4JI3C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji3C02
4DCVA 1N36C 1USPB 1JOSA 1VLAA 4LFAC 4DR1C 4JI6C 1ZB8A 4YHHC 4LF6C 2ZM6C 4XX2A 3R9WA 2HHHC 2UU9C 1HR0C 2VQFC 2E8FA 2CXCA 4DR6C 4DV4C 2E8CA 4GKKC 4GKJC 1N34C 1MKYA 5LMUC 4DR3C 2E5LC 3GKUA 1EGAA 4JV5C 4K0KC 1LQLA 3I07A 5IWAC 4X64C 2ONFA 1XMOC 1WF3A 1N2FA 1WH9A 1J5EC 2UXBC 3R9XA 4JI7C 1N33C 1IBKC 2PT7G 2YCBA 4LF7C 3AF5A 4DUZC 2UUBC 1UKKA 4BSZA 1HNZC 4JI3C 2ATWA 4LF5C 2UXCC 2OPLA 4B3TC 1PA4A 3J7AD 2EGTA 2CY1A 1I94C 1HNWC 5BR8C 2KZFA 4DV6C 4DV7C 4JI8C 4X65C 4YY3C 3LUSA 4LF4C 3JAMD 3OTOC 1K0RA 4DR7C 1FJGC 1L2FA 1HH2P 2E7GA 4MTNA 1XNQC 1HNXC 4DCSA 4DCTA 3J80D 4JI0C 4JI2C 4JI5C 4DCUA 4B3RC 2UXDC 3T1HC 5LMNC 4B3MC 4DR5C 4NXNC 2OPLB 4DV5C 2JMPA 4NOZA 1XMQC 2UUAC 3AF6A 1QWIA 1ZB9A 2E8EA 4DV1C 4DV3C 2UUCC 2ASBA 4X62C 4LF8C 3EERA 4LFCC 4DR2C 4B3SC 1N32C 4X66C 4AQYC 1IBMC 5IT9D 2BJOA 4KHPC 5FLXD 4JI1C 3J81D 5A2QD 4OX9C 2PN2A 1USPA 4NXMC 2F4VC 2QL8A 3IEUA 1IBLC 4LF9C 4DUYC 1XNRC 4DV2C 1ML8A 2DYJA 3T1YC 4JYAC 3CJEA 1NYEA 3IEVA 2XR1A 2VQEC 4DV0C 2D7VA 4MH4A 4JI4C 4LFBC 4DR4C 1KKGA 2HJGA
chains in the Genus database with same CATH superfamily
3DAYA 4YHHC 2ZM6C 4WV3A 2Z51A 3GR0A 5ADZA 3EQ6A 1P4EA 4I9FA 1MXBA 4IZ6A 4GKKC 3O2EA 4BC7A 4RM3A 5LMUC 4OXIA 4NDNA 3TR3A 1MDFA 1FUGA 3UX2A 4L2ZA 1N2FA 3LNOA 3CQ1A 2VSQA 1O9TA 3UEBA 3NYQA 1HNZC 2WD9A 2P2MA 2ATWA 2OBVA 2QVXX 2EGTA 3CW9A 1I94C 4GS5A 1XRBA 4DV7C 4JI8C 5CZVA 3CW8X 3GR1A 3K6RA 3JAMD 2P2FA 4JI5C 4DCSA 3J80D 2D1RA 4DCUA 5LCIA 4B3MC 4DR5C 4I9GA 4NXNC 5BSTA 4KTTA 4D56A 2JMPA 2MCQA 5GTDA 2ZTBA 4D57A 4X62C 4LFCC 1O90A 2MMAB 5KYVA 4DR2C 4RVNA 4FUTA 3FCEA 1IBMC 4KHPC 3A25A 2V7BA 3RV2A 4LE5A 2PROA 1RY2A 4PZPA 1IB8A 2ZZNA 3A4IA 1NYEA 4LFBC 2MM9A 3ETOA 4U5YD 1XS3A 1XHJA 5KYTA 1VLAA 4LFAC 1MDBA 3VNSA 1ZB8A 4LF6C 4XX2A 3R9WA 4WS9A 5BURA 4GXQA 1HR0C 2D28C 3L8CA 1VEHA 4JM1A 4KTVA 3G7SA 4RM2A 4BCAA 1ULTA 3NPDA 4RMNA 4R1MA 1LQLA 3TDEA 2WP0C 5IWAC 4OYCA 4ZJZA 1XMOC 1WF3A 3VNRA 2D1SA 3IPLA 4RLQA 4GXRA 2D1TA 3R9XA 3AF5A 3LGXA 2UUBC 3VNQA 4BSZA 2M5HA 3N54B 2P2BA 4JI3C 1PA4A 3LNVA 4IR7A 3J7AD 3B7WA 2CY1A 1QM4A 4DV6C 3TUFA 4LF4C 1YJ7A 3TQIA 1M6XC 2Y4OA 1HH2P 2E7GA 2YX1A 1HNXC 4JI0C 3NYRA 4B3RC 2AYAA 2YWBA 4G36A 5BSMA 3CQ3A 4DV5C 5DV9A 2Y4NA 3AY0A 4NOZA 1MXAA 1V25A 4DV3C 2PG1E 1XDXA 3LAXA 1FLOA 5IT9D 4ISBA 4JI1C 1T5HX 2CU6A 4G37A 1GPMA 2F4VC 3C5EA 2QL8A 1XNRC 4DV2C 3PESA 5H9UA 3T1YC 1MD9A 3CJEA 3IEVA 2D7VA 4RLFA 4DR4C 1P4EC 2JNVA 4DCVA 2QVZX 1N36C 1USPB 1JOSA 3UX3A 4R0MA 5BSVA 5BSUA 2UU9C 3N2QA 3KXWA 2E8FA 2CXCA 4DR6C 2E8CA 4GKJC 1N34C 3UOWA 1MKYA 2P2QA 2E5LC 3CQ2A 1EGAA 2KDNA 4BBYA 4JV5C 4K0KC 3IMLA 1WCJA 3H2TA 2P2JA 2ONFA 4PUIA 1J5EC 5A1IA 2UXBC 1IBKC 2PT7G 4DUZC 1UKKA 1T5DX 1YGTA 4G1IA 4LF5C 5T8TA 5A19A 4RVOA 3A9VA 2DHMA 4L4QA 1M6XA 4PUHA 5BR8C 4D4IA 1HNWC 4X65C 4ODJA 3LUSA 5BSWA 1K0RA 4DR7C 1FJGC 4FUQA 1L2FA 4DCTA 3ETCA 2DPLA 2UXDC 3T1HC 2OPLB 1XMQC 3AF6A 1QWIA 1BA3A 4DV1C 5CZXA 5AE1A 3SO4A 4LF8C 3FCCA 1PG3A 3S82A 4AQYC 5FLXD 5BSRA 3J81D 4L7IA 1USPA 2BH1X 4TPSB 5A1GA 4D4GA 4NXMC 5AE3A 4LF9C 4DUYC 1ML8A 4PROC 1AMUA 4JYAC 2ZZMA 1LCIA 2XR1A 4DV0C 4MH4A 2HJGA 1TH5A 3DLPX 5K8FA 5KEIA 4DR1C 4JI6C 3RG2A 2OO4A 2YWCA 2QW0X 2HHHC 2VQFC 4DV4C 4DG8A 5K85A 5T8SA 1O92A 4DR3C 5BUSA 3GKUA 1MXCA 3NI2A 4K0BA 2QVYX 3I07A 4X64C 5JRHA 1O93A 5E7QA 1WH9A 4JI7C 3A9UA 5BUQA 1N33C 4ZLPA 2YCBA 4LF7C 2M5OA 2P20A 3PROC 1XRCA 2UXCC 2P02A 2OPLA 3L95X 4B3TC 1UWDA 3DHVA 2D1QA 2KZFA 1V60A 4YY3C 4R1LA 5IFIA 3OTOC 1PG4A 2NCLA 4MTNA 1XNQC 4JI2C 4EATA 5LMNC 1RG9A 1NY8A 1XRAA 2UUAC 4PUGA 1ZB9A 2E8EA 2VZEA 2UUCC 2ASBA 3EERA 1P7LA 3FM7A 4B3SC 3PBKA 1N32C 3E7XA 4X66C 4HPVA 4DG9A 2E0GA 3R44A 2BJOA 5A2QD 4OX9C 1PU1A 2KZ0A 2PN2A 5AE2A 3IEUA 1IBLC 4BC9A 3E7WA 2DYJA 4PHTA 4FTFA 2Y27A 3A26A 2VQEC 1V26A 4JI4C 3GPCA 2D27A 3UZ0A 3I08A 1KKGA
chains in the Genus database with same CATH topology
3DAYA 4YHHC 2ZM6C 4WV3A 3GR0A 5ADZA 3EQ6A 4I9FA 1MXBA 4IZ6A 4GKKC 4BC7A 4RM3A 5LMUC 4OXIA 4NDNA 1MDFA 1FUGA 4L2ZA 1N2FA 2VSQA 1O9TA 3NYQA 1HNZC 2WD9A 2P2MA 2ATWA 2OBVA 2QVXX 2EGTA 3CW9A 1I94C 4GS5A 1XRBA 4DV7C 4JI8C 5CZVA 3CW8X 3GR1A 3JAMD 2P2FA 4JI5C 4DCSA 3J80D 2D1RA 4DCUA 4B3MC 4DR5C 4I9GA 4NXNC 5BSTA 4KTTA 4D56A 2JMPA 5GTDA 4D57A 4X62C 4LFCC 1O90A 5KYVA 4DR2C 4RVNA 4FUTA 3FCEA 1IBMC 4KHPC 2V7BA 3RV2A 4LE5A 2PROA 1RY2A 4PZPA 3A4IA 1NYEA 4LFBC 3ETOA 4U5YD 5KYTA 1VLAA 4LFAC 1MDBA 3VNSA 1ZB8A 4LF6C 4XX2A 3R9WA 4WS9A 5BURA 4GXQA 1HR0C 2D28C 3L8CA 4JM1A 4KTVA 3G7SA 4RM2A 4BCAA 1ULTA 3NPDA 4RMNA 4R1MA 1LQLA 3TDEA 2WP0C 5IWAC 4OYCA 4ZJZA 1XMOC 1WF3A 3VNRA 2D1SA 3IPLA 4RLQA 4GXRA 2D1TA 3R9XA 3AF5A 3LGXA 2UUBC 3VNQA 4BSZA 3N54B 2P2BA 4JI3C 1PA4A 3LNVA 4IR7A 3J7AD 3B7WA 2CY1A 1QM4A 4DV6C 3TUFA 4LF4C 1YJ7A 3TQIA 2Y4OA 1HH2P 2E7GA 1HNXC 4JI0C 3NYRA 4B3RC 2AYAA 2YWBA 4G36A 5BSMA 4DV5C 5DV9A 2Y4NA 4NOZA 1MXAA 1V25A 4DV3C 3LAXA 5IT9D 4ISBA 4JI1C 1T5HX 4G37A 1GPMA 2F4VC 3C5EA 2QL8A 1XNRC 4DV2C 3PESA 5H9UA 3T1YC 1MD9A 3CJEA 3IEVA 2D7VA 4RLFA 4DR4C 4DCVA 2QVZX 1N36C 1USPB 1JOSA 4R0MA 5BSVA 5BSUA 2UU9C 3N2QA 3KXWA 2E8FA 2CXCA 4DR6C 2E8CA 4GKJC 1N34C 3UOWA 1MKYA 2P2QA 2E5LC 1EGAA 4BBYA 4JV5C 4K0KC 3IMLA 3H2TA 2P2JA 2ONFA 1J5EC 5A1IA 2UXBC 1IBKC 2PT7G 4DUZC 1UKKA 1T5DX 4G1IA 4LF5C 5T8TA 5A19A 4RVOA 3A9VA 4L4QA 1HNWC 5BR8C 4D4IA 4X65C 4ODJA 3LUSA 5BSWA 1K0RA 4DR7C 1FJGC 4FUQA 1L2FA 4DCTA 3ETCA 2DPLA 2UXDC 3T1HC 2OPLB 1XMQC 3AF6A 1QWIA 1BA3A 4DV1C 5CZXA 5AE1A 3SO4A 4LF8C 3FCCA 1PG3A 3S82A 4AQYC 5FLXD 5BSRA 3J81D 4L7IA 1USPA 2BH1X 4TPSB 5A1GA 4D4GA 4NXMC 5AE3A 4LF9C 4DUYC 1ML8A 4PROC 1AMUA 4JYAC 1LCIA 2XR1A 4DV0C 4MH4A 2HJGA 3DLPX 5K8FA 5KEIA 4DR1C 4JI6C 3RG2A 2OO4A 2YWCA 2QW0X 2HHHC 2VQFC 4DV4C 4DG8A 5K85A 5T8SA 1O92A 4DR3C 5BUSA 3GKUA 1MXCA 3NI2A 4K0BA 2QVYX 3I07A 4X64C 5JRHA 1O93A 5E7QA 1WH9A 4JI7C 3A9UA 5BUQA 1N33C 4ZLPA 2YCBA 4LF7C 2P20A 3PROC 1XRCA 2UXCC 2P02A 2OPLA 3L95X 4B3TC 3DHVA 2D1QA 2KZFA 4YY3C 4R1LA 5IFIA 3OTOC 1PG4A 4MTNA 1XNQC 4JI2C 4EATA 5LMNC 1RG9A 1XRAA 2UUAC 1ZB9A 2E8EA 2VZEA 2UUCC 2ASBA 3EERA 1P7LA 4B3SC 3PBKA 1N32C 3E7XA 4X66C 4HPVA 4DG9A 2E0GA 3R44A 2BJOA 5A2QD 4OX9C 2PN2A 5AE2A 3IEUA 1IBLC 4BC9A 3E7WA 2DYJA 4PHTA 4FTFA 2Y27A 2VQEC 1V26A 4JI4C 3GPCA 2D27A 3UZ0A 3I08A 1KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCV A;  1N36 C;  1USP B;  1JOS A;  1VLA A;  4LFA C;  4DR1 C;  4JI6 C;  1ZB8 A;  4YHH C;  4LF6 C;  2ZM6 C;  4XX2 A;  3R9W A;  2HHH C;  2UU9 C;  1HR0 C;  2VQF C;  2E8F A;  2CXC A;  4DR6 C;  4DV4 C;  2E8C A;  4GKK C;  4GKJ C;  1N34 C;  1MKY A;  5LMU C;  4DR3 C;  2E5L C;  3GKU A;  1EGA A;  4JV5 C;  4K0K C;  1LQL A;  3I07 A;  5IWA C;  4X64 C;  2ONF A;  1XMO C;  1WF3 A;  1N2F A;  1WH9 A;  1J5E C;  2UXB C;  3R9X A;  4JI7 C;  1N33 C;  1IBK C;  2PT7 G;  2YCB A;  4LF7 C;  3AF5 A;  4DUZ C;  2UUB C;  1UKK A;  4BSZ A;  1HNZ C;  4JI3 C;  2ATW A;  4LF5 C;  2UXC C;  2OPL A;  4B3T C;  1PA4 A;  3J7A D;  2EGT A;  2CY1 A;  1I94 C;  1HNW C;  5BR8 C;  2KZF A;  4DV6 C;  4DV7 C;  4JI8 C;  4X65 C;  4YY3 C;  3LUS A;  4LF4 C;  3JAM D;  3OTO C;  1K0R A;  4DR7 C;  1FJG C;  1L2F A;  1HH2 P;  2E7G A;  4MTN A;  1XNQ C;  1HNX C;  4DCS A;  4DCT A;  3J80 D;  4JI0 C;  4JI2 C;  4JI5 C;  4DCU A;  4B3R C;  2UXD C;  3T1H C;  5LMN C;  4B3M C;  4DR5 C;  4NXN C;  2OPL B;  4DV5 C;  2JMP A;  4NOZ A;  1XMQ C;  2UUA C;  3AF6 A;  1QWI A;  1ZB9 A;  2E8E A;  4DV1 C;  4DV3 C;  2UUC C;  2ASB A;  4X62 C;  4LF8 C;  3EER A;  4LFC C;  4DR2 C;  4B3S C;  1N32 C;  4X66 C;  4AQY C;  1IBM C;  5IT9 D;  2BJO A;  4KHP C;  5FLX D;  4JI1 C;  3J81 D;  5A2Q D;  4OX9 C;  2PN2 A;  1USP A;  4NXM C;  2F4V C;  2QL8 A;  3IEU A;  1IBL C;  4LF9 C;  4DUY C;  1XNR C;  4DV2 C;  1ML8 A;  2DYJ A;  3T1Y C;  4JYA C;  3CJE A;  1NYE A;  3IEV A;  2XR1 A;  2VQE C;  4DV0 C;  2D7V A;  4MH4 A;  4JI4 C;  4LFB C;  4DR4 C;  1KKG A;  2HJG A; 
#chains in the Genus database with same CATH topology
 3DAY A;  4YHH C;  2ZM6 C;  4WV3 A;  2Z51 A;  3GR0 A;  5ADZ A;  3EQ6 A;  1P4E A;  4I9F A;  1MXB A;  4IZ6 A;  4GKK C;  3O2E A;  4BC7 A;  4RM3 A;  5LMU C;  4OXI A;  4NDN A;  3TR3 A;  1MDF A;  1FUG A;  3UX2 A;  4L2Z A;  1N2F A;  3LNO A;  3CQ1 A;  2VSQ A;  1O9T A;  3UEB A;  3NYQ A;  1HNZ C;  2WD9 A;  2P2M A;  2ATW A;  2OBV A;  2QVX X;  2EGT A;  3CW9 A;  1I94 C;  4GS5 A;  1XRB A;  4DV7 C;  4JI8 C;  5CZV A;  3CW8 X;  3GR1 A;  3K6R A;  3JAM D;  2P2F A;  4JI5 C;  4DCS A;  3J80 D;  2D1R A;  4DCU A;  5LCI A;  4B3M C;  4DR5 C;  4I9G A;  4NXN C;  5BST A;  4KTT A;  4D56 A;  2JMP A;  2MCQ A;  5GTD A;  2ZTB A;  4D57 A;  4X62 C;  4LFC C;  1O90 A;  2MMA B;  5KYV A;  4DR2 C;  4RVN A;  4FUT A;  3FCE A;  1IBM C;  4KHP C;  3A25 A;  2V7B A;  3RV2 A;  4LE5 A;  2PRO A;  1RY2 A;  4PZP A;  1IB8 A;  2ZZN A;  3A4I A;  1NYE A;  4LFB C;  2MM9 A;  3ETO A;  4U5Y D;  1XS3 A;  1XHJ A;  5KYT A;  1VLA A;  4LFA C;  1MDB A;  3VNS A;  1ZB8 A;  4LF6 C;  4XX2 A;  3R9W A;  4WS9 A;  5BUR A;  4GXQ A;  1HR0 C;  2D28 C;  3L8C A;  1VEH A;  4JM1 A;  4KTV A;  3G7S A;  4RM2 A;  4BCA A;  1ULT A;  3NPD A;  4RMN A;  4R1M A;  1LQL A;  3TDE A;  2WP0 C;  5IWA C;  4OYC A;  4ZJZ A;  1XMO C;  1WF3 A;  3VNR A;  2D1S A;  3IPL A;  4RLQ A;  4GXR A;  2D1T A;  3R9X A;  3AF5 A;  3LGX A;  2UUB C;  3VNQ A;  4BSZ A;  2M5H A;  3N54 B;  2P2B A;  4JI3 C;  1PA4 A;  3LNV A;  4IR7 A;  3J7A D;  3B7W A;  2CY1 A;  1QM4 A;  4DV6 C;  3TUF A;  4LF4 C;  1YJ7 A;  3TQI A;  1M6X C;  2Y4O A;  1HH2 P;  2E7G A;  2YX1 A;  1HNX C;  4JI0 C;  3NYR A;  4B3R C;  2AYA A;  2YWB A;  4G36 A;  5BSM A;  3CQ3 A;  4DV5 C;  5DV9 A;  2Y4N A;  3AY0 A;  4NOZ A;  1MXA A;  1V25 A;  4DV3 C;  2PG1 E;  1XDX A;  3LAX A;  1FLO A;  5IT9 D;  4ISB A;  4JI1 C;  1T5H X;  2CU6 A;  4G37 A;  1GPM A;  2F4V C;  3C5E A;  2QL8 A;  1XNR C;  4DV2 C;  3PES A;  5H9U A;  3T1Y C;  1MD9 A;  3CJE A;  3IEV A;  2D7V A;  4RLF A;  4DR4 C;  1P4E C;  2JNV A;  4DCV A;  2QVZ X;  1N36 C;  1USP B;  1JOS A;  3UX3 A;  4R0M A;  5BSV A;  5BSU A;  2UU9 C;  3N2Q A;  3KXW A;  2E8F A;  2CXC A;  4DR6 C;  2E8C A;  4GKJ C;  1N34 C;  3UOW A;  1MKY A;  2P2Q A;  2E5L C;  3CQ2 A;  1EGA A;  2KDN A;  4BBY A;  4JV5 C;  4K0K C;  3IML A;  1WCJ A;  3H2T A;  2P2J A;  2ONF A;  4PUI A;  1J5E C;  5A1I A;  2UXB C;  1IBK C;  2PT7 G;  4DUZ C;  1UKK A;  1T5D X;  1YGT A;  4G1I A;  4LF5 C;  5T8T A;  5A19 A;  4RVO A;  3A9V A;  2DHM A;  4L4Q A;  1M6X A;  4PUH A;  5BR8 C;  4D4I A;  1HNW C;  4X65 C;  4ODJ A;  3LUS A;  5BSW A;  1K0R A;  4DR7 C;  1FJG C;  4FUQ A;  1L2F A;  4DCT A;  3ETC A;  2DPL A;  2UXD C;  3T1H C;  2OPL B;  1XMQ C;  3AF6 A;  1QWI A;  1BA3 A;  4DV1 C;  5CZX A;  5AE1 A;  3SO4 A;  4LF8 C;  3FCC A;  1PG3 A;  3S82 A;  4AQY C;  5FLX D;  5BSR A;  3J81 D;  4L7I A;  1USP A;  2BH1 X;  4TPS B;  5A1G A;  4D4G A;  4NXM C;  5AE3 A;  4LF9 C;  4DUY C;  1ML8 A;  4PRO C;  1AMU A;  4JYA C;  2ZZM A;  1LCI A;  2XR1 A;  4DV0 C;  4MH4 A;  2HJG A;  1TH5 A;  3DLP X;  5K8F A;  5KEI A;  4DR1 C;  4JI6 C;  3RG2 A;  2OO4 A;  2YWC A;  2QW0 X;  2HHH C;  2VQF C;  4DV4 C;  4DG8 A;  5K85 A;  5T8S A;  1O92 A;  4DR3 C;  5BUS A;  3GKU A;  1MXC A;  3NI2 A;  4K0B A;  2QVY X;  3I07 A;  4X64 C;  5JRH A;  1O93 A;  5E7Q A;  1WH9 A;  4JI7 C;  3A9U A;  5BUQ A;  1N33 C;  4ZLP A;  2YCB A;  4LF7 C;  2M5O A;  2P20 A;  3PRO C;  1XRC A;  2UXC C;  2P02 A;  2OPL A;  3L95 X;  4B3T C;  1UWD A;  3DHV A;  2D1Q A;  2KZF A;  1V60 A;  4YY3 C;  4R1L A;  5IFI A;  3OTO C;  1PG4 A;  2NCL A;  4MTN A;  1XNQ C;  4JI2 C;  4EAT A;  5LMN C;  1RG9 A;  1NY8 A;  1XRA A;  2UUA C;  4PUG A;  1ZB9 A;  2E8E A;  2VZE A;  2UUC C;  2ASB A;  3EER A;  1P7L A;  3FM7 A;  4B3S C;  3PBK A;  1N32 C;  3E7X A;  4X66 C;  4HPV A;  4DG9 A;  2E0G A;  3R44 A;  2BJO A;  5A2Q D;  4OX9 C;  1PU1 A;  2KZ0 A;  2PN2 A;  5AE2 A;  3IEU A;  1IBL C;  4BC9 A;  3E7W A;  2DYJ A;  4PHT A;  4FTF A;  2Y27 A;  3A26 A;  2VQE C;  1V26 A;  4JI4 C;  3GPC A;  2D27 A;  3UZ0 A;  3I08 A;  1KKG A; 
#chains in the Genus database with same CATH homology
 3DAY A;  4YHH C;  2ZM6 C;  4WV3 A;  3GR0 A;  5ADZ A;  3EQ6 A;  4I9F A;  1MXB A;  4IZ6 A;  4GKK C;  4BC7 A;  4RM3 A;  5LMU C;  4OXI A;  4NDN A;  1MDF A;  1FUG A;  4L2Z A;  1N2F A;  2VSQ A;  1O9T A;  3NYQ A;  1HNZ C;  2WD9 A;  2P2M A;  2ATW A;  2OBV A;  2QVX X;  2EGT A;  3CW9 A;  1I94 C;  4GS5 A;  1XRB A;  4DV7 C;  4JI8 C;  5CZV A;  3CW8 X;  3GR1 A;  3JAM D;  2P2F A;  4JI5 C;  4DCS A;  3J80 D;  2D1R A;  4DCU A;  4B3M C;  4DR5 C;  4I9G A;  4NXN C;  5BST A;  4KTT A;  4D56 A;  2JMP A;  5GTD A;  4D57 A;  4X62 C;  4LFC C;  1O90 A;  5KYV A;  4DR2 C;  4RVN A;  4FUT A;  3FCE A;  1IBM C;  4KHP C;  2V7B A;  3RV2 A;  4LE5 A;  2PRO A;  1RY2 A;  4PZP A;  3A4I A;  1NYE A;  4LFB C;  3ETO A;  4U5Y D;  5KYT A;  1VLA A;  4LFA C;  1MDB A;  3VNS A;  1ZB8 A;  4LF6 C;  4XX2 A;  3R9W A;  4WS9 A;  5BUR A;  4GXQ A;  1HR0 C;  2D28 C;  3L8C A;  4JM1 A;  4KTV A;  3G7S A;  4RM2 A;  4BCA A;  1ULT A;  3NPD A;  4RMN A;  4R1M A;  1LQL A;  3TDE A;  2WP0 C;  5IWA C;  4OYC A;  4ZJZ A;  1XMO C;  1WF3 A;  3VNR A;  2D1S A;  3IPL A;  4RLQ A;  4GXR A;  2D1T A;  3R9X A;  3AF5 A;  3LGX A;  2UUB C;  3VNQ A;  4BSZ A;  3N54 B;  2P2B A;  4JI3 C;  1PA4 A;  3LNV A;  4IR7 A;  3J7A D;  3B7W A;  2CY1 A;  1QM4 A;  4DV6 C;  3TUF A;  4LF4 C;  1YJ7 A;  3TQI A;  2Y4O A;  1HH2 P;  2E7G A;  1HNX C;  4JI0 C;  3NYR A;  4B3R C;  2AYA A;  2YWB A;  4G36 A;  5BSM A;  4DV5 C;  5DV9 A;  2Y4N A;  4NOZ A;  1MXA A;  1V25 A;  4DV3 C;  3LAX A;  5IT9 D;  4ISB A;  4JI1 C;  1T5H X;  4G37 A;  1GPM A;  2F4V C;  3C5E A;  2QL8 A;  1XNR C;  4DV2 C;  3PES A;  5H9U A;  3T1Y C;  1MD9 A;  3CJE A;  3IEV A;  2D7V A;  4RLF A;  4DR4 C;  4DCV A;  2QVZ X;  1N36 C;  1USP B;  1JOS A;  4R0M A;  5BSV A;  5BSU A;  2UU9 C;  3N2Q A;  3KXW A;  2E8F A;  2CXC A;  4DR6 C;  2E8C A;  4GKJ C;  1N34 C;  3UOW A;  1MKY A;  2P2Q A;  2E5L C;  1EGA A;  4BBY A;  4JV5 C;  4K0K C;  3IML A;  3H2T A;  2P2J A;  2ONF A;  1J5E C;  5A1I A;  2UXB C;  1IBK C;  2PT7 G;  4DUZ C;  1UKK A;  1T5D X;  4G1I A;  4LF5 C;  5T8T A;  5A19 A;  4RVO A;  3A9V A;  4L4Q A;  1HNW C;  5BR8 C;  4D4I A;  4X65 C;  4ODJ A;  3LUS A;  5BSW A;  1K0R A;  4DR7 C;  1FJG C;  4FUQ A;  1L2F A;  4DCT A;  3ETC A;  2DPL A;  2UXD C;  3T1H C;  2OPL B;  1XMQ C;  3AF6 A;  1QWI A;  1BA3 A;  4DV1 C;  5CZX A;  5AE1 A;  3SO4 A;  4LF8 C;  3FCC A;  1PG3 A;  3S82 A;  4AQY C;  5FLX D;  5BSR A;  3J81 D;  4L7I A;  1USP A;  2BH1 X;  4TPS B;  5A1G A;  4D4G A;  4NXM C;  5AE3 A;  4LF9 C;  4DUY C;  1ML8 A;  4PRO C;  1AMU A;  4JYA C;  1LCI A;  2XR1 A;  4DV0 C;  4MH4 A;  2HJG A;  3DLP X;  5K8F A;  5KEI A;  4DR1 C;  4JI6 C;  3RG2 A;  2OO4 A;  2YWC A;  2QW0 X;  2HHH C;  2VQF C;  4DV4 C;  4DG8 A;  5K85 A;  5T8S A;  1O92 A;  4DR3 C;  5BUS A;  3GKU A;  1MXC A;  3NI2 A;  4K0B A;  2QVY X;  3I07 A;  4X64 C;  5JRH A;  1O93 A;  5E7Q A;  1WH9 A;  4JI7 C;  3A9U A;  5BUQ A;  1N33 C;  4ZLP A;  2YCB A;  4LF7 C;  2P20 A;  3PRO C;  1XRC A;  2UXC C;  2P02 A;  2OPL A;  3L95 X;  4B3T C;  3DHV A;  2D1Q A;  2KZF A;  4YY3 C;  4R1L A;  5IFI A;  3OTO C;  1PG4 A;  4MTN A;  1XNQ C;  4JI2 C;  4EAT A;  5LMN C;  1RG9 A;  1XRA A;  2UUA C;  1ZB9 A;  2E8E A;  2VZE A;  2UUC C;  2ASB A;  3EER A;  1P7L A;  4B3S C;  3PBK A;  1N32 C;  3E7X A;  4X66 C;  4HPV A;  4DG9 A;  2E0G A;  3R44 A;  2BJO A;  5A2Q D;  4OX9 C;  2PN2 A;  5AE2 A;  3IEU A;  1IBL C;  4BC9 A;  3E7W A;  2DYJ A;  4PHT A;  4FTF A;  2Y27 A;  2VQE C;  1V26 A;  4JI4 C;  3GPC A;  2D27 A;  3UZ0 A;  3I08 A;  1KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...