2UUBC

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 43
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
C PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2uubC01
3.30.1140.32 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3, C-terminal domain 2uubC02
1IBMC 2PT7G 4B3SC 2UXCC 4YHHC 4DCVA 4NXNC 4DR3C 2ATWA 4DR5C 1PA4A 2CXCA 1ZB9A 4NXMC 1UKKA 4DR6C 3J80D 2OPLA 5IT9D 1WF3A 4DR7C 1HNZC 3J7AD 1HH2P 4XX2A 4LF8C 4GKKC 2UUBC 1USPA 4DCSA 1ZB8A 4BSZA 1HR0C 2E8EA 1L2FA 2E5LC 1N34C 4K0KC 2CY1A 4JI8C 4OX9C 4AQYC 4JYAC 4JI7C 4LF5C 2ONFA 4JI3C 2ASBA 4DV1C 1IBLC 4JI6C 3IEUA 1I94C 4DCTA 2E7GA 3LUSA 1N36C 5A2QD 2QL8A 2KZFA 2VQEC 4B3TC 4DV6C 4LFAC 4YY3C 4MTNA 1EGAA 4DR4C 4B3RC 3CJEA 4DV5C 2VQFC 4LF6C 1XMQC 4B3MC 4LF7C 4JI2C 4MH4A 1KKGA 2UU9C 2UXBC 5BR8C 1USPB 2XR1A 4JI5C 2UUCC 4KHPC 3AF5A 3GKUA 4DV0C 3I07A 2HJGA 1WH9A 5LMNC 1N32C 4DR2C 3T1YC 1N2FA 4X66C 1HNWC 1XMOC 2JMPA 2UXDC 3JAMD 1K0RA 5LMUC 3R9XA 2E8CA 4JI4C 2OPLB 3OTOC 3T1HC 2UUAC 2F4VC 3EERA 2D7VA 3J81D 4DV3C 3R9WA 2BJOA 4DUYC 4JI1C 1FJGC 3IEVA 1ML8A 4X62C 2EGTA 1IBKC 1MKYA 4DV2C 4GKJC 1N33C 1LQLA 4X65C 1J5EC 1HNXC 1XNRC 5FLXD 4LFBC 2PN2A 4NOZA 4JV5C 1QWIA 1XNQC 4DV7C 4LF9C 2DYJA 4DCUA 4DUZC 1JOSA 4LFCC 4DR1C 1VLAA 4LF4C 4X64C 2ZM6C 2E8FA 3AF6A 2YCBA 4DV4C 4JI0C 5IWAC 1NYEA 2HHHC
chains in the Genus database with same CATH superfamily
4K0BA 3CQ1A 3E7XA 4DCVA 4DR3C 4ZJZA 3CQ3A 1V25A 1MDBA 4GXRA 2P2FA 4PUGA 1XRCA 4NXMC 4FUQA 1UKKA 3TUFA 4DR6C 4G37A 5K8FA 3J80D 2OPLA 4BC9A 4LF8C 2D1RA 1HR0C 2E8EA 2E5LC 5KYVA 4K0KC 2CY1A 4JI7C 2ONFA 4JI3C 4ZLPA 1GPMA 1PU1A 4L7IA 4PUHA 4DCTA 1YGTA 4KTVA 2V7BA 4L4QA 4DV6C 1EGAA 4RM3A 5IFIA 3CJEA 2QVYX 4BCAA 2Z51A 1XMQC 2BH1X 4B3MC 3IMLA 5BR8C 4JI5C 1ULTA 1XHJA 1P4EC 2QVZX 4KHPC 4BBYA 4DV0C 5BSWA 3I07A 2M5OA 3FCCA 3UOWA 5K85A 3A26A 4DR2C 3T1YC 5ADZA 3LNOA 4X66C 1HNWC 2UXDC 4JI4C 1V26A 1WCJA 2CU6A 3R9WA 4DUYC 3IEVA 1V60A 4DV2C 1N33C 3ETOA 2KDNA 4NOZA 5BUQA 5BSTA 4JM1A 5BURA 3TQIA 4DR1C 1VLAA 3G7SA 4GXQA 2ZM6C 4D4GA 3TDEA 2E8FA 3EQ6A 3DAYA 4TPSB 4JI0C 4NXNC 5JRHA 2ATWA 1PA4A 2CXCA 4U5YD 2PROA 1ZB9A 2WP0C 3VNSA 3LAXA 5IT9D 2P2JA 3NPDA 4DR7C 3FCEA 4EATA 1HH2P 4OYCA 2UUBC 1USPA 1ZB8A 4BSZA 5CZXA 1XDXA 5H9UA 1O93A 3K6RA 1L2FA 2KZ0A 4OX9C 4AQYC 2ASBA 1XRBA 1PG4A 2P2MA 1IBLC 3RG2A 1TH5A 4R1LA 5AE1A 2E7GA 3LUSA 1N36C 5A2QD 1RG9A 2WD9A 1MXAA 2QL8A 4NDNA 1NY8A 4KTTA 4B3TC 4B3RC 4DV5C 1FUGA 2Y4NA 4JI2C 1VEHA 3VNRA 2UUCC 4D56A 4PROC 3GKUA 4PUIA 1FLOA 3I08A 1WH9A 5LMNC 1N32C 4DG8A 1N2FA 3JAMD 1K0RA 3R9XA 2E8CA 3T1HC 2UUAC 2F4VC 3EERA 2PG1E 3RV2A 4R0MA 1IBKC 4GKJC 3A9VA 1HNXC 1XNRC 4LFBC 4BC7A 4ODJA 2VZEA 3A25A 5AE2A 4JV5C 1XNQC 5LCIA 3SO4A 4I9FA 2DPLA 3AF6A 3NI2A 1YJ7A 4OXIA 4DV4C 4RLQA 3C5EA 5A1GA 1LCIA 4IZ6A 4B3SC 4DR5C 3GR1A 4L2ZA 2JNVA 2D27A 1PG3A 1O9TA 4FTFA 2D28C 3UZ0A 4D57A 4DG9A 2P20A 4XX2A 4GKKC 3PROC 3NYQA 3KXWA 1P4EA 1N34C 3S82A 1IB8A 4JI8C 4LF5C 2AYAA 2OBVA 3CQ2A 4DV1C 4JI6C 3IEUA 4HPVA 1I94C 3E7WA 3N2QA 3NYRA 3GPCA 2M5HA 2VQEC 4LFAC 5A1IA 3DLPX 2QVXX 4MTNA 4YY3C 4DR4C 4LE5A 2YX1A 1M6XA 4LF7C 4MH4A 1KKGA 2OO4A 1USPB 3B7WA 2Y4OA 3TR3A 2YWBA 3DHVA 5A19A 4D4IA 2HJGA 3UX2A 1XMOC 2JMPA 1UWDA 4RVOA 3FM7A 5LMUC 3IPLA 4G36A 2OPLB 2VSQA 2YWCA 3J81D 4DV3C 2BJOA 4JI1C 1FJGC 3CW9A 1MKYA 4X65C 3H2TA 5BUSA 5FLXD 4PZPA 2PN2A 4IR7A 1MXBA 1QWIA 1XS3A 5KEIA 4ISBA 4LF9C 2DYJA 4DUZC 1T5HX 4LFCC 2ZTBA 4RM2A 4WS9A 4X64C 3L8CA 4G1IA 2ZZNA 1O92A 2MCQA 1NYEA 3LGXA 4PHTA 1IBMC 2PT7G 2UXCC 2P02A 4YHHC 1BA3A 2P2BA 4RLFA 4WV3A 5KYTA 1MDFA 3L95X 5BSRA 5AE3A 5DV9A 2MMAB 1WF3A 3PBKA 2E0GA 1HNZC 3AY0A 3J7AD 4DCSA 1AMUA 1O90A 4FUTA 4JYAC 1P7LA 2ZZMA 4R1MA 2D1SA 3CW8X 2QW0X 2KZFA 3PESA 5BSMA 2VQFC 4LF6C 1M6XC 3UX3A 2UU9C 4I9GA 2UXBC 2XR1A 1QM4A 3AF5A 3GR0A 2P2QA 2D1QA 4RVNA 3A9UA 1XRAA 3ETCA 5E7QA 2DHMA 5GTDA 3OTOC 1T5DX 3R44A 5CZVA 2MM9A 2D7VA 2Y27A 1ML8A 4X62C 2EGTA 2D1TA 3LNVA 1LQLA 1J5EC 5T8TA 3O2EA 1RY2A 4DV7C 4DCUA 1JOSA 1MXCA 2NCLA 3VNQA 3N54B 5BSVA 4RMNA 4LF4C 3UEBA 2YCBA 1MD9A 3A4IA 5T8SA 5IWAC 5BSUA 4GS5A 2HHHC
chains in the Genus database with same CATH topology
4K0BA 3E7XA 4DCVA 4DR3C 4ZJZA 1V25A 1MDBA 4GXRA 2P2FA 1XRCA 4NXMC 4FUQA 1UKKA 3TUFA 4DR6C 4G37A 5K8FA 3J80D 2OPLA 4BC9A 4LF8C 2D1RA 1HR0C 2E8EA 2E5LC 5KYVA 4K0KC 2CY1A 4JI7C 2ONFA 4JI3C 4ZLPA 1GPMA 4L7IA 4DCTA 4KTVA 2V7BA 4L4QA 4DV6C 1EGAA 4RM3A 5IFIA 3CJEA 2QVYX 4BCAA 1XMQC 2BH1X 4B3MC 3IMLA 5BR8C 4JI5C 1ULTA 4KHPC 2QVZX 4BBYA 4DV0C 5BSWA 3I07A 3FCCA 3UOWA 5K85A 4DR2C 3T1YC 5ADZA 4X66C 1HNWC 2UXDC 4JI4C 1V26A 3R9WA 4DUYC 3IEVA 4DV2C 1N33C 3ETOA 4NOZA 5BUQA 5BSTA 4JM1A 5BURA 3TQIA 4DR1C 1VLAA 3G7SA 4GXQA 2ZM6C 4D4GA 3TDEA 2E8FA 3EQ6A 3DAYA 4TPSB 4JI0C 4NXNC 5JRHA 2ATWA 1PA4A 2CXCA 4U5YD 2PROA 1ZB9A 2WP0C 3VNSA 3LAXA 5IT9D 2P2JA 3NPDA 4DR7C 3FCEA 4EATA 1HH2P 4OYCA 2UUBC 1USPA 1ZB8A 4BSZA 5CZXA 5H9UA 1O93A 1L2FA 4OX9C 4AQYC 2ASBA 1XRBA 1PG4A 2P2MA 1IBLC 3RG2A 4R1LA 5AE1A 2E7GA 3LUSA 1N36C 5A2QD 1RG9A 2WD9A 1MXAA 2QL8A 4NDNA 4KTTA 4B3TC 4B3RC 4DV5C 1FUGA 2Y4NA 4JI2C 3VNRA 2UUCC 4D56A 4PROC 3GKUA 3I08A 1WH9A 5LMNC 1N32C 4DG8A 1N2FA 3JAMD 1K0RA 3R9XA 2E8CA 3T1HC 2UUAC 2F4VC 3EERA 3RV2A 4R0MA 1IBKC 4GKJC 3A9VA 1HNXC 1XNRC 4LFBC 4BC7A 4ODJA 2VZEA 5AE2A 4JV5C 1XNQC 3SO4A 4I9FA 2DPLA 3AF6A 3NI2A 4DV4C 1YJ7A 4OXIA 4RLQA 3C5EA 5A1GA 1LCIA 4IZ6A 4B3SC 4DR5C 3GR1A 4L2ZA 2D27A 1PG3A 1O9TA 4FTFA 2D28C 3UZ0A 4D57A 4DG9A 2P20A 4XX2A 4GKKC 3PROC 3NYQA 3KXWA 1N34C 3S82A 4JI8C 4LF5C 2AYAA 2OBVA 4DV1C 4JI6C 3IEUA 4HPVA 1I94C 3E7WA 3N2QA 3NYRA 3GPCA 2VQEC 4LFAC 5A1IA 3DLPX 2QVXX 4MTNA 4YY3C 4DR4C 4LE5A 4LF7C 4MH4A 1KKGA 2OO4A 1USPB 3B7WA 2Y4OA 2YWBA 3DHVA 5A19A 4D4IA 2HJGA 1XMOC 2JMPA 4RVOA 5LMUC 3IPLA 4G36A 2OPLB 2VSQA 2YWCA 3J81D 4DV3C 2BJOA 4JI1C 1FJGC 3CW9A 1MKYA 4X65C 3H2TA 5BUSA 5FLXD 4PZPA 2PN2A 4IR7A 1MXBA 1QWIA 5KEIA 4ISBA 4LF9C 2DYJA 4DUZC 1T5HX 4LFCC 4RM2A 4WS9A 4X64C 3L8CA 4G1IA 1O92A 1NYEA 3LGXA 4PHTA 1IBMC 2PT7G 2UXCC 2P02A 4YHHC 1BA3A 2P2BA 4RLFA 4WV3A 5KYTA 1MDFA 3L95X 5BSRA 5AE3A 5DV9A 1WF3A 3PBKA 2E0GA 1HNZC 3J7AD 4DCSA 1AMUA 1O90A 4FUTA 4JYAC 1P7LA 4R1MA 2D1SA 3CW8X 2QW0X 2KZFA 3PESA 5BSMA 2VQFC 4LF6C 2UU9C 4I9GA 2UXBC 2XR1A 1QM4A 3AF5A 3GR0A 2P2QA 2D1QA 4RVNA 3A9UA 1XRAA 3ETCA 5E7QA 5GTDA 3OTOC 1T5DX 3R44A 5CZVA 2D7VA 2Y27A 1ML8A 4X62C 2EGTA 2D1TA 3LNVA 1LQLA 1J5EC 5T8TA 1RY2A 4DV7C 4DCUA 1JOSA 1MXCA 3VNQA 3N54B 5BSVA 4RMNA 4LF4C 2YCBA 1MD9A 3A4IA 5T8SA 5IWAC 5BSUA 4GS5A 2HHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM C;  2PT7 G;  4B3S C;  2UXC C;  4YHH C;  4DCV A;  4NXN C;  4DR3 C;  2ATW A;  4DR5 C;  1PA4 A;  2CXC A;  1ZB9 A;  4NXM C;  1UKK A;  4DR6 C;  3J80 D;  2OPL A;  5IT9 D;  1WF3 A;  4DR7 C;  1HNZ C;  3J7A D;  1HH2 P;  4XX2 A;  4LF8 C;  4GKK C;  2UUB C;  1USP A;  4DCS A;  1ZB8 A;  4BSZ A;  1HR0 C;  2E8E A;  1L2F A;  2E5L C;  1N34 C;  4K0K C;  2CY1 A;  4JI8 C;  4OX9 C;  4AQY C;  4JYA C;  4JI7 C;  4LF5 C;  2ONF A;  4JI3 C;  2ASB A;  4DV1 C;  1IBL C;  4JI6 C;  3IEU A;  1I94 C;  4DCT A;  2E7G A;  3LUS A;  1N36 C;  5A2Q D;  2QL8 A;  2KZF A;  2VQE C;  4B3T C;  4DV6 C;  4LFA C;  4YY3 C;  4MTN A;  1EGA A;  4DR4 C;  4B3R C;  3CJE A;  4DV5 C;  2VQF C;  4LF6 C;  1XMQ C;  4B3M C;  4LF7 C;  4JI2 C;  4MH4 A;  1KKG A;  2UU9 C;  2UXB C;  5BR8 C;  1USP B;  2XR1 A;  4JI5 C;  2UUC C;  4KHP C;  3AF5 A;  3GKU A;  4DV0 C;  3I07 A;  2HJG A;  1WH9 A;  5LMN C;  1N32 C;  4DR2 C;  3T1Y C;  1N2F A;  4X66 C;  1HNW C;  1XMO C;  2JMP A;  2UXD C;  3JAM D;  1K0R A;  5LMU C;  3R9X A;  2E8C A;  4JI4 C;  2OPL B;  3OTO C;  3T1H C;  2UUA C;  2F4V C;  3EER A;  2D7V A;  3J81 D;  4DV3 C;  3R9W A;  2BJO A;  4DUY C;  4JI1 C;  1FJG C;  3IEV A;  1ML8 A;  4X62 C;  2EGT A;  1IBK C;  1MKY A;  4DV2 C;  4GKJ C;  1N33 C;  1LQL A;  4X65 C;  1J5E C;  1HNX C;  1XNR C;  5FLX D;  4LFB C;  2PN2 A;  4NOZ A;  4JV5 C;  1QWI A;  1XNQ C;  4DV7 C;  4LF9 C;  2DYJ A;  4DCU A;  4DUZ C;  1JOS A;  4LFC C;  4DR1 C;  1VLA A;  4LF4 C;  4X64 C;  2ZM6 C;  2E8F A;  3AF6 A;  2YCB A;  4DV4 C;  4JI0 C;  5IWA C;  1NYE A;  2HHH C; 
#chains in the Genus database with same CATH topology
 4K0B A;  3CQ1 A;  3E7X A;  4DCV A;  4DR3 C;  4ZJZ A;  3CQ3 A;  1V25 A;  1MDB A;  4GXR A;  2P2F A;  4PUG A;  1XRC A;  4NXM C;  4FUQ A;  1UKK A;  3TUF A;  4DR6 C;  4G37 A;  5K8F A;  3J80 D;  2OPL A;  4BC9 A;  4LF8 C;  2D1R A;  1HR0 C;  2E8E A;  2E5L C;  5KYV A;  4K0K C;  2CY1 A;  4JI7 C;  2ONF A;  4JI3 C;  4ZLP A;  1GPM A;  1PU1 A;  4L7I A;  4PUH A;  4DCT A;  1YGT A;  4KTV A;  2V7B A;  4L4Q A;  4DV6 C;  1EGA A;  4RM3 A;  5IFI A;  3CJE A;  2QVY X;  4BCA A;  2Z51 A;  1XMQ C;  2BH1 X;  4B3M C;  3IML A;  5BR8 C;  4JI5 C;  1ULT A;  1XHJ A;  1P4E C;  2QVZ X;  4KHP C;  4BBY A;  4DV0 C;  5BSW A;  3I07 A;  2M5O A;  3FCC A;  3UOW A;  5K85 A;  3A26 A;  4DR2 C;  3T1Y C;  5ADZ A;  3LNO A;  4X66 C;  1HNW C;  2UXD C;  4JI4 C;  1V26 A;  1WCJ A;  2CU6 A;  3R9W A;  4DUY C;  3IEV A;  1V60 A;  4DV2 C;  1N33 C;  3ETO A;  2KDN A;  4NOZ A;  5BUQ A;  5BST A;  4JM1 A;  5BUR A;  3TQI A;  4DR1 C;  1VLA A;  3G7S A;  4GXQ A;  2ZM6 C;  4D4G A;  3TDE A;  2E8F A;  3EQ6 A;  3DAY A;  4TPS B;  4JI0 C;  4NXN C;  5JRH A;  2ATW A;  1PA4 A;  2CXC A;  4U5Y D;  2PRO A;  1ZB9 A;  2WP0 C;  3VNS A;  3LAX A;  5IT9 D;  2P2J A;  3NPD A;  4DR7 C;  3FCE A;  4EAT A;  1HH2 P;  4OYC A;  2UUB C;  1USP A;  1ZB8 A;  4BSZ A;  5CZX A;  1XDX A;  5H9U A;  1O93 A;  3K6R A;  1L2F A;  2KZ0 A;  4OX9 C;  4AQY C;  2ASB A;  1XRB A;  1PG4 A;  2P2M A;  1IBL C;  3RG2 A;  1TH5 A;  4R1L A;  5AE1 A;  2E7G A;  3LUS A;  1N36 C;  5A2Q D;  1RG9 A;  2WD9 A;  1MXA A;  2QL8 A;  4NDN A;  1NY8 A;  4KTT A;  4B3T C;  4B3R C;  4DV5 C;  1FUG A;  2Y4N A;  4JI2 C;  1VEH A;  3VNR A;  2UUC C;  4D56 A;  4PRO C;  3GKU A;  4PUI A;  1FLO A;  3I08 A;  1WH9 A;  5LMN C;  1N32 C;  4DG8 A;  1N2F A;  3JAM D;  1K0R A;  3R9X A;  2E8C A;  3T1H C;  2UUA C;  2F4V C;  3EER A;  2PG1 E;  3RV2 A;  4R0M A;  1IBK C;  4GKJ C;  3A9V A;  1HNX C;  1XNR C;  4LFB C;  4BC7 A;  4ODJ A;  2VZE A;  3A25 A;  5AE2 A;  4JV5 C;  1XNQ C;  5LCI A;  3SO4 A;  4I9F A;  2DPL A;  3AF6 A;  3NI2 A;  1YJ7 A;  4OXI A;  4DV4 C;  4RLQ A;  3C5E A;  5A1G A;  1LCI A;  4IZ6 A;  4B3S C;  4DR5 C;  3GR1 A;  4L2Z A;  2JNV A;  2D27 A;  1PG3 A;  1O9T A;  4FTF A;  2D28 C;  3UZ0 A;  4D57 A;  4DG9 A;  2P20 A;  4XX2 A;  4GKK C;  3PRO C;  3NYQ A;  3KXW A;  1P4E A;  1N34 C;  3S82 A;  1IB8 A;  4JI8 C;  4LF5 C;  2AYA A;  2OBV A;  3CQ2 A;  4DV1 C;  4JI6 C;  3IEU A;  4HPV A;  1I94 C;  3E7W A;  3N2Q A;  3NYR A;  3GPC A;  2M5H A;  2VQE C;  4LFA C;  5A1I A;  3DLP X;  2QVX X;  4MTN A;  4YY3 C;  4DR4 C;  4LE5 A;  2YX1 A;  1M6X A;  4LF7 C;  4MH4 A;  1KKG A;  2OO4 A;  1USP B;  3B7W A;  2Y4O A;  3TR3 A;  2YWB A;  3DHV A;  5A19 A;  4D4I A;  2HJG A;  3UX2 A;  1XMO C;  2JMP A;  1UWD A;  4RVO A;  3FM7 A;  5LMU C;  3IPL A;  4G36 A;  2OPL B;  2VSQ A;  2YWC A;  3J81 D;  4DV3 C;  2BJO A;  4JI1 C;  1FJG C;  3CW9 A;  1MKY A;  4X65 C;  3H2T A;  5BUS A;  5FLX D;  4PZP A;  2PN2 A;  4IR7 A;  1MXB A;  1QWI A;  1XS3 A;  5KEI A;  4ISB A;  4LF9 C;  2DYJ A;  4DUZ C;  1T5H X;  4LFC C;  2ZTB A;  4RM2 A;  4WS9 A;  4X64 C;  3L8C A;  4G1I A;  2ZZN A;  1O92 A;  2MCQ A;  1NYE A;  3LGX A;  4PHT A;  1IBM C;  2PT7 G;  2UXC C;  2P02 A;  4YHH C;  1BA3 A;  2P2B A;  4RLF A;  4WV3 A;  5KYT A;  1MDF A;  3L95 X;  5BSR A;  5AE3 A;  5DV9 A;  2MMA B;  1WF3 A;  3PBK A;  2E0G A;  1HNZ C;  3AY0 A;  3J7A D;  4DCS A;  1AMU A;  1O90 A;  4FUT A;  4JYA C;  1P7L A;  2ZZM A;  4R1M A;  2D1S A;  3CW8 X;  2QW0 X;  2KZF A;  3PES A;  5BSM A;  2VQF C;  4LF6 C;  1M6X C;  3UX3 A;  2UU9 C;  4I9G A;  2UXB C;  2XR1 A;  1QM4 A;  3AF5 A;  3GR0 A;  2P2Q A;  2D1Q A;  4RVN A;  3A9U A;  1XRA A;  3ETC A;  5E7Q A;  2DHM A;  5GTD A;  3OTO C;  1T5D X;  3R44 A;  5CZV A;  2MM9 A;  2D7V A;  2Y27 A;  1ML8 A;  4X62 C;  2EGT A;  2D1T A;  3LNV A;  1LQL A;  1J5E C;  5T8T A;  3O2E A;  1RY2 A;  4DV7 C;  4DCU A;  1JOS A;  1MXC A;  2NCL A;  3VNQ A;  3N54 B;  5BSV A;  4RMN A;  4LF4 C;  3UEB A;  2YCB A;  1MD9 A;  3A4I A;  5T8S A;  5IWA C;  5BSU A;  4GS5 A;  2HHH C; 
#chains in the Genus database with same CATH homology
 4K0B A;  3E7X A;  4DCV A;  4DR3 C;  4ZJZ A;  1V25 A;  1MDB A;  4GXR A;  2P2F A;  1XRC A;  4NXM C;  4FUQ A;  1UKK A;  3TUF A;  4DR6 C;  4G37 A;  5K8F A;  3J80 D;  2OPL A;  4BC9 A;  4LF8 C;  2D1R A;  1HR0 C;  2E8E A;  2E5L C;  5KYV A;  4K0K C;  2CY1 A;  4JI7 C;  2ONF A;  4JI3 C;  4ZLP A;  1GPM A;  4L7I A;  4DCT A;  4KTV A;  2V7B A;  4L4Q A;  4DV6 C;  1EGA A;  4RM3 A;  5IFI A;  3CJE A;  2QVY X;  4BCA A;  1XMQ C;  2BH1 X;  4B3M C;  3IML A;  5BR8 C;  4JI5 C;  1ULT A;  4KHP C;  2QVZ X;  4BBY A;  4DV0 C;  5BSW A;  3I07 A;  3FCC A;  3UOW A;  5K85 A;  4DR2 C;  3T1Y C;  5ADZ A;  4X66 C;  1HNW C;  2UXD C;  4JI4 C;  1V26 A;  3R9W A;  4DUY C;  3IEV A;  4DV2 C;  1N33 C;  3ETO A;  4NOZ A;  5BUQ A;  5BST A;  4JM1 A;  5BUR A;  3TQI A;  4DR1 C;  1VLA A;  3G7S A;  4GXQ A;  2ZM6 C;  4D4G A;  3TDE A;  2E8F A;  3EQ6 A;  3DAY A;  4TPS B;  4JI0 C;  4NXN C;  5JRH A;  2ATW A;  1PA4 A;  2CXC A;  4U5Y D;  2PRO A;  1ZB9 A;  2WP0 C;  3VNS A;  3LAX A;  5IT9 D;  2P2J A;  3NPD A;  4DR7 C;  3FCE A;  4EAT A;  1HH2 P;  4OYC A;  2UUB C;  1USP A;  1ZB8 A;  4BSZ A;  5CZX A;  5H9U A;  1O93 A;  1L2F A;  4OX9 C;  4AQY C;  2ASB A;  1XRB A;  1PG4 A;  2P2M A;  1IBL C;  3RG2 A;  4R1L A;  5AE1 A;  2E7G A;  3LUS A;  1N36 C;  5A2Q D;  1RG9 A;  2WD9 A;  1MXA A;  2QL8 A;  4NDN A;  4KTT A;  4B3T C;  4B3R C;  4DV5 C;  1FUG A;  2Y4N A;  4JI2 C;  3VNR A;  2UUC C;  4D56 A;  4PRO C;  3GKU A;  3I08 A;  1WH9 A;  5LMN C;  1N32 C;  4DG8 A;  1N2F A;  3JAM D;  1K0R A;  3R9X A;  2E8C A;  3T1H C;  2UUA C;  2F4V C;  3EER A;  3RV2 A;  4R0M A;  1IBK C;  4GKJ C;  3A9V A;  1HNX C;  1XNR C;  4LFB C;  4BC7 A;  4ODJ A;  2VZE A;  5AE2 A;  4JV5 C;  1XNQ C;  3SO4 A;  4I9F A;  2DPL A;  3AF6 A;  3NI2 A;  4DV4 C;  1YJ7 A;  4OXI A;  4RLQ A;  3C5E A;  5A1G A;  1LCI A;  4IZ6 A;  4B3S C;  4DR5 C;  3GR1 A;  4L2Z A;  2D27 A;  1PG3 A;  1O9T A;  4FTF A;  2D28 C;  3UZ0 A;  4D57 A;  4DG9 A;  2P20 A;  4XX2 A;  4GKK C;  3PRO C;  3NYQ A;  3KXW A;  1N34 C;  3S82 A;  4JI8 C;  4LF5 C;  2AYA A;  2OBV A;  4DV1 C;  4JI6 C;  3IEU A;  4HPV A;  1I94 C;  3E7W A;  3N2Q A;  3NYR A;  3GPC A;  2VQE C;  4LFA C;  5A1I A;  3DLP X;  2QVX X;  4MTN A;  4YY3 C;  4DR4 C;  4LE5 A;  4LF7 C;  4MH4 A;  1KKG A;  2OO4 A;  1USP B;  3B7W A;  2Y4O A;  2YWB A;  3DHV A;  5A19 A;  4D4I A;  2HJG A;  1XMO C;  2JMP A;  4RVO A;  5LMU C;  3IPL A;  4G36 A;  2OPL B;  2VSQ A;  2YWC A;  3J81 D;  4DV3 C;  2BJO A;  4JI1 C;  1FJG C;  3CW9 A;  1MKY A;  4X65 C;  3H2T A;  5BUS A;  5FLX D;  4PZP A;  2PN2 A;  4IR7 A;  1MXB A;  1QWI A;  5KEI A;  4ISB A;  4LF9 C;  2DYJ A;  4DUZ C;  1T5H X;  4LFC C;  4RM2 A;  4WS9 A;  4X64 C;  3L8C A;  4G1I A;  1O92 A;  1NYE A;  3LGX A;  4PHT A;  1IBM C;  2PT7 G;  2UXC C;  2P02 A;  4YHH C;  1BA3 A;  2P2B A;  4RLF A;  4WV3 A;  5KYT A;  1MDF A;  3L95 X;  5BSR A;  5AE3 A;  5DV9 A;  1WF3 A;  3PBK A;  2E0G A;  1HNZ C;  3J7A D;  4DCS A;  1AMU A;  1O90 A;  4FUT A;  4JYA C;  1P7L A;  4R1M A;  2D1S A;  3CW8 X;  2QW0 X;  2KZF A;  3PES A;  5BSM A;  2VQF C;  4LF6 C;  2UU9 C;  4I9G A;  2UXB C;  2XR1 A;  1QM4 A;  3AF5 A;  3GR0 A;  2P2Q A;  2D1Q A;  4RVN A;  3A9U A;  1XRA A;  3ETC A;  5E7Q A;  5GTD A;  3OTO C;  1T5D X;  3R44 A;  5CZV A;  2D7V A;  2Y27 A;  1ML8 A;  4X62 C;  2EGT A;  2D1T A;  3LNV A;  1LQL A;  1J5E C;  5T8T A;  1RY2 A;  4DV7 C;  4DCU A;  1JOS A;  1MXC A;  3VNQ A;  3N54 B;  5BSV A;  4RMN A;  4LF4 C;  2YCB A;  1MD9 A;  3A4I A;  5T8S A;  5IWA C;  5BSU A;  4GS5 A;  2HHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...