1O9T A;  2P20 A;  2UXB C;  2UUA C;  2D1R A;  4DR6 C;  4WS9 A;  1VLA A;  5AE3 A;  3VNS A;  4XX2 A;  3CW9 A;  3TQI A;  4LFB C;  2YCB A;  4GS5 A;  3H2T A;  2UUB C;  1XRB A;  4LF4 C;  1PA4 A;  3DAY A;  5IFI A;  4X64 C;  1ML8 A;  5IWA C;  4NOZ A;  1QWI A;  4HPV A;  4RLQ A;  1IBK C;  4LF6 C;  4LFC C;  4NDN A;  4YHH C;  3GKU A;  4DV3 C;  5BUQ A;  1WH9 A;  3EER A;  1IBL C;  3L8C A;  4RVO A;  2UXC C;  2E0G A;  2WD9 A;  4R0M A;  3AF5 A;  4BSZ A;  4D4I A;  4G1I A;  5AE2 A;  4DV1 C;  3GPC A;  4U5Y D;  1T5H X;  1HNX C;  4OYC A;  3TDE A;  1N33 C;  4OXI A;  1MD9 A;  5H9U A;  4DCT A;  3LUS A;  1KKG A;  4R1L A;  4DUZ C;  4JI2 C;  2Y4N A;  1XNQ C;  2D1S A;  2QL8 A;  4RMN A;  4RM2 A;  4JYA C;  2Y4O A;  4K0B A;  3UZ0 A;  2XR1 A;  4ISB A;  3NPD A;  3J81 D;  1MKY A;  1N34 C;  1N2F A;  2P2B A;  2CXC A;  2PRO A;  1FJG C;  4L7I A;  1XNR C;  2QVX X;  2VQF C;  4JI0 C;  2D1Q A;  1O90 A;  1ZB8 A;  2HJG A;  4YY3 C;  1MXC A;  4DG8 A;  4RLF A;  1HNW C;  3T1Y C;  5DV9 A;  1USP B;  5CZX A;  3R44 A;  4L2Z A;  2P2J A;  2PT7 G;  2VQE C;  3G7S A;  4DUY C;  2D1T A;  5BR8 C;  4AQY C;  3IML A;  2UXD C;  4RVN A;  5A2Q D;  4JI8 C;  3N2Q A;  4R1M A;  5IT9 D;  1RG9 A;  2QVZ X;  2ZM6 C;  2ASB A;  2D27 A;  1I94 C;  4DV0 C;  4BBY A;  1V26 A;  1N36 C;  1NYE A;  3R9X A;  3R9W A;  3VNQ A;  1T5D X;  2ONF A;  3E7W A;  3FCC A;  3PES A;  4D4G A;  4DCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...