2UUBC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uubC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uubC02
2E7GA 2ATWA 1N34C 4JI7C 4NXMC 4JV5C 2E8EA 4DCTA 3AF5A 1K0RA 3T1YC 2EGTA 2CY1A 2ONFA 4JI1C 5IT9D 4JI8C 2VQEC 4LF7C 1USPB 2HJGA 4JI4C 2E8FA 4DR6C 1EGAA 3CJEA 4DUYC 1XNQC 1XNRC 4DR5C 4JI5C 2VQFC 4K0KC 4LFBC 3J80D 4XX2A 2UUAC 1XMQC 4JI0C 3AF6A 4DR4C 3LUSA 4JI6C 4MH4A 4LF8C 2DYJA 4MTNA 4DV3C 1QWIA 3EERA 5FLXD 4DR1C 4YHHC 2UUBC 4X66C 3J81D 2OPLA 3JAMD 2HHHC 4LF9C 4LF6C 4LFCC 4B3RC 1I94C 4LF5C 2F4VC 2OPLB 1HNXC 4NXNC 4GKJC 1FJGC 4X65C 1ZB9A 2UXDC 4B3SC 1XMOC 2UXCC 3IEUA 4LF4C 4X62C 1HNWC 2XR1A 1PA4A 4DR7C 4DV5C 2ASBA 3R9WA 2UUCC 4KHPC 4B3TC 4JYAC 1N2FA 1MKYA 2E5LC 1VLAA 3I07A 4JI3C 5LMNC 4DV7C 1WH9A 4DCSA 3J7AD 2ZM6C 1IBKC 1L2FA 4DV1C 4GKKC 1UKKA 4NOZA 4B3MC 1IBMC 4YY3C 1LQLA 2CXCA 5A2QD 1ZB8A 1NYEA 2KZFA 3OTOC 4DCUA 4DR3C 2PN2A 1HNZC 3GKUA 4OX9C 5BR8C 2PT7G 4DV6C 5LMUC 1J5EC 2E8CA 4DUZC 4JI2C 4DV0C 2YCBA 1USPA 1JOSA 3IEVA 2JMPA 1WF3A 3T1HC 4DV2C 1KKGA 1ML8A 2BJOA 2D7VA 1HH2P 4X64C 4LFAC 1N33C 4DV4C 1N36C 5IWAC 1N32C 4AQYC 2UXBC 1IBLC 4DR2C 1HR0C 2UU9C 4DCVA 4BSZA 3R9XA 2QL8A
chains in the Genus database with same CATH superfamily
1MXBA 1O93A 1N34C 2QVYX 3ETOA 3UEBA 2E0GA 3AF5A 1GPMA 2CY1A 1MD9A 4LF7C 4RM2A 4DR6C 3CJEA 4RLQA 3RV2A 3CW8X 3J80D 2P20A 1XMQC 1P4EC 3AF6A 5DV9A 3SO4A 5BUSA 4LF8C 1AMUA 4RVOA 4DR1C 3H2TA 1PU1A 1MXCA 4LF9C 4LF6C 1I94C 4LF5C 3A9VA 1HNXC 3FM7A 4NXNC 5A1GA 4X65C 1ZB9A 2AYAA 2ZZMA 2UXDC 1YGTA 2UXCC 3A26A 3IEUA 2DHMA 1M6XA 5H9UA 4DR7C 5BSMA 4FUTA 3R9WA 2E5LC 4RMNA 3K6RA 4JI3C 4DV7C 5BSRA 1V26A 4DCSA 2ZM6C 1RG9A 4FTFA 3GR0A 4DG9A 4NOZA 3TUFA 4G37A 1P7LA 4GXQA 5BUQA 1XRBA 4K0BA 1NYEA 2KZFA 5AE1A 3GPCA 3PBKA 1J5EC 4ISBA 4PUIA 4DUZC 4JI2C 1XDXA 3FCCA 2YCBA 5LCIA 5ADZA 3IEVA 2JMPA 1XRCA 1MXAA 1KKGA 2BJOA 2D7VA 1HH2P 5BSWA 3G7SA 4I9FA 1N32C 1TH5A 1MDBA 3RG2A 1WCJA 3PROC 1HR0C 4ZJZA 3LNOA 3LGXA 1XRAA 3TDEA 1V25A 2E8EA 1K0RA 3T1YC 5GTDA 4HPVA 4JI1C 5IT9D 3IMLA 2HJGA 1T5HX 3A4IA 2E8FA 4OXIA 4D4IA 2OO4A 4D57A 1EGAA 4RVNA 3LNVA 4R1MA 4L4QA 4L2ZA 4LFBC 4BBYA 2ZTBA 4DR4C 3LUSA 4R0MA 1PG3A 4JI6C 4MH4A 4DV3C 5CZXA 1XHJA 3DAYA 2UUBC 2JNVA 2Y27A 3UX3A 3JAMD 4D4GA 2WP0C 4GXRA 2P2BA 1FJGC 5BSTA 3UOWA 1FLOA 4B3SC 4LF4C 4X62C 3O2EA 3DLPX 2QVXX 4U5YD 4DV5C 3LAXA 4B3TC 2YWBA 1N2FA 5AE2A 3UX2A 3A25A 2M5HA 2Z51A 1L2FA 4DV1C 5T8TA 4GKKC 4WS9A 1UKKA 4B3MC 2Y4OA 5A1IA 3L8CA 4DG8A 5A2QD 4R1LA 2VZEA 4DCUA 1V60A 2PN2A 1HNZC 3GKUA 5LMUC 3N54B 3VNRA 3I08A 4DV0C 1JOSA 5T8SA 2D1RA 1WF3A 5IFIA 1UWDA 4X64C 2MM9A 2KDNA 1N33C 2D28C 4DV4C 3AY0A 4AQYC 2UXBC 1IBLC 1QM4A 4DR2C 2D1SA 2M5OA 4DCVA 2QL8A 2E7GA 4RM3A 2ATWA 3L95X 4G1IA 2P2QA 4JV5C 4DCTA 2EGTA 2ONFA 3VNSA 2OBVA 4JI8C 1IB8A 1USPB 2D1QA 4JI4C 1M6XC 1LCIA 3S82A 4DUYC 1XNQC 1XNRC 4DR5C 4JI5C 2VQFC 4K0KC 2UUAC 1O92A 4JI0C 5KYTA 4KTVA 1P4EA 2DYJA 4MTNA 3EERA 2PROA 4GS5A 4YHHC 4X66C 4BC7A 2BH1X 4BCAA 4WV3A 4I9GA 2YX1A 2P2FA 4KTTA 4GKJC 3E7WA 2YWCA 2P02A 5A19A 1HNWC 1PA4A 4TPSB 4LE5A 2ASBA 4PUGA 3NYQA 1MKYA 3CW9A 3GR1A 1VLAA 5LMNC 3UZ0A 1WH9A 4NDNA 3J7AD 2MMAB 2NCLA 3KXWA 3NPDA 3TR3A 2CU6A 1IBMC 1XS3A 1MDFA 3EQ6A 1LQLA 1ZB8A 1NY8A 3OTOC 4JM1A 4DV6C 3DHVA 3CQ1A 2MCQA 1USPA 2VSQA 3NI2A 3VNQA 2D27A 4DV2C 4IR7A 1ML8A 2QVZX 3CQ2A 4ODJA 1O9TA 4EATA 5IWAC 1RY2A 3C5EA 4PUHA 2DPLA 3N2QA 2KZ0A 4JI7C 4NXMC 4ZLPA 2VQEC 2ZZNA 4RLFA 1O90A 1FUGA 5K85A 4XX2A 2QW0X 5K8FA 3A9UA 3TQIA 1QWIA 5FLXD 3NYRA 3J81D 2OPLA 5BSVA 2HHHC 2PG1E 4B3RC 4LFCC 3IPLA 2F4VC 2V7BA 2OPLB 3B7WA 3E7XA 5E7QA 4BC9A 2WD9A 5AE3A 2D1TA 1XMOC 2XR1A 1BA3A 4OYCA 2Y4NA 1ULTA 1PG4A 2UUCC 4KHPC 4JYAC 2P2MA 3I07A 1IBKC 4D56A 4IZ6A 4PROC 5KYVA 4YY3C 2CXCA 3FCEA 4DR3C 4OX9C 5BSUA 5BR8C 2PT7G 4PHTA 2E8CA 3ETCA 5CZVA 5JRHA 3PESA 4PZPA 3T1HC 1T5DX 3CQ3A 4LFAC 4FUQA 1YJ7A 5BURA 5KEIA 1N36C 4G36A 3R44A 4L7IA 2P2JA 2UU9C 1VEHA 4BSZA 3R9XA
chains in the Genus database with same CATH topology
1MXBA 1O93A 1N34C 2QVYX 3ETOA 2E0GA 3AF5A 1GPMA 2CY1A 1MD9A 4LF7C 4RM2A 4DR6C 3CJEA 4RLQA 3RV2A 3CW8X 3J80D 2P20A 1XMQC 3AF6A 5DV9A 3SO4A 5BUSA 4LF8C 1AMUA 4RVOA 4DR1C 3H2TA 1MXCA 4LF9C 4LF6C 1I94C 4LF5C 3A9VA 1HNXC 4NXNC 5A1GA 4X65C 1ZB9A 2AYAA 2UXDC 2UXCC 3IEUA 5H9UA 4DR7C 5BSMA 4FUTA 3R9WA 2E5LC 4RMNA 4DV7C 4JI3C 5BSRA 1V26A 4DCSA 2ZM6C 1RG9A 4FTFA 3GR0A 4DG9A 4NOZA 3TUFA 4G37A 1P7LA 4GXQA 5BUQA 1XRBA 4K0BA 1NYEA 2KZFA 5AE1A 3GPCA 3PBKA 1J5EC 4ISBA 4DUZC 4JI2C 3FCCA 2YCBA 5ADZA 3IEVA 2JMPA 1XRCA 1MXAA 1KKGA 2BJOA 2D7VA 1HH2P 5BSWA 3G7SA 4I9FA 1N32C 1MDBA 3RG2A 3PROC 1HR0C 4ZJZA 3LGXA 1XRAA 3TDEA 1V25A 2E8EA 1K0RA 3T1YC 5GTDA 4HPVA 4JI1C 5IT9D 3IMLA 2HJGA 1T5HX 3A4IA 2E8FA 4OXIA 4D4IA 2OO4A 4D57A 1EGAA 4RVNA 3LNVA 4R1MA 4L4QA 4L2ZA 4LFBC 4BBYA 4DR4C 3LUSA 4R0MA 1PG3A 4JI6C 4MH4A 4DV3C 5CZXA 3DAYA 2UUBC 2Y27A 3JAMD 4D4GA 2WP0C 4GXRA 2P2BA 1FJGC 5BSTA 3UOWA 4B3SC 4LF4C 4X62C 3DLPX 2QVXX 4U5YD 4DV5C 3LAXA 4B3TC 2YWBA 1N2FA 5AE2A 1L2FA 4DV1C 5T8TA 4GKKC 4WS9A 1UKKA 4B3MC 2Y4OA 5A1IA 3L8CA 4DG8A 5A2QD 4R1LA 2VZEA 4DCUA 1HNZC 2PN2A 3GKUA 5LMUC 3N54B 3VNRA 3I08A 4DV0C 1JOSA 5T8SA 2D1RA 1WF3A 5IFIA 4X64C 1N33C 2D28C 4DV4C 4AQYC 2UXBC 1IBLC 1QM4A 4DR2C 2D1SA 4DCVA 2QL8A 2E7GA 4RM3A 2ATWA 3L95X 4G1IA 2P2QA 4JV5C 4DCTA 2EGTA 2ONFA 3VNSA 2OBVA 4JI8C 1USPB 2D1QA 4JI4C 1LCIA 3S82A 4DUYC 1XNQC 1XNRC 4DR5C 4JI5C 2VQFC 4K0KC 2UUAC 1O92A 4JI0C 5KYTA 4KTVA 2DYJA 4MTNA 3EERA 2PROA 4GS5A 4YHHC 4X66C 4BC7A 2BH1X 4BCAA 4WV3A 4I9GA 2P2FA 4KTTA 4GKJC 3E7WA 2YWCA 2P02A 5A19A 1HNWC 1PA4A 4TPSB 4LE5A 2ASBA 3NYQA 1MKYA 3CW9A 3GR1A 1VLAA 5LMNC 3UZ0A 1WH9A 4NDNA 3J7AD 3KXWA 3NPDA 1IBMC 1MDFA 3EQ6A 1LQLA 1ZB8A 3OTOC 4JM1A 4DV6C 3DHVA 1USPA 2VSQA 3NI2A 3VNQA 2D27A 4DV2C 4IR7A 1ML8A 2QVZX 4ODJA 1O9TA 4EATA 5IWAC 1RY2A 3C5EA 2DPLA 3N2QA 4JI7C 4NXMC 4ZLPA 2VQEC 4RLFA 1O90A 1FUGA 5K85A 4XX2A 2QW0X 5K8FA 3A9UA 3TQIA 1QWIA 5FLXD 3NYRA 3J81D 2OPLA 5BSVA 2HHHC 4B3RC 4LFCC 3IPLA 2F4VC 2V7BA 2OPLB 3B7WA 3E7XA 5E7QA 4BC9A 2WD9A 5AE3A 2D1TA 1XMOC 2XR1A 1BA3A 4OYCA 2Y4NA 1ULTA 1PG4A 2UUCC 4KHPC 4JYAC 2P2MA 3I07A 1IBKC 4D56A 4IZ6A 4PROC 5KYVA 4YY3C 2CXCA 3FCEA 4DR3C 4OX9C 5BSUA 5BR8C 2PT7G 4PHTA 2E8CA 3ETCA 5CZVA 5JRHA 3PESA 4PZPA 3T1HC 1T5DX 4LFAC 4FUQA 1YJ7A 5BURA 5KEIA 1N36C 4G36A 3R44A 4L7IA 2P2JA 2UU9C 4BSZA 3R9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7G A;  2ATW A;  1N34 C;  4JI7 C;  4NXM C;  4JV5 C;  2E8E A;  4DCT A;  3AF5 A;  1K0R A;  3T1Y C;  2EGT A;  2CY1 A;  2ONF A;  4JI1 C;  5IT9 D;  4JI8 C;  2VQE C;  4LF7 C;  1USP B;  2HJG A;  4JI4 C;  2E8F A;  4DR6 C;  1EGA A;  3CJE A;  4DUY C;  1XNQ C;  1XNR C;  4DR5 C;  4JI5 C;  2VQF C;  4K0K C;  4LFB C;  3J80 D;  4XX2 A;  2UUA C;  1XMQ C;  4JI0 C;  3AF6 A;  4DR4 C;  3LUS A;  4JI6 C;  4MH4 A;  4LF8 C;  2DYJ A;  4MTN A;  4DV3 C;  1QWI A;  3EER A;  5FLX D;  4DR1 C;  4YHH C;  2UUB C;  4X66 C;  3J81 D;  2OPL A;  3JAM D;  2HHH C;  4LF9 C;  4LF6 C;  4LFC C;  4B3R C;  1I94 C;  4LF5 C;  2F4V C;  2OPL B;  1HNX C;  4NXN C;  4GKJ C;  1FJG C;  4X65 C;  1ZB9 A;  2UXD C;  4B3S C;  1XMO C;  2UXC C;  3IEU A;  4LF4 C;  4X62 C;  1HNW C;  2XR1 A;  1PA4 A;  4DR7 C;  4DV5 C;  2ASB A;  3R9W A;  2UUC C;  4KHP C;  4B3T C;  4JYA C;  1N2F A;  1MKY A;  2E5L C;  1VLA A;  3I07 A;  4JI3 C;  5LMN C;  4DV7 C;  1WH9 A;  4DCS A;  3J7A D;  2ZM6 C;  1IBK C;  1L2F A;  4DV1 C;  4GKK C;  1UKK A;  4NOZ A;  4B3M C;  1IBM C;  4YY3 C;  1LQL A;  2CXC A;  5A2Q D;  1ZB8 A;  1NYE A;  2KZF A;  3OTO C;  4DCU A;  4DR3 C;  2PN2 A;  1HNZ C;  3GKU A;  4OX9 C;  5BR8 C;  2PT7 G;  4DV6 C;  5LMU C;  1J5E C;  2E8C A;  4DUZ C;  4JI2 C;  4DV0 C;  2YCB A;  1USP A;  1JOS A;  3IEV A;  2JMP A;  1WF3 A;  3T1H C;  4DV2 C;  1KKG A;  1ML8 A;  2BJO A;  2D7V A;  1HH2 P;  4X64 C;  4LFA C;  1N33 C;  4DV4 C;  1N36 C;  5IWA C;  1N32 C;  4AQY C;  2UXB C;  1IBL C;  4DR2 C;  1HR0 C;  2UU9 C;  4DCV A;  4BSZ A;  3R9X A;  2QL8 A; 
#chains in the Genus database with same CATH topology
 1MXB A;  1O93 A;  1N34 C;  2QVY X;  3ETO A;  3UEB A;  2E0G A;  3AF5 A;  1GPM A;  2CY1 A;  1MD9 A;  4LF7 C;  4RM2 A;  4DR6 C;  3CJE A;  4RLQ A;  3RV2 A;  3CW8 X;  3J80 D;  2P20 A;  1XMQ C;  1P4E C;  3AF6 A;  5DV9 A;  3SO4 A;  5BUS A;  4LF8 C;  1AMU A;  4RVO A;  4DR1 C;  3H2T A;  1PU1 A;  1MXC A;  4LF9 C;  4LF6 C;  1I94 C;  4LF5 C;  3A9V A;  1HNX C;  3FM7 A;  4NXN C;  5A1G A;  4X65 C;  1ZB9 A;  2AYA A;  2ZZM A;  2UXD C;  1YGT A;  2UXC C;  3A26 A;  3IEU A;  2DHM A;  1M6X A;  5H9U A;  4DR7 C;  5BSM A;  4FUT A;  3R9W A;  2E5L C;  4RMN A;  3K6R A;  4JI3 C;  4DV7 C;  5BSR A;  1V26 A;  4DCS A;  2ZM6 C;  1RG9 A;  4FTF A;  3GR0 A;  4DG9 A;  4NOZ A;  3TUF A;  4G37 A;  1P7L A;  4GXQ A;  5BUQ A;  1XRB A;  4K0B A;  1NYE A;  2KZF A;  5AE1 A;  3GPC A;  3PBK A;  1J5E C;  4ISB A;  4PUI A;  4DUZ C;  4JI2 C;  1XDX A;  3FCC A;  2YCB A;  5LCI A;  5ADZ A;  3IEV A;  2JMP A;  1XRC A;  1MXA A;  1KKG A;  2BJO A;  2D7V A;  1HH2 P;  5BSW A;  3G7S A;  4I9F A;  1N32 C;  1TH5 A;  1MDB A;  3RG2 A;  1WCJ A;  3PRO C;  1HR0 C;  4ZJZ A;  3LNO A;  3LGX A;  1XRA A;  3TDE A;  1V25 A;  2E8E A;  1K0R A;  3T1Y C;  5GTD A;  4HPV A;  4JI1 C;  5IT9 D;  3IML A;  2HJG A;  1T5H X;  3A4I A;  2E8F A;  4OXI A;  4D4I A;  2OO4 A;  4D57 A;  1EGA A;  4RVN A;  3LNV A;  4R1M A;  4L4Q A;  4L2Z A;  4LFB C;  4BBY A;  2ZTB A;  4DR4 C;  3LUS A;  4R0M A;  1PG3 A;  4JI6 C;  4MH4 A;  4DV3 C;  5CZX A;  1XHJ A;  3DAY A;  2UUB C;  2JNV A;  2Y27 A;  3UX3 A;  3JAM D;  4D4G A;  2WP0 C;  4GXR A;  2P2B A;  1FJG C;  5BST A;  3UOW A;  1FLO A;  4B3S C;  4LF4 C;  4X62 C;  3O2E A;  3DLP X;  2QVX X;  4U5Y D;  4DV5 C;  3LAX A;  4B3T C;  2YWB A;  1N2F A;  5AE2 A;  3UX2 A;  3A25 A;  2M5H A;  2Z51 A;  1L2F A;  4DV1 C;  5T8T A;  4GKK C;  4WS9 A;  1UKK A;  4B3M C;  2Y4O A;  5A1I A;  3L8C A;  4DG8 A;  5A2Q D;  4R1L A;  2VZE A;  4DCU A;  1V60 A;  2PN2 A;  1HNZ C;  3GKU A;  5LMU C;  3N54 B;  3VNR A;  3I08 A;  4DV0 C;  1JOS A;  5T8S A;  2D1R A;  1WF3 A;  5IFI A;  1UWD A;  4X64 C;  2MM9 A;  2KDN A;  1N33 C;  2D28 C;  4DV4 C;  3AY0 A;  4AQY C;  2UXB C;  1IBL C;  1QM4 A;  4DR2 C;  2D1S A;  2M5O A;  4DCV A;  2QL8 A;  2E7G A;  4RM3 A;  2ATW A;  3L95 X;  4G1I A;  2P2Q A;  4JV5 C;  4DCT A;  2EGT A;  2ONF A;  3VNS A;  2OBV A;  4JI8 C;  1IB8 A;  1USP B;  2D1Q A;  4JI4 C;  1M6X C;  1LCI A;  3S82 A;  4DUY C;  1XNQ C;  1XNR C;  4DR5 C;  4JI5 C;  2VQF C;  4K0K C;  2UUA C;  1O92 A;  4JI0 C;  5KYT A;  4KTV A;  1P4E A;  2DYJ A;  4MTN A;  3EER A;  2PRO A;  4GS5 A;  4YHH C;  4X66 C;  4BC7 A;  2BH1 X;  4BCA A;  4WV3 A;  4I9G A;  2YX1 A;  2P2F A;  4KTT A;  4GKJ C;  3E7W A;  2YWC A;  2P02 A;  5A19 A;  1HNW C;  1PA4 A;  4TPS B;  4LE5 A;  2ASB A;  4PUG A;  3NYQ A;  1MKY A;  3CW9 A;  3GR1 A;  1VLA A;  5LMN C;  3UZ0 A;  1WH9 A;  4NDN A;  3J7A D;  2MMA B;  2NCL A;  3KXW A;  3NPD A;  3TR3 A;  2CU6 A;  1IBM C;  1XS3 A;  1MDF A;  3EQ6 A;  1LQL A;  1ZB8 A;  1NY8 A;  3OTO C;  4JM1 A;  4DV6 C;  3DHV A;  3CQ1 A;  2MCQ A;  1USP A;  2VSQ A;  3NI2 A;  3VNQ A;  2D27 A;  4DV2 C;  4IR7 A;  1ML8 A;  2QVZ X;  3CQ2 A;  4ODJ A;  1O9T A;  4EAT A;  5IWA C;  1RY2 A;  3C5E A;  4PUH A;  2DPL A;  3N2Q A;  2KZ0 A;  4JI7 C;  4NXM C;  4ZLP A;  2VQE C;  2ZZN A;  4RLF A;  1O90 A;  1FUG A;  5K85 A;  4XX2 A;  2QW0 X;  5K8F A;  3A9U A;  3TQI A;  1QWI A;  5FLX D;  3NYR A;  3J81 D;  2OPL A;  5BSV A;  2HHH C;  2PG1 E;  4B3R C;  4LFC C;  3IPL A;  2F4V C;  2V7B A;  2OPL B;  3B7W A;  3E7X A;  5E7Q A;  4BC9 A;  2WD9 A;  5AE3 A;  2D1T A;  1XMO C;  2XR1 A;  1BA3 A;  4OYC A;  2Y4N A;  1ULT A;  1PG4 A;  2UUC C;  4KHP C;  4JYA C;  2P2M A;  3I07 A;  1IBK C;  4D56 A;  4IZ6 A;  4PRO C;  5KYV A;  4YY3 C;  2CXC A;  3FCE A;  4DR3 C;  4OX9 C;  5BSU A;  5BR8 C;  2PT7 G;  4PHT A;  2E8C A;  3ETC A;  5CZV A;  5JRH A;  3PES A;  4PZP A;  3T1H C;  1T5D X;  3CQ3 A;  4LFA C;  4FUQ A;  1YJ7 A;  5BUR A;  5KEI A;  1N36 C;  4G36 A;  3R44 A;  4L7I A;  2P2J A;  2UU9 C;  1VEH A;  4BSZ A;  3R9X A; 
#chains in the Genus database with same CATH homology
 1MXB A;  1O93 A;  1N34 C;  2QVY X;  3ETO A;  2E0G A;  3AF5 A;  1GPM A;  2CY1 A;  1MD9 A;  4LF7 C;  4RM2 A;  4DR6 C;  3CJE A;  4RLQ A;  3RV2 A;  3CW8 X;  3J80 D;  2P20 A;  1XMQ C;  3AF6 A;  5DV9 A;  3SO4 A;  5BUS A;  4LF8 C;  1AMU A;  4RVO A;  4DR1 C;  3H2T A;  1MXC A;  4LF9 C;  4LF6 C;  1I94 C;  4LF5 C;  3A9V A;  1HNX C;  4NXN C;  5A1G A;  4X65 C;  1ZB9 A;  2AYA A;  2UXD C;  2UXC C;  3IEU A;  5H9U A;  4DR7 C;  5BSM A;  4FUT A;  3R9W A;  2E5L C;  4RMN A;  4DV7 C;  4JI3 C;  5BSR A;  1V26 A;  4DCS A;  2ZM6 C;  1RG9 A;  4FTF A;  3GR0 A;  4DG9 A;  4NOZ A;  3TUF A;  4G37 A;  1P7L A;  4GXQ A;  5BUQ A;  1XRB A;  4K0B A;  1NYE A;  2KZF A;  5AE1 A;  3GPC A;  3PBK A;  1J5E C;  4ISB A;  4DUZ C;  4JI2 C;  3FCC A;  2YCB A;  5ADZ A;  3IEV A;  2JMP A;  1XRC A;  1MXA A;  1KKG A;  2BJO A;  2D7V A;  1HH2 P;  5BSW A;  3G7S A;  4I9F A;  1N32 C;  1MDB A;  3RG2 A;  3PRO C;  1HR0 C;  4ZJZ A;  3LGX A;  1XRA A;  3TDE A;  1V25 A;  2E8E A;  1K0R A;  3T1Y C;  5GTD A;  4HPV A;  4JI1 C;  5IT9 D;  3IML A;  2HJG A;  1T5H X;  3A4I A;  2E8F A;  4OXI A;  4D4I A;  2OO4 A;  4D57 A;  1EGA A;  4RVN A;  3LNV A;  4R1M A;  4L4Q A;  4L2Z A;  4LFB C;  4BBY A;  4DR4 C;  3LUS A;  4R0M A;  1PG3 A;  4JI6 C;  4MH4 A;  4DV3 C;  5CZX A;  3DAY A;  2UUB C;  2Y27 A;  3JAM D;  4D4G A;  2WP0 C;  4GXR A;  2P2B A;  1FJG C;  5BST A;  3UOW A;  4B3S C;  4LF4 C;  4X62 C;  3DLP X;  2QVX X;  4U5Y D;  4DV5 C;  3LAX A;  4B3T C;  2YWB A;  1N2F A;  5AE2 A;  1L2F A;  4DV1 C;  5T8T A;  4GKK C;  4WS9 A;  1UKK A;  4B3M C;  2Y4O A;  5A1I A;  3L8C A;  4DG8 A;  5A2Q D;  4R1L A;  2VZE A;  4DCU A;  1HNZ C;  2PN2 A;  3GKU A;  5LMU C;  3N54 B;  3VNR A;  3I08 A;  4DV0 C;  1JOS A;  5T8S A;  2D1R A;  1WF3 A;  5IFI A;  4X64 C;  1N33 C;  2D28 C;  4DV4 C;  4AQY C;  2UXB C;  1IBL C;  1QM4 A;  4DR2 C;  2D1S A;  4DCV A;  2QL8 A;  2E7G A;  4RM3 A;  2ATW A;  3L95 X;  4G1I A;  2P2Q A;  4JV5 C;  4DCT A;  2EGT A;  2ONF A;  3VNS A;  2OBV A;  4JI8 C;  1USP B;  2D1Q A;  4JI4 C;  1LCI A;  3S82 A;  4DUY C;  1XNQ C;  1XNR C;  4DR5 C;  4JI5 C;  2VQF C;  4K0K C;  2UUA C;  1O92 A;  4JI0 C;  5KYT A;  4KTV A;  2DYJ A;  4MTN A;  3EER A;  2PRO A;  4GS5 A;  4YHH C;  4X66 C;  4BC7 A;  2BH1 X;  4BCA A;  4WV3 A;  4I9G A;  2P2F A;  4KTT A;  4GKJ C;  3E7W A;  2YWC A;  2P02 A;  5A19 A;  1HNW C;  1PA4 A;  4TPS B;  4LE5 A;  2ASB A;  3NYQ A;  1MKY A;  3CW9 A;  3GR1 A;  1VLA A;  5LMN C;  3UZ0 A;  1WH9 A;  4NDN A;  3J7A D;  3KXW A;  3NPD A;  1IBM C;  1MDF A;  3EQ6 A;  1LQL A;  1ZB8 A;  3OTO C;  4JM1 A;  4DV6 C;  3DHV A;  1USP A;  2VSQ A;  3NI2 A;  3VNQ A;  2D27 A;  4DV2 C;  4IR7 A;  1ML8 A;  2QVZ X;  4ODJ A;  1O9T A;  4EAT A;  5IWA C;  1RY2 A;  3C5E A;  2DPL A;  3N2Q A;  4JI7 C;  4NXM C;  4ZLP A;  2VQE C;  4RLF A;  1O90 A;  1FUG A;  5K85 A;  4XX2 A;  2QW0 X;  5K8F A;  3A9U A;  3TQI A;  1QWI A;  5FLX D;  3NYR A;  3J81 D;  2OPL A;  5BSV A;  2HHH C;  4B3R C;  4LFC C;  3IPL A;  2F4V C;  2V7B A;  2OPL B;  3B7W A;  3E7X A;  5E7Q A;  4BC9 A;  2WD9 A;  5AE3 A;  2D1T A;  1XMO C;  2XR1 A;  1BA3 A;  4OYC A;  2Y4N A;  1ULT A;  1PG4 A;  2UUC C;  4KHP C;  4JYA C;  2P2M A;  3I07 A;  1IBK C;  4D56 A;  4IZ6 A;  4PRO C;  5KYV A;  4YY3 C;  2CXC A;  3FCE A;  4DR3 C;  4OX9 C;  5BSU A;  5BR8 C;  2PT7 G;  4PHT A;  2E8C A;  3ETC A;  5CZV A;  5JRH A;  3PES A;  4PZP A;  3T1H C;  1T5D X;  4LFA C;  4FUQ A;  1YJ7 A;  5BUR A;  5KEI A;  1N36 C;  4G36 A;  3R44 A;  4L7I A;  2P2J A;  2UU9 C;  4BSZ A;  3R9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...