4JI3C

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 48
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ji3C01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 4ji3C02
4LFBC 4LF8C 4DR3C 4OX9C 2CY1A 2XR1A 3CJEA 5FLXD 1QWIA 2E7GA 1LQLA 4X66C 2UXDC 1USPA 4DR6C 1FJGC 3T1HC 2E8CA 5IT9D 5LMNC 1KKGA 1ZB8A 2JMPA 2ONFA 4MH4A 4NXNC 4DCUA 4LF7C 4B3TC 2UUBC 4JI7C 1PA4A 3AF5A 1ML8A 1N34C 2HHHC 3AF6A 4LF9C 1UKKA 1I94C 2E8FA 3J80D 1ZB9A 3I07A 4JI5C 1HH2P 4JI4C 1IBKC 1NYEA 2YCBA 4NOZA 1WF3A 4YHHC 2UU9C 4MTNA 1EGAA 2VQEC 1HNZC 4X62C 5IWAC 1WH9A 2F4VC 4DCSA 1XMQC 4DV3C 1MKYA 1HNXC 1N32C 4LF6C 1N33C 2ASBA 2E8EA 2UXBC 4DV1C 4DR5C 4GKKC 4JYAC 5LMUC 4JI1C 4LF4C 4DV0C 3IEUA 2UXCC 3J7AD 4DV4C 4B3SC 1J5EC 4BSZA 4LFAC 2OPLA 2BJOA 4JI0C 2ZM6C 2KZFA 3GKUA 1USPB 1IBMC 4GKJC 3OTOC 4DR4C 4XX2A 1N2FA 2UUAC 2D7VA 2QL8A 4JI3C 4DR2C 2E5LC 3IEVA 4DUYC 4K0KC 3R9WA 1HR0C 2VQFC 1N36C 2HJGA 1JOSA 1VLAA 3T1YC 3R9XA 1XNQC 4DV7C 2PT7G 4JV5C 4NXMC 4X64C 4X65C 5A2QD 3LUSA 2UUCC 3J81D 4LF5C 2ATWA 2OPLB 4DV5C 2CXCA 4DCVA 4KHPC 2PN2A 1XMOC 1XNRC 4LFCC 4JI2C 4JI6C 1IBLC 4YY3C 3JAMD 1HNWC 4JI8C 1L2FA 2DYJA 1K0RA 3EERA 5BR8C 4DCTA 2EGTA 4DR7C 4DR1C 4DUZC 4B3MC 4AQYC 4DV6C 4B3RC 4DV2C
chains in the Genus database with same CATH superfamily
4GS5A 4NDNA 1QWIA 4D56A 1LQLA 1FJGC 1TH5A 3T1HC 3R44A 2JMPA 2ONFA 5BUSA 4NXNC 4B3TC 2QVXX 4JI7C 4KTVA 4RM3A 3AF5A 4D57A 2V7BA 1I94C 2E8FA 1XRAA 2P2FA 1HH2P 1P4EA 4JI4C 2ZTBA 1T5HX 4AQYC 2MCQA 1PG4A 3A26A 4MTNA 1EGAA 4JM1A 4OXIA 1HNZC 4D4IA 2MMAB 4PUHA 2D1RA 1N32C 4LF6C 5BSVA 1VEHA 5CZXA 4DG8A 4DV1C 4DR5C 4GKKC 1FUGA 5LMUC 1FLOA 1XHJA 4BBYA 4JI0C 3GKUA 1USPB 1IBMC 1MXAA 2BH1X 5BSMA 3RG2A 1XRBA 1PG3A 3RV2A 1P4EC 2WD9A 4DR2C 3TDEA 4K0KC 2P02A 3R9XA 1JOSA 2YWBA 1AMUA 2Y27A 4X64C 2VSQA 2UUCC 3J81D 3AY0A 4PZPA 2OPLB 5GTDA 1UWDA 4DCVA 1XMOC 5BSWA 3ETOA 1V26A 4JI6C 1IBLC 5T8TA 2DYJA 2P2MA 3EERA 3CW8X 4DCTA 3N54B 4DR7C 5CZVA 4DR1C 1V60A 3I08A 4DV2C 3E7WA 4DR3C 2P20A 2XR1A 4PUIA 3CQ2A 3NYQA 3H2TA 5KEIA 3KXWA 1KKGA 2QVYX 4TPSB 4MH4A 4DCUA 3LGXA 4LF7C 1P7LA 1M6XC 5ADZA 1ULTA 3N2QA 3PBKA 3L95X 1O90A 3NYRA 2HHHC 3TR3A 3J80D 1ZB9A 4JI5C 2YCBA 1BA3A 1LCIA 1RG9A 2UU9C 4D4GA 4X62C 3CQ1A 2F4VC 1XMQC 1YGTA 3VNQA 1MKYA 5BUQA 1XRCA 2ASBA 3EQ6A 4ODJA 5KYTA 4LF4C 4JI1C 5IFIA 4RVOA 4I9FA 2UXCC 1MDBA 1YJ7A 3IMLA 1XDXA 1J5EC 4BSZA 3A25A 1O9TA 1WCJA 2DHMA 2BJOA 2KZFA 4BC9A 3G7SA 4GXQA 3PROC 4DR4C 2P2QA 2Y4NA 2E5LC 4DUYC 1QM4A 3R9WA 1M6XA 2DPLA 2HJGA 3T1YC 3VNSA 2Z51A 1XNQC 3NPDA 4DV7C 4JV5C 4NXMC 5A2QD 2MM9A 5A1IA 3LUSA 3CW9A 4I9GA 2P2BA 4DV5C 3DAYA 2CXCA 1MD9A 1O92A 4RMNA 4R0MA 5LCIA 3ETCA 5BR8C 2E0GA 4DUZC 1MXCA 3O2EA 4OYCA 4DG9A 5K85A 4B3MC 4B3RC 3LNOA 2OO4A 4OX9C 2CY1A 3CJEA 5DV9A 5FLXD 4X66C 2KDNA 2E8CA 5IT9D 4G37A 4ZJZA 2UUBC 2KZ0A 1N34C 4L7IA 4WS9A 1UKKA 3K6RA 2JNVA 4FTFA 5AE2A 3LNVA 2D1QA 3S82A 2OBVA 2VQEC 1XS3A 5IWAC 4DCSA 4DV3C 4PROC 4R1MA 5A1GA 3B7WA 3GPCA 5AE1A 3VNRA 1N33C 2D1SA 3FCEA 2E8EA 5T8SA 5JRHA 2UXBC 5A19A 4K0BA 3DLPX 2P2JA 4DV0C 5BSUA 3E7XA 4EATA 4DV4C 4B3SC 1RY2A 2YWCA 3IPLA 4FUQA 4GKJC 5AE3A 4XX2A 4RM2A 3C5EA 3UX2A 1N2FA 2UUAC 2QL8A 2AYAA 4G1IA 4G36A 1N36C 1IB8A 1VLAA 3CQ3A 2PT7G 1T5DX 3PESA 2QW0X 2PG1E 2ATWA 2PROA 4KHPC 1XNRC 4PHTA 4RLQA 1HNWC 4JI8C 1L2FA 4ISBA 3DHVA 4IZ6A 1K0RA 3TUFA 4GXRA 2EGTA 2D1TA 5BSRA 4DV6C 3NI2A 4PUGA 3UZ0A 4LFBC 4LF8C 3A4IA 2D27A 4KTTA 2E7GA 2UXDC 1USPA 4DR6C 5K8FA 4WV3A 4L2ZA 5LMNC 1ZB8A 4R1LA 4U5YD 3L8CA 2CU6A 4RLFA 2Y4OA 3FCCA 1PA4A 3A9UA 2QVZX 1ML8A 3AF6A 4BC7A 4BCAA 4LF9C 2YX1A 2WP0C 4HPVA 1GPMA 3UEBA 3I07A 1PU1A 1IBKC 1NYEA 4NOZA 1WF3A 4YHHC 4IR7A 1WH9A 1MXBA 3TQIA 1HNXC 3GR0A 5H9UA 4JYAC 2M5OA 3LAXA 3IEUA 3J7AD 3UOWA 4LE5A 5BURA 4LFAC 5KYVA 2OPLA 2ZZMA 2ZM6C 2M5HA 2D28C 4ZLPA 4FUTA 4L4QA 3OTOC 2VZEA 2NCLA 2D7VA 4JI3C 3IEVA 2ZZNA 1HR0C 2VQFC 3GR1A 4RVNA 4X65C 5BSTA 1V25A 4LF5C 2PN2A 5E7QA 1MDFA 4LFCC 1NY8A 3FM7A 4JI2C 4YY3C 3JAMD 3A9VA 3UX3A 1O93A 3SO4A
chains in the Genus database with same CATH topology
4GS5A 4NDNA 1QWIA 4D56A 1LQLA 1FJGC 3T1HC 3R44A 2JMPA 2ONFA 5BUSA 4NXNC 4B3TC 2QVXX 4JI7C 4KTVA 4RM3A 3AF5A 4D57A 2V7BA 1I94C 2E8FA 1XRAA 2P2FA 1HH2P 4JI4C 1T5HX 4AQYC 1PG4A 4MTNA 1EGAA 4JM1A 4OXIA 1HNZC 4D4IA 2D1RA 1N32C 4LF6C 5BSVA 5CZXA 4DG8A 4DV1C 4DR5C 4GKKC 1FUGA 5LMUC 4BBYA 4JI0C 3GKUA 1USPB 1IBMC 1MXAA 2BH1X 5BSMA 3RG2A 1XRBA 1PG3A 3RV2A 2WD9A 4DR2C 3TDEA 4K0KC 2P02A 3R9XA 1JOSA 2YWBA 1AMUA 2Y27A 4X64C 2VSQA 2UUCC 3J81D 4PZPA 2OPLB 5GTDA 4DCVA 1XMOC 5BSWA 3ETOA 1V26A 4JI6C 1IBLC 5T8TA 2DYJA 2P2MA 3EERA 3CW8X 4DCTA 3N54B 4DR7C 5CZVA 4DR1C 3I08A 4DV2C 3E7WA 4DR3C 2P20A 2XR1A 3NYQA 3H2TA 5KEIA 3KXWA 1KKGA 2QVYX 4TPSB 4MH4A 4DCUA 3LGXA 4LF7C 1P7LA 5ADZA 1ULTA 3N2QA 3PBKA 3L95X 1O90A 3NYRA 2HHHC 3J80D 1ZB9A 4JI5C 2YCBA 1BA3A 1LCIA 1RG9A 2UU9C 4D4GA 4X62C 2F4VC 1XMQC 3VNQA 1MKYA 5BUQA 1XRCA 2ASBA 3EQ6A 4ODJA 5KYTA 4LF4C 4JI1C 5IFIA 4RVOA 4I9FA 2UXCC 1MDBA 1YJ7A 3IMLA 1J5EC 4BSZA 1O9TA 2BJOA 2KZFA 4BC9A 3G7SA 4GXQA 3PROC 4DR4C 2P2QA 2Y4NA 2E5LC 4DUYC 1QM4A 3R9WA 2DPLA 2HJGA 3T1YC 3VNSA 1XNQC 3NPDA 4DV7C 4JV5C 4NXMC 5A2QD 5A1IA 3LUSA 3CW9A 4I9GA 2P2BA 4DV5C 3DAYA 2CXCA 1MD9A 1O92A 4RMNA 4R0MA 3ETCA 5BR8C 2E0GA 4DUZC 1MXCA 4B3MC 4OYCA 4DG9A 5K85A 4B3RC 2OO4A 4OX9C 2CY1A 3CJEA 5DV9A 5FLXD 4X66C 2E8CA 5IT9D 4G37A 4ZJZA 2UUBC 1N34C 4L7IA 4WS9A 1UKKA 4FTFA 5AE2A 3LNVA 2D1QA 3S82A 2OBVA 2VQEC 5IWAC 4DCSA 4DV3C 4PROC 4R1MA 5A1GA 3B7WA 3GPCA 5AE1A 3VNRA 1N33C 2D1SA 3FCEA 2E8EA 5T8SA 5JRHA 2UXBC 5A19A 4K0BA 3DLPX 2P2JA 4DV0C 5BSUA 3E7XA 4EATA 4DV4C 4B3SC 1RY2A 2YWCA 3IPLA 4FUQA 4GKJC 5AE3A 4XX2A 4RM2A 3C5EA 1N2FA 2UUAC 2QL8A 2AYAA 4G1IA 4G36A 1N36C 1VLAA 2PT7G 1T5DX 3PESA 2QW0X 2ATWA 2PROA 4KHPC 1XNRC 4PHTA 4RLQA 1HNWC 4JI8C 1L2FA 4ISBA 3DHVA 4IZ6A 1K0RA 3TUFA 4GXRA 2EGTA 2D1TA 5BSRA 4DV6C 3NI2A 3UZ0A 4LFBC 4LF8C 3A4IA 2D27A 4KTTA 2E7GA 2UXDC 1USPA 4DR6C 5K8FA 4WV3A 4L2ZA 5LMNC 1ZB8A 4R1LA 4U5YD 3L8CA 4RLFA 2Y4OA 3FCCA 1PA4A 3A9UA 2QVZX 1ML8A 3AF6A 4BC7A 4BCAA 4LF9C 2WP0C 4HPVA 1GPMA 3I07A 1IBKC 1NYEA 4NOZA 1WF3A 4YHHC 4IR7A 1WH9A 1MXBA 3TQIA 1HNXC 3GR0A 5H9UA 4JYAC 3LAXA 3IEUA 3J7AD 3UOWA 4LE5A 5BURA 4LFAC 5KYVA 2OPLA 2ZM6C 2D28C 4ZLPA 4FUTA 4L4QA 3OTOC 2VZEA 2D7VA 4JI3C 3IEVA 1HR0C 2VQFC 3GR1A 4RVNA 4X65C 5BSTA 1V25A 4LF5C 2PN2A 5E7QA 1MDFA 4LFCC 4JI2C 4YY3C 3JAMD 3A9VA 1O93A 3SO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB C;  4LF8 C;  4DR3 C;  4OX9 C;  2CY1 A;  2XR1 A;  3CJE A;  5FLX D;  1QWI A;  2E7G A;  1LQL A;  4X66 C;  2UXD C;  1USP A;  4DR6 C;  1FJG C;  3T1H C;  2E8C A;  5IT9 D;  5LMN C;  1KKG A;  1ZB8 A;  2JMP A;  2ONF A;  4MH4 A;  4NXN C;  4DCU A;  4LF7 C;  4B3T C;  2UUB C;  4JI7 C;  1PA4 A;  3AF5 A;  1ML8 A;  1N34 C;  2HHH C;  3AF6 A;  4LF9 C;  1UKK A;  1I94 C;  2E8F A;  3J80 D;  1ZB9 A;  3I07 A;  4JI5 C;  1HH2 P;  4JI4 C;  1IBK C;  1NYE A;  2YCB A;  4NOZ A;  1WF3 A;  4YHH C;  2UU9 C;  4MTN A;  1EGA A;  2VQE C;  1HNZ C;  4X62 C;  5IWA C;  1WH9 A;  2F4V C;  4DCS A;  1XMQ C;  4DV3 C;  1MKY A;  1HNX C;  1N32 C;  4LF6 C;  1N33 C;  2ASB A;  2E8E A;  2UXB C;  4DV1 C;  4DR5 C;  4GKK C;  4JYA C;  5LMU C;  4JI1 C;  4LF4 C;  4DV0 C;  3IEU A;  2UXC C;  3J7A D;  4DV4 C;  4B3S C;  1J5E C;  4BSZ A;  4LFA C;  2OPL A;  2BJO A;  4JI0 C;  2ZM6 C;  2KZF A;  3GKU A;  1USP B;  1IBM C;  4GKJ C;  3OTO C;  4DR4 C;  4XX2 A;  1N2F A;  2UUA C;  2D7V A;  2QL8 A;  4JI3 C;  4DR2 C;  2E5L C;  3IEV A;  4DUY C;  4K0K C;  3R9W A;  1HR0 C;  2VQF C;  1N36 C;  2HJG A;  1JOS A;  1VLA A;  3T1Y C;  3R9X A;  1XNQ C;  4DV7 C;  2PT7 G;  4JV5 C;  4NXM C;  4X64 C;  4X65 C;  5A2Q D;  3LUS A;  2UUC C;  3J81 D;  4LF5 C;  2ATW A;  2OPL B;  4DV5 C;  2CXC A;  4DCV A;  4KHP C;  2PN2 A;  1XMO C;  1XNR C;  4LFC C;  4JI2 C;  4JI6 C;  1IBL C;  4YY3 C;  3JAM D;  1HNW C;  4JI8 C;  1L2F A;  2DYJ A;  1K0R A;  3EER A;  5BR8 C;  4DCT A;  2EGT A;  4DR7 C;  4DR1 C;  4DUZ C;  4B3M C;  4AQY C;  4DV6 C;  4B3R C;  4DV2 C; 
#chains in the Genus database with same CATH topology
 4GS5 A;  4NDN A;  1QWI A;  4D56 A;  1LQL A;  1FJG C;  1TH5 A;  3T1H C;  3R44 A;  2JMP A;  2ONF A;  5BUS A;  4NXN C;  4B3T C;  2QVX X;  4JI7 C;  4KTV A;  4RM3 A;  3AF5 A;  4D57 A;  2V7B A;  1I94 C;  2E8F A;  1XRA A;  2P2F A;  1HH2 P;  1P4E A;  4JI4 C;  2ZTB A;  1T5H X;  4AQY C;  2MCQ A;  1PG4 A;  3A26 A;  4MTN A;  1EGA A;  4JM1 A;  4OXI A;  1HNZ C;  4D4I A;  2MMA B;  4PUH A;  2D1R A;  1N32 C;  4LF6 C;  5BSV A;  1VEH A;  5CZX A;  4DG8 A;  4DV1 C;  4DR5 C;  4GKK C;  1FUG A;  5LMU C;  1FLO A;  1XHJ A;  4BBY A;  4JI0 C;  3GKU A;  1USP B;  1IBM C;  1MXA A;  2BH1 X;  5BSM A;  3RG2 A;  1XRB A;  1PG3 A;  3RV2 A;  1P4E C;  2WD9 A;  4DR2 C;  3TDE A;  4K0K C;  2P02 A;  3R9X A;  1JOS A;  2YWB A;  1AMU A;  2Y27 A;  4X64 C;  2VSQ A;  2UUC C;  3J81 D;  3AY0 A;  4PZP A;  2OPL B;  5GTD A;  1UWD A;  4DCV A;  1XMO C;  5BSW A;  3ETO A;  1V26 A;  4JI6 C;  1IBL C;  5T8T A;  2DYJ A;  2P2M A;  3EER A;  3CW8 X;  4DCT A;  3N54 B;  4DR7 C;  5CZV A;  4DR1 C;  1V60 A;  3I08 A;  4DV2 C;  3E7W A;  4DR3 C;  2P20 A;  2XR1 A;  4PUI A;  3CQ2 A;  3NYQ A;  3H2T A;  5KEI A;  3KXW A;  1KKG A;  2QVY X;  4TPS B;  4MH4 A;  4DCU A;  3LGX A;  4LF7 C;  1P7L A;  1M6X C;  5ADZ A;  1ULT A;  3N2Q A;  3PBK A;  3L95 X;  1O90 A;  3NYR A;  2HHH C;  3TR3 A;  3J80 D;  1ZB9 A;  4JI5 C;  2YCB A;  1BA3 A;  1LCI A;  1RG9 A;  2UU9 C;  4D4G A;  4X62 C;  3CQ1 A;  2F4V C;  1XMQ C;  1YGT A;  3VNQ A;  1MKY A;  5BUQ A;  1XRC A;  2ASB A;  3EQ6 A;  4ODJ A;  5KYT A;  4LF4 C;  4JI1 C;  5IFI A;  4RVO A;  4I9F A;  2UXC C;  1MDB A;  1YJ7 A;  3IML A;  1XDX A;  1J5E C;  4BSZ A;  3A25 A;  1O9T A;  1WCJ A;  2DHM A;  2BJO A;  2KZF A;  4BC9 A;  3G7S A;  4GXQ A;  3PRO C;  4DR4 C;  2P2Q A;  2Y4N A;  2E5L C;  4DUY C;  1QM4 A;  3R9W A;  1M6X A;  2DPL A;  2HJG A;  3T1Y C;  3VNS A;  2Z51 A;  1XNQ C;  3NPD A;  4DV7 C;  4JV5 C;  4NXM C;  5A2Q D;  2MM9 A;  5A1I A;  3LUS A;  3CW9 A;  4I9G A;  2P2B A;  4DV5 C;  3DAY A;  2CXC A;  1MD9 A;  1O92 A;  4RMN A;  4R0M A;  5LCI A;  3ETC A;  5BR8 C;  2E0G A;  4DUZ C;  1MXC A;  3O2E A;  4OYC A;  4DG9 A;  5K85 A;  4B3M C;  4B3R C;  3LNO A;  2OO4 A;  4OX9 C;  2CY1 A;  3CJE A;  5DV9 A;  5FLX D;  4X66 C;  2KDN A;  2E8C A;  5IT9 D;  4G37 A;  4ZJZ A;  2UUB C;  2KZ0 A;  1N34 C;  4L7I A;  4WS9 A;  1UKK A;  3K6R A;  2JNV A;  4FTF A;  5AE2 A;  3LNV A;  2D1Q A;  3S82 A;  2OBV A;  2VQE C;  1XS3 A;  5IWA C;  4DCS A;  4DV3 C;  4PRO C;  4R1M A;  5A1G A;  3B7W A;  3GPC A;  5AE1 A;  3VNR A;  1N33 C;  2D1S A;  3FCE A;  2E8E A;  5T8S A;  5JRH A;  2UXB C;  5A19 A;  4K0B A;  3DLP X;  2P2J A;  4DV0 C;  5BSU A;  3E7X A;  4EAT A;  4DV4 C;  4B3S C;  1RY2 A;  2YWC A;  3IPL A;  4FUQ A;  4GKJ C;  5AE3 A;  4XX2 A;  4RM2 A;  3C5E A;  3UX2 A;  1N2F A;  2UUA C;  2QL8 A;  2AYA A;  4G1I A;  4G36 A;  1N36 C;  1IB8 A;  1VLA A;  3CQ3 A;  2PT7 G;  1T5D X;  3PES A;  2QW0 X;  2PG1 E;  2ATW A;  2PRO A;  4KHP C;  1XNR C;  4PHT A;  4RLQ A;  1HNW C;  4JI8 C;  1L2F A;  4ISB A;  3DHV A;  4IZ6 A;  1K0R A;  3TUF A;  4GXR A;  2EGT A;  2D1T A;  5BSR A;  4DV6 C;  3NI2 A;  4PUG A;  3UZ0 A;  4LFB C;  4LF8 C;  3A4I A;  2D27 A;  4KTT A;  2E7G A;  2UXD C;  1USP A;  4DR6 C;  5K8F A;  4WV3 A;  4L2Z A;  5LMN C;  1ZB8 A;  4R1L A;  4U5Y D;  3L8C A;  2CU6 A;  4RLF A;  2Y4O A;  3FCC A;  1PA4 A;  3A9U A;  2QVZ X;  1ML8 A;  3AF6 A;  4BC7 A;  4BCA A;  4LF9 C;  2YX1 A;  2WP0 C;  4HPV A;  1GPM A;  3UEB A;  3I07 A;  1PU1 A;  1IBK C;  1NYE A;  4NOZ A;  1WF3 A;  4YHH C;  4IR7 A;  1WH9 A;  1MXB A;  3TQI A;  1HNX C;  3GR0 A;  5H9U A;  4JYA C;  2M5O A;  3LAX A;  3IEU A;  3J7A D;  3UOW A;  4LE5 A;  5BUR A;  4LFA C;  5KYV A;  2OPL A;  2ZZM A;  2ZM6 C;  2M5H A;  2D28 C;  4ZLP A;  4FUT A;  4L4Q A;  3OTO C;  2VZE A;  2NCL A;  2D7V A;  4JI3 C;  3IEV A;  2ZZN A;  1HR0 C;  2VQF C;  3GR1 A;  4RVN A;  4X65 C;  5BST A;  1V25 A;  4LF5 C;  2PN2 A;  5E7Q A;  1MDF A;  4LFC C;  1NY8 A;  3FM7 A;  4JI2 C;  4YY3 C;  3JAM D;  3A9V A;  3UX3 A;  1O93 A;  3SO4 A; 
#chains in the Genus database with same CATH homology
 4GS5 A;  4NDN A;  1QWI A;  4D56 A;  1LQL A;  1FJG C;  3T1H C;  3R44 A;  2JMP A;  2ONF A;  5BUS A;  4NXN C;  4B3T C;  2QVX X;  4JI7 C;  4KTV A;  4RM3 A;  3AF5 A;  4D57 A;  2V7B A;  1I94 C;  2E8F A;  1XRA A;  2P2F A;  1HH2 P;  4JI4 C;  1T5H X;  4AQY C;  1PG4 A;  4MTN A;  1EGA A;  4JM1 A;  4OXI A;  1HNZ C;  4D4I A;  2D1R A;  1N32 C;  4LF6 C;  5BSV A;  5CZX A;  4DG8 A;  4DV1 C;  4DR5 C;  4GKK C;  1FUG A;  5LMU C;  4BBY A;  4JI0 C;  3GKU A;  1USP B;  1IBM C;  1MXA A;  2BH1 X;  5BSM A;  3RG2 A;  1XRB A;  1PG3 A;  3RV2 A;  2WD9 A;  4DR2 C;  3TDE A;  4K0K C;  2P02 A;  3R9X A;  1JOS A;  2YWB A;  1AMU A;  2Y27 A;  4X64 C;  2VSQ A;  2UUC C;  3J81 D;  4PZP A;  2OPL B;  5GTD A;  4DCV A;  1XMO C;  5BSW A;  3ETO A;  1V26 A;  4JI6 C;  1IBL C;  5T8T A;  2DYJ A;  2P2M A;  3EER A;  3CW8 X;  4DCT A;  3N54 B;  4DR7 C;  5CZV A;  4DR1 C;  3I08 A;  4DV2 C;  3E7W A;  4DR3 C;  2P20 A;  2XR1 A;  3NYQ A;  3H2T A;  5KEI A;  3KXW A;  1KKG A;  2QVY X;  4TPS B;  4MH4 A;  4DCU A;  3LGX A;  4LF7 C;  1P7L A;  5ADZ A;  1ULT A;  3N2Q A;  3PBK A;  3L95 X;  1O90 A;  3NYR A;  2HHH C;  3J80 D;  1ZB9 A;  4JI5 C;  2YCB A;  1BA3 A;  1LCI A;  1RG9 A;  2UU9 C;  4D4G A;  4X62 C;  2F4V C;  1XMQ C;  3VNQ A;  1MKY A;  5BUQ A;  1XRC A;  2ASB A;  3EQ6 A;  4ODJ A;  5KYT A;  4LF4 C;  4JI1 C;  5IFI A;  4RVO A;  4I9F A;  2UXC C;  1MDB A;  1YJ7 A;  3IML A;  1J5E C;  4BSZ A;  1O9T A;  2BJO A;  2KZF A;  4BC9 A;  3G7S A;  4GXQ A;  3PRO C;  4DR4 C;  2P2Q A;  2Y4N A;  2E5L C;  4DUY C;  1QM4 A;  3R9W A;  2DPL A;  2HJG A;  3T1Y C;  3VNS A;  1XNQ C;  3NPD A;  4DV7 C;  4JV5 C;  4NXM C;  5A2Q D;  5A1I A;  3LUS A;  3CW9 A;  4I9G A;  2P2B A;  4DV5 C;  3DAY A;  2CXC A;  1MD9 A;  1O92 A;  4RMN A;  4R0M A;  3ETC A;  5BR8 C;  2E0G A;  4DUZ C;  1MXC A;  4B3M C;  4OYC A;  4DG9 A;  5K85 A;  4B3R C;  2OO4 A;  4OX9 C;  2CY1 A;  3CJE A;  5DV9 A;  5FLX D;  4X66 C;  2E8C A;  5IT9 D;  4G37 A;  4ZJZ A;  2UUB C;  1N34 C;  4L7I A;  4WS9 A;  1UKK A;  4FTF A;  5AE2 A;  3LNV A;  2D1Q A;  3S82 A;  2OBV A;  2VQE C;  5IWA C;  4DCS A;  4DV3 C;  4PRO C;  4R1M A;  5A1G A;  3B7W A;  3GPC A;  5AE1 A;  3VNR A;  1N33 C;  2D1S A;  3FCE A;  2E8E A;  5T8S A;  5JRH A;  2UXB C;  5A19 A;  4K0B A;  3DLP X;  2P2J A;  4DV0 C;  5BSU A;  3E7X A;  4EAT A;  4DV4 C;  4B3S C;  1RY2 A;  2YWC A;  3IPL A;  4FUQ A;  4GKJ C;  5AE3 A;  4XX2 A;  4RM2 A;  3C5E A;  1N2F A;  2UUA C;  2QL8 A;  2AYA A;  4G1I A;  4G36 A;  1N36 C;  1VLA A;  2PT7 G;  1T5D X;  3PES A;  2QW0 X;  2ATW A;  2PRO A;  4KHP C;  1XNR C;  4PHT A;  4RLQ A;  1HNW C;  4JI8 C;  1L2F A;  4ISB A;  3DHV A;  4IZ6 A;  1K0R A;  3TUF A;  4GXR A;  2EGT A;  2D1T A;  5BSR A;  4DV6 C;  3NI2 A;  3UZ0 A;  4LFB C;  4LF8 C;  3A4I A;  2D27 A;  4KTT A;  2E7G A;  2UXD C;  1USP A;  4DR6 C;  5K8F A;  4WV3 A;  4L2Z A;  5LMN C;  1ZB8 A;  4R1L A;  4U5Y D;  3L8C A;  4RLF A;  2Y4O A;  3FCC A;  1PA4 A;  3A9U A;  2QVZ X;  1ML8 A;  3AF6 A;  4BC7 A;  4BCA A;  4LF9 C;  2WP0 C;  4HPV A;  1GPM A;  3I07 A;  1IBK C;  1NYE A;  4NOZ A;  1WF3 A;  4YHH C;  4IR7 A;  1WH9 A;  1MXB A;  3TQI A;  1HNX C;  3GR0 A;  5H9U A;  4JYA C;  3LAX A;  3IEU A;  3J7A D;  3UOW A;  4LE5 A;  5BUR A;  4LFA C;  5KYV A;  2OPL A;  2ZM6 C;  2D28 C;  4ZLP A;  4FUT A;  4L4Q A;  3OTO C;  2VZE A;  2D7V A;  4JI3 C;  3IEV A;  1HR0 C;  2VQF C;  3GR1 A;  4RVN A;  4X65 C;  5BST A;  1V25 A;  4LF5 C;  2PN2 A;  5E7Q A;  1MDF A;  4LFC C;  4JI2 C;  4YY3 C;  3JAM D;  3A9V A;  1O93 A;  3SO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...