2UUBC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uubC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uubC02
2VQEC 3AF5A 2UU9C 4B3MC 4XX2A 4JI1C 2UUBC 4GKJC 4X66C 4LF8C 3CJEA 1WH9A 4JI3C 2ONFA 4LF6C 1KKGA 4LF7C 1MKYA 3OTOC 1WF3A 4LF9C 4K0KC 2E7GA 1JOSA 4BSZA 2PT7G 1ZB8A 4LF5C 1HR0C 1ML8A 4DV5C 4DR1C 1I94C 1HH2P 4JI6C 4DV6C 4LFAC 4OX9C 2BJOA 2ASBA 4GKKC 4DV4C 2UXDC 1N33C 2UXBC 4X62C 4DR3C 1UKKA 2EGTA 4NXNC 1HNZC 2PN2A 3T1YC 5FLXD 2JMPA 3R9WA 4DV1C 1L2FA 1EGAA 4DUYC 4DR4C 1NYEA 4JI7C 4YHHC 1USPA 2KZFA 1PA4A 2DYJA 4DV7C 4LFCC 3J7AD 4JYAC 1N36C 4LFBC 3T1HC 5A2QD 2QL8A 5BR8C 4DV2C 2E8FA 1N32C 2OPLA 5LMUC 3IEVA 3GKUA 4MTNA 4X65C 1N2FA 4JI5C 4LF4C 4DCSA 4X64C 1IBKC 3I07A 3JAMD 4DR2C 1USPB 1K0RA 5IT9D 4B3RC 1HNXC 3J80D 4DV3C 2ZM6C 2UUCC 2F4VC 2E8CA 2ATWA 4KHPC 2D7VA 2OPLB 2YCBA 2CY1A 1LQLA 1N34C 4JI0C 1XMQC 4DCVA 4DR5C 2HHHC 1J5EC 4B3TC 1HNWC 3R9XA 3EERA 2CXCA 3J81D 4JI4C 4DCUA 4DV0C 4AQYC 4MH4A 1FJGC 1XMOC 2XR1A 4NXMC 2UXCC 1XNQC 3IEUA 1IBMC 2UUAC 2E5LC 4B3SC 5IWAC 5LMNC 4YY3C 4NOZA 4DCTA 4JI8C 1XNRC 3LUSA 4JI2C 1VLAA 1ZB9A 4DR7C 4DUZC 4DR6C 3AF6A 1QWIA 4JV5C 2HJGA 2E8EA 1IBLC 2VQFC
chains in the Genus database with same CATH superfamily
3AF5A 2UU9C 1ULTA 4JI1C 4PUHA 4LF8C 4JI3C 3UOWA 4DG8A 4PUIA 4LF6C 3OTOC 4L2ZA 4PHTA 5AE3A 3TR3A 1I94C 4DV5C 4JI6C 4DV6C 2ASBA 4GKKC 2BJOA 2D1TA 2PROA 1XS3A 2UXBC 2ZTBA 3E7WA 1UKKA 4G36A 3R44A 3T1YC 5GTDA 1O92A 4OYCA 5KYVA 1L2FA 4DR4C 1USPA 2MM9A 3FCEA 2V7BA 1MXAA 3T1HC 3L95X 4OXIA 3VNQA 3UX2A 1N32C 3IEVA 3EQ6A 3DLPX 3GKUA 1MD9A 4X65C 4D57A 4JI5C 1M6XA 4PUGA 4ZLPA 3A25A 5JRHA 1T5DX 2QVYX 3LGXA 3PESA 2ZM6C 4R1LA 3ETOA 3CW9A 2OPLB 1LQLA 4G1IA 2YWCA 4DCVA 1J5EC 1UWDA 4RM3A 3J81D 4JI4C 2QW0X 4AQYC 4DV0C 3FCCA 4MH4A 1FJGC 2XR1A 4RVNA 3IEUA 1BA3A 3A9VA 4NOZA 4DCTA 1TH5A 4JI2C 4DR7C 4IR7A 1XRAA 4L4QA 2Y4NA 4JV5C 4D4IA 5BURA 2VQEC 4XX2A 5BSRA 5DV9A 3VNRA 2DPLA 3NI2A 4GKJC 3E7XA 2MCQA 3CJEA 3H2TA 3CW8X 5KEIA 5BSMA 4LF7C 1WF3A 3UX3A 5BSWA 3TUFA 2P2FA 2D1RA 4BSZA 4LF5C 4DR1C 1O90A 4LFAC 4OX9C 2P2QA 3O2EA 2EGTA 2M5OA 1LCIA 2JMPA 2BH1X 1FUGA 1XHJA 4DV1C 3C5EA 4DUYC 1WCJA 4BCAA 4DV7C 4D4GA 4EATA 5A1IA 4LFBC 4FUTA 5A2QD 2E8FA 3N54B 2YWBA 3G7SA 1N2FA 4K0BA 5KYTA 2D1QA 3I07A 3JAMD 3IPLA 4DR2C 1USPB 1K0RA 4NDNA 4B3RC 4ODJA 1HNXC 3A9UA 2OBVA 4DV3C 3A4IA 5LCIA 4WS9A 5BSVA 2D7VA 2D1SA 1XDXA 1N34C 4PROC 1XMQC 3NYRA 4B3TC 3R9XA 3FM7A 4GXQA 1XMOC 4BC9A 1MDBA 5IWAC 4JI8C 3PROC 1VLAA 4R1MA 1FLOA 3LAXA 1XRCA 4L7IA 3AF6A 4IZ6A 1GPMA 3SO4A 2P20A 2UUBC 2VZEA 4X66C 1RY2A 4RMNA 4GXRA 4KTVA 3GR1A 5A19A 4LE5A 4TPSB 1MKYA 3CQ3A 1V25A 2E7GA 1JOSA 4K0KC 2PT7G 5IFIA 1ML8A 1HH2P 4DV4C 3TDEA 1N33C 4X62C 1YJ7A 4NXNC 2PN2A 3DHVA 2M5HA 5BUQA 5FLXD 1P4EA 1VEHA 3R9WA 3IMLA 3I08A 1PU1A 4JI7C 2PG1E 1QM4A 2DYJA 2D27A 3LNVA 3J7AD 3AY0A 3L8CA 1N36C 1RG9A 2YX1A 1YGTA 3DAYA 3A26A 4MTNA 2MMAB 4DCSA 4LF4C 1IBKC 2ZZMA 3GR0A 5AE1A 5CZVA 3ETCA 1PG4A 3CQ1A 4BBYA 4BC7A 4DG9A 3CQ2A 5BUSA 2UUCC 2F4VC 2WD9A 4FTFA 4KHPC 2YCBA 4JI0C 2ZZNA 4DR5C 2QVZX 1HNWC 2E0GA 3UEBA 5T8SA 4DCUA 4ZJZA 1AMUA 2D28C 2UXCC 2Y27A 3KXWA 4B3SC 4PZPA 1XNRC 3LUSA 1NY8A 1ZB9A 1P7LA 2P2JA 4WV3A 4DUZC 4D56A 2ATWA 2VQFC 4B3MC 3UZ0A 1WH9A 2ONFA 1MDFA 2DHMA 1KKGA 2WP0C 1IB8A 1T5HX 1V60A 4RLFA 4LF9C 3VNSA 4JM1A 1ZB8A 1HR0C 3GPCA 5ADZA 2UXDC 5K85A 4DR3C 5CZXA 1M6XC 1HNZC 4FUQA 2OO4A 2P02A 1EGAA 1NYEA 4YHHC 5T8TA 2KZFA 2JNVA 2Y4OA 1PA4A 3S82A 4LFCC 4JYAC 5K8FA 2QL8A 3PBKA 5BR8C 4DV2C 2OPLA 5LMUC 1P4EC 1O93A 4R0MA 2P2BA 4RLQA 4RVOA 4X64C 4ISBA 4I9GA 2NCLA 2Z51A 5IT9D 3J80D 5H9UA 5BSTA 4KTTA 2QVXX 1PG3A 3RG2A 2E8CA 3K6RA 2VSQA 4G37A 2CY1A 5E7QA 5A1GA 1MXBA 2HHHC 3B7WA 2CU6A 2KDNA 4HPVA 1V26A 2CXCA 3EERA 3LNOA 1MXCA 3NYQA 5AE2A 4GS5A 2AYAA 4NXMC 4U5YD 1XNQC 1IBMC 2UUAC 2E5LC 3TQIA 3NPDA 5LMNC 4YY3C 2KZ0A 1XRBA 2P2MA 3N2QA 3RV2A 4RM2A 5BSUA 4DR6C 1QWIA 4I9FA 1O9TA 2HJGA 2E8EA 1IBLC
chains in the Genus database with same CATH topology
3AF5A 2UU9C 1ULTA 4JI1C 4LF8C 4JI3C 3UOWA 4DG8A 4LF6C 3OTOC 4L2ZA 4PHTA 5AE3A 1I94C 4DV5C 4JI6C 4DV6C 2ASBA 4GKKC 2BJOA 2D1TA 2PROA 2UXBC 3E7WA 1UKKA 4G36A 3R44A 3T1YC 5GTDA 1O92A 4OYCA 5KYVA 1L2FA 4DR4C 1USPA 3FCEA 2V7BA 1MXAA 3T1HC 3L95X 4OXIA 3VNQA 1N32C 3IEVA 3EQ6A 3DLPX 3GKUA 1MD9A 4X65C 4D57A 4JI5C 4ZLPA 5JRHA 1T5DX 2QVYX 3LGXA 3PESA 2ZM6C 4R1LA 3ETOA 3CW9A 2OPLB 1LQLA 4G1IA 2YWCA 4DCVA 1J5EC 4RM3A 3J81D 4JI4C 2QW0X 4AQYC 4DV0C 3FCCA 4MH4A 1FJGC 2XR1A 4RVNA 3IEUA 1BA3A 3A9VA 4NOZA 4DCTA 4JI2C 4DR7C 4IR7A 1XRAA 4L4QA 2Y4NA 4JV5C 4D4IA 5BURA 2VQEC 4XX2A 5BSRA 5DV9A 3VNRA 2DPLA 3NI2A 4GKJC 3E7XA 3CJEA 3H2TA 3CW8X 5KEIA 5BSMA 4LF7C 1WF3A 5BSWA 3TUFA 2P2FA 2D1RA 4BSZA 4LF5C 4DR1C 1O90A 4LFAC 4OX9C 2P2QA 2EGTA 1LCIA 2JMPA 2BH1X 1FUGA 4DV1C 3C5EA 4DUYC 4BCAA 4DV7C 4D4GA 4EATA 5A1IA 4LFBC 4FUTA 5A2QD 2E8FA 3N54B 2YWBA 3G7SA 1N2FA 4K0BA 5KYTA 2D1QA 3I07A 3JAMD 3IPLA 4DR2C 1USPB 1K0RA 4NDNA 4B3RC 4ODJA 1HNXC 3A9UA 2OBVA 4DV3C 3A4IA 4WS9A 5BSVA 2D7VA 2D1SA 1N34C 4PROC 1XMQC 3NYRA 4B3TC 3R9XA 4GXQA 1XMOC 4BC9A 1MDBA 5IWAC 4JI8C 3PROC 1VLAA 4R1MA 3LAXA 1XRCA 4L7IA 3AF6A 4IZ6A 1GPMA 3SO4A 2P20A 2UUBC 2VZEA 4X66C 1RY2A 4RMNA 4GXRA 4KTVA 3GR1A 5A19A 4LE5A 4TPSB 1MKYA 1V25A 2E7GA 1JOSA 4K0KC 2PT7G 5IFIA 1ML8A 1HH2P 4DV4C 3TDEA 1N33C 4X62C 1YJ7A 4NXNC 2PN2A 3DHVA 5BUQA 5FLXD 3R9WA 3IMLA 3I08A 4JI7C 1QM4A 2DYJA 2D27A 3LNVA 3J7AD 3L8CA 1N36C 1RG9A 3DAYA 4MTNA 4LF4C 4DCSA 1IBKC 3GR0A 5AE1A 5CZVA 3ETCA 1PG4A 4BBYA 4BC7A 4DG9A 5BUSA 2UUCC 2F4VC 2WD9A 4FTFA 4KHPC 2YCBA 4JI0C 4DR5C 2QVZX 1HNWC 2E0GA 5T8SA 4DCUA 4ZJZA 1AMUA 2D28C 2UXCC 2Y27A 3KXWA 4B3SC 4PZPA 1XNRC 3LUSA 1ZB9A 1P7LA 2P2JA 4WV3A 4DUZC 4D56A 2ATWA 2VQFC 4B3MC 3UZ0A 1WH9A 2ONFA 1MDFA 1KKGA 2WP0C 1T5HX 4RLFA 4LF9C 3VNSA 4JM1A 1ZB8A 1HR0C 3GPCA 5ADZA 2UXDC 5K85A 4DR3C 5CZXA 1HNZC 4FUQA 2OO4A 2P02A 1EGAA 1NYEA 4YHHC 5T8TA 2KZFA 2Y4OA 1PA4A 3S82A 4LFCC 4JYAC 5K8FA 2QL8A 3PBKA 5BR8C 4DV2C 2OPLA 5LMUC 1O93A 4R0MA 2P2BA 4RLQA 4RVOA 4X64C 4ISBA 4I9GA 5IT9D 3J80D 5H9UA 5BSTA 4KTTA 2QVXX 1PG3A 3RG2A 2E8CA 2VSQA 4G37A 2CY1A 5E7QA 5A1GA 1MXBA 2HHHC 3B7WA 4HPVA 1V26A 2CXCA 3EERA 1MXCA 3NYQA 5AE2A 4GS5A 2AYAA 4NXMC 4U5YD 1XNQC 1IBMC 2UUAC 2E5LC 3TQIA 3NPDA 5LMNC 4YY3C 1XRBA 2P2MA 3N2QA 3RV2A 4RM2A 5BSUA 4DR6C 1QWIA 4I9FA 1O9TA 2HJGA 2E8EA 1IBLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE C;  3AF5 A;  2UU9 C;  4B3M C;  4XX2 A;  4JI1 C;  2UUB C;  4GKJ C;  4X66 C;  4LF8 C;  3CJE A;  1WH9 A;  4JI3 C;  2ONF A;  4LF6 C;  1KKG A;  4LF7 C;  1MKY A;  3OTO C;  1WF3 A;  4LF9 C;  4K0K C;  2E7G A;  1JOS A;  4BSZ A;  2PT7 G;  1ZB8 A;  4LF5 C;  1HR0 C;  1ML8 A;  4DV5 C;  4DR1 C;  1I94 C;  1HH2 P;  4JI6 C;  4DV6 C;  4LFA C;  4OX9 C;  2BJO A;  2ASB A;  4GKK C;  4DV4 C;  2UXD C;  1N33 C;  2UXB C;  4X62 C;  4DR3 C;  1UKK A;  2EGT A;  4NXN C;  1HNZ C;  2PN2 A;  3T1Y C;  5FLX D;  2JMP A;  3R9W A;  4DV1 C;  1L2F A;  1EGA A;  4DUY C;  4DR4 C;  1NYE A;  4JI7 C;  4YHH C;  1USP A;  2KZF A;  1PA4 A;  2DYJ A;  4DV7 C;  4LFC C;  3J7A D;  4JYA C;  1N36 C;  4LFB C;  3T1H C;  5A2Q D;  2QL8 A;  5BR8 C;  4DV2 C;  2E8F A;  1N32 C;  2OPL A;  5LMU C;  3IEV A;  3GKU A;  4MTN A;  4X65 C;  1N2F A;  4JI5 C;  4LF4 C;  4DCS A;  4X64 C;  1IBK C;  3I07 A;  3JAM D;  4DR2 C;  1USP B;  1K0R A;  5IT9 D;  4B3R C;  1HNX C;  3J80 D;  4DV3 C;  2ZM6 C;  2UUC C;  2F4V C;  2E8C A;  2ATW A;  4KHP C;  2D7V A;  2OPL B;  2YCB A;  2CY1 A;  1LQL A;  1N34 C;  4JI0 C;  1XMQ C;  4DCV A;  4DR5 C;  2HHH C;  1J5E C;  4B3T C;  1HNW C;  3R9X A;  3EER A;  2CXC A;  3J81 D;  4JI4 C;  4DCU A;  4DV0 C;  4AQY C;  4MH4 A;  1FJG C;  1XMO C;  2XR1 A;  4NXM C;  2UXC C;  1XNQ C;  3IEU A;  1IBM C;  2UUA C;  2E5L C;  4B3S C;  5IWA C;  5LMN C;  4YY3 C;  4NOZ A;  4DCT A;  4JI8 C;  1XNR C;  3LUS A;  4JI2 C;  1VLA A;  1ZB9 A;  4DR7 C;  4DUZ C;  4DR6 C;  3AF6 A;  1QWI A;  4JV5 C;  2HJG A;  2E8E A;  1IBL C;  2VQF C; 
#chains in the Genus database with same CATH topology
 3AF5 A;  2UU9 C;  1ULT A;  4JI1 C;  4PUH A;  4LF8 C;  4JI3 C;  3UOW A;  4DG8 A;  4PUI A;  4LF6 C;  3OTO C;  4L2Z A;  4PHT A;  5AE3 A;  3TR3 A;  1I94 C;  4DV5 C;  4JI6 C;  4DV6 C;  2ASB A;  4GKK C;  2BJO A;  2D1T A;  2PRO A;  1XS3 A;  2UXB C;  2ZTB A;  3E7W A;  1UKK A;  4G36 A;  3R44 A;  3T1Y C;  5GTD A;  1O92 A;  4OYC A;  5KYV A;  1L2F A;  4DR4 C;  1USP A;  2MM9 A;  3FCE A;  2V7B A;  1MXA A;  3T1H C;  3L95 X;  4OXI A;  3VNQ A;  3UX2 A;  1N32 C;  3IEV A;  3EQ6 A;  3DLP X;  3GKU A;  1MD9 A;  4X65 C;  4D57 A;  4JI5 C;  1M6X A;  4PUG A;  4ZLP A;  3A25 A;  5JRH A;  1T5D X;  2QVY X;  3LGX A;  3PES A;  2ZM6 C;  4R1L A;  3ETO A;  3CW9 A;  2OPL B;  1LQL A;  4G1I A;  2YWC A;  4DCV A;  1J5E C;  1UWD A;  4RM3 A;  3J81 D;  4JI4 C;  2QW0 X;  4AQY C;  4DV0 C;  3FCC A;  4MH4 A;  1FJG C;  2XR1 A;  4RVN A;  3IEU A;  1BA3 A;  3A9V A;  4NOZ A;  4DCT A;  1TH5 A;  4JI2 C;  4DR7 C;  4IR7 A;  1XRA A;  4L4Q A;  2Y4N A;  4JV5 C;  4D4I A;  5BUR A;  2VQE C;  4XX2 A;  5BSR A;  5DV9 A;  3VNR A;  2DPL A;  3NI2 A;  4GKJ C;  3E7X A;  2MCQ A;  3CJE A;  3H2T A;  3CW8 X;  5KEI A;  5BSM A;  4LF7 C;  1WF3 A;  3UX3 A;  5BSW A;  3TUF A;  2P2F A;  2D1R A;  4BSZ A;  4LF5 C;  4DR1 C;  1O90 A;  4LFA C;  4OX9 C;  2P2Q A;  3O2E A;  2EGT A;  2M5O A;  1LCI A;  2JMP A;  2BH1 X;  1FUG A;  1XHJ A;  4DV1 C;  3C5E A;  4DUY C;  1WCJ A;  4BCA A;  4DV7 C;  4D4G A;  4EAT A;  5A1I A;  4LFB C;  4FUT A;  5A2Q D;  2E8F A;  3N54 B;  2YWB A;  3G7S A;  1N2F A;  4K0B A;  5KYT A;  2D1Q A;  3I07 A;  3JAM D;  3IPL A;  4DR2 C;  1USP B;  1K0R A;  4NDN A;  4B3R C;  4ODJ A;  1HNX C;  3A9U A;  2OBV A;  4DV3 C;  3A4I A;  5LCI A;  4WS9 A;  5BSV A;  2D7V A;  2D1S A;  1XDX A;  1N34 C;  4PRO C;  1XMQ C;  3NYR A;  4B3T C;  3R9X A;  3FM7 A;  4GXQ A;  1XMO C;  4BC9 A;  1MDB A;  5IWA C;  4JI8 C;  3PRO C;  1VLA A;  4R1M A;  1FLO A;  3LAX A;  1XRC A;  4L7I A;  3AF6 A;  4IZ6 A;  1GPM A;  3SO4 A;  2P20 A;  2UUB C;  2VZE A;  4X66 C;  1RY2 A;  4RMN A;  4GXR A;  4KTV A;  3GR1 A;  5A19 A;  4LE5 A;  4TPS B;  1MKY A;  3CQ3 A;  1V25 A;  2E7G A;  1JOS A;  4K0K C;  2PT7 G;  5IFI A;  1ML8 A;  1HH2 P;  4DV4 C;  3TDE A;  1N33 C;  4X62 C;  1YJ7 A;  4NXN C;  2PN2 A;  3DHV A;  2M5H A;  5BUQ A;  5FLX D;  1P4E A;  1VEH A;  3R9W A;  3IML A;  3I08 A;  1PU1 A;  4JI7 C;  2PG1 E;  1QM4 A;  2DYJ A;  2D27 A;  3LNV A;  3J7A D;  3AY0 A;  3L8C A;  1N36 C;  1RG9 A;  2YX1 A;  1YGT A;  3DAY A;  3A26 A;  4MTN A;  2MMA B;  4DCS A;  4LF4 C;  1IBK C;  2ZZM A;  3GR0 A;  5AE1 A;  5CZV A;  3ETC A;  1PG4 A;  3CQ1 A;  4BBY A;  4BC7 A;  4DG9 A;  3CQ2 A;  5BUS A;  2UUC C;  2F4V C;  2WD9 A;  4FTF A;  4KHP C;  2YCB A;  4JI0 C;  2ZZN A;  4DR5 C;  2QVZ X;  1HNW C;  2E0G A;  3UEB A;  5T8S A;  4DCU A;  4ZJZ A;  1AMU A;  2D28 C;  2UXC C;  2Y27 A;  3KXW A;  4B3S C;  4PZP A;  1XNR C;  3LUS A;  1NY8 A;  1ZB9 A;  1P7L A;  2P2J A;  4WV3 A;  4DUZ C;  4D56 A;  2ATW A;  2VQF C;  4B3M C;  3UZ0 A;  1WH9 A;  2ONF A;  1MDF A;  2DHM A;  1KKG A;  2WP0 C;  1IB8 A;  1T5H X;  1V60 A;  4RLF A;  4LF9 C;  3VNS A;  4JM1 A;  1ZB8 A;  1HR0 C;  3GPC A;  5ADZ A;  2UXD C;  5K85 A;  4DR3 C;  5CZX A;  1M6X C;  1HNZ C;  4FUQ A;  2OO4 A;  2P02 A;  1EGA A;  1NYE A;  4YHH C;  5T8T A;  2KZF A;  2JNV A;  2Y4O A;  1PA4 A;  3S82 A;  4LFC C;  4JYA C;  5K8F A;  2QL8 A;  3PBK A;  5BR8 C;  4DV2 C;  2OPL A;  5LMU C;  1P4E C;  1O93 A;  4R0M A;  2P2B A;  4RLQ A;  4RVO A;  4X64 C;  4ISB A;  4I9G A;  2NCL A;  2Z51 A;  5IT9 D;  3J80 D;  5H9U A;  5BST A;  4KTT A;  2QVX X;  1PG3 A;  3RG2 A;  2E8C A;  3K6R A;  2VSQ A;  4G37 A;  2CY1 A;  5E7Q A;  5A1G A;  1MXB A;  2HHH C;  3B7W A;  2CU6 A;  2KDN A;  4HPV A;  1V26 A;  2CXC A;  3EER A;  3LNO A;  1MXC A;  3NYQ A;  5AE2 A;  4GS5 A;  2AYA A;  4NXM C;  4U5Y D;  1XNQ C;  1IBM C;  2UUA C;  2E5L C;  3TQI A;  3NPD A;  5LMN C;  4YY3 C;  2KZ0 A;  1XRB A;  2P2M A;  3N2Q A;  3RV2 A;  4RM2 A;  5BSU A;  4DR6 C;  1QWI A;  4I9F A;  1O9T A;  2HJG A;  2E8E A;  1IBL C; 
#chains in the Genus database with same CATH homology
 3AF5 A;  2UU9 C;  1ULT A;  4JI1 C;  4LF8 C;  4JI3 C;  3UOW A;  4DG8 A;  4LF6 C;  3OTO C;  4L2Z A;  4PHT A;  5AE3 A;  1I94 C;  4DV5 C;  4JI6 C;  4DV6 C;  2ASB A;  4GKK C;  2BJO A;  2D1T A;  2PRO A;  2UXB C;  3E7W A;  1UKK A;  4G36 A;  3R44 A;  3T1Y C;  5GTD A;  1O92 A;  4OYC A;  5KYV A;  1L2F A;  4DR4 C;  1USP A;  3FCE A;  2V7B A;  1MXA A;  3T1H C;  3L95 X;  4OXI A;  3VNQ A;  1N32 C;  3IEV A;  3EQ6 A;  3DLP X;  3GKU A;  1MD9 A;  4X65 C;  4D57 A;  4JI5 C;  4ZLP A;  5JRH A;  1T5D X;  2QVY X;  3LGX A;  3PES A;  2ZM6 C;  4R1L A;  3ETO A;  3CW9 A;  2OPL B;  1LQL A;  4G1I A;  2YWC A;  4DCV A;  1J5E C;  4RM3 A;  3J81 D;  4JI4 C;  2QW0 X;  4AQY C;  4DV0 C;  3FCC A;  4MH4 A;  1FJG C;  2XR1 A;  4RVN A;  3IEU A;  1BA3 A;  3A9V A;  4NOZ A;  4DCT A;  4JI2 C;  4DR7 C;  4IR7 A;  1XRA A;  4L4Q A;  2Y4N A;  4JV5 C;  4D4I A;  5BUR A;  2VQE C;  4XX2 A;  5BSR A;  5DV9 A;  3VNR A;  2DPL A;  3NI2 A;  4GKJ C;  3E7X A;  3CJE A;  3H2T A;  3CW8 X;  5KEI A;  5BSM A;  4LF7 C;  1WF3 A;  5BSW A;  3TUF A;  2P2F A;  2D1R A;  4BSZ A;  4LF5 C;  4DR1 C;  1O90 A;  4LFA C;  4OX9 C;  2P2Q A;  2EGT A;  1LCI A;  2JMP A;  2BH1 X;  1FUG A;  4DV1 C;  3C5E A;  4DUY C;  4BCA A;  4DV7 C;  4D4G A;  4EAT A;  5A1I A;  4LFB C;  4FUT A;  5A2Q D;  2E8F A;  3N54 B;  2YWB A;  3G7S A;  1N2F A;  4K0B A;  5KYT A;  2D1Q A;  3I07 A;  3JAM D;  3IPL A;  4DR2 C;  1USP B;  1K0R A;  4NDN A;  4B3R C;  4ODJ A;  1HNX C;  3A9U A;  2OBV A;  4DV3 C;  3A4I A;  4WS9 A;  5BSV A;  2D7V A;  2D1S A;  1N34 C;  4PRO C;  1XMQ C;  3NYR A;  4B3T C;  3R9X A;  4GXQ A;  1XMO C;  4BC9 A;  1MDB A;  5IWA C;  4JI8 C;  3PRO C;  1VLA A;  4R1M A;  3LAX A;  1XRC A;  4L7I A;  3AF6 A;  4IZ6 A;  1GPM A;  3SO4 A;  2P20 A;  2UUB C;  2VZE A;  4X66 C;  1RY2 A;  4RMN A;  4GXR A;  4KTV A;  3GR1 A;  5A19 A;  4LE5 A;  4TPS B;  1MKY A;  1V25 A;  2E7G A;  1JOS A;  4K0K C;  2PT7 G;  5IFI A;  1ML8 A;  1HH2 P;  4DV4 C;  3TDE A;  1N33 C;  4X62 C;  1YJ7 A;  4NXN C;  2PN2 A;  3DHV A;  5BUQ A;  5FLX D;  3R9W A;  3IML A;  3I08 A;  4JI7 C;  1QM4 A;  2DYJ A;  2D27 A;  3LNV A;  3J7A D;  3L8C A;  1N36 C;  1RG9 A;  3DAY A;  4MTN A;  4LF4 C;  4DCS A;  1IBK C;  3GR0 A;  5AE1 A;  5CZV A;  3ETC A;  1PG4 A;  4BBY A;  4BC7 A;  4DG9 A;  5BUS A;  2UUC C;  2F4V C;  2WD9 A;  4FTF A;  4KHP C;  2YCB A;  4JI0 C;  4DR5 C;  2QVZ X;  1HNW C;  2E0G A;  5T8S A;  4DCU A;  4ZJZ A;  1AMU A;  2D28 C;  2UXC C;  2Y27 A;  3KXW A;  4B3S C;  4PZP A;  1XNR C;  3LUS A;  1ZB9 A;  1P7L A;  2P2J A;  4WV3 A;  4DUZ C;  4D56 A;  2ATW A;  2VQF C;  4B3M C;  3UZ0 A;  1WH9 A;  2ONF A;  1MDF A;  1KKG A;  2WP0 C;  1T5H X;  4RLF A;  4LF9 C;  3VNS A;  4JM1 A;  1ZB8 A;  1HR0 C;  3GPC A;  5ADZ A;  2UXD C;  5K85 A;  4DR3 C;  5CZX A;  1HNZ C;  4FUQ A;  2OO4 A;  2P02 A;  1EGA A;  1NYE A;  4YHH C;  5T8T A;  2KZF A;  2Y4O A;  1PA4 A;  3S82 A;  4LFC C;  4JYA C;  5K8F A;  2QL8 A;  3PBK A;  5BR8 C;  4DV2 C;  2OPL A;  5LMU C;  1O93 A;  4R0M A;  2P2B A;  4RLQ A;  4RVO A;  4X64 C;  4ISB A;  4I9G A;  5IT9 D;  3J80 D;  5H9U A;  5BST A;  4KTT A;  2QVX X;  1PG3 A;  3RG2 A;  2E8C A;  2VSQ A;  4G37 A;  2CY1 A;  5E7Q A;  5A1G A;  1MXB A;  2HHH C;  3B7W A;  4HPV A;  1V26 A;  2CXC A;  3EER A;  1MXC A;  3NYQ A;  5AE2 A;  4GS5 A;  2AYA A;  4NXM C;  4U5Y D;  1XNQ C;  1IBM C;  2UUA C;  2E5L C;  3TQI A;  3NPD A;  5LMN C;  4YY3 C;  1XRB A;  2P2M A;  3N2Q A;  3RV2 A;  4RM2 A;  5BSU A;  4DR6 C;  1QWI A;  4I9F A;  1O9T A;  2HJG A;  2E8E A;  1IBL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...